Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05698g70269134860.0
Kwal_14.181268467310871e-139
Scas_686.196636829621e-120
Scas_563.106666748801e-108
YBR216C (YBP1)6746958581e-105
YGL060W (YBP2)6416417692e-92
CAGL0K06743g6556697526e-90
AAR159C6134736178e-71
CAGL0F06985g6306614122e-42
CAGL0K07502g21364648.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05698g
         (691 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05698g complement(508204..510312) weakly similar to sp|P38...  1347   0.0  
Kwal_14.1812                                                          423   e-139
Scas_686.19                                                           375   e-120
Scas_563.10                                                           343   e-108
YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein wit...   335   e-105
YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in ...   300   2e-92
CAGL0K06743g complement(656238..658205) similar to sp|P38315 Sac...   294   6e-90
AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH] (63...   242   8e-71
CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces c...   163   2e-42
CAGL0K07502g 741520..742161 no similarity, possibly noncoding, h...    29   8.7  

>KLLA0C05698g complement(508204..510312) weakly similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, start by similarity
          Length = 702

 Score = 1347 bits (3486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/691 (95%), Positives = 662/691 (95%)

Query: 1   MPLEVERFKEIEEKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLL 60
           MPLEVERFKEIEEKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLL
Sbjct: 1   MPLEVERFKEIEEKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLL 60

Query: 61  QQNKDVVYEIGWDLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFF 120
           QQNKDVVYEIGWDLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFF
Sbjct: 61  QQNKDVVYEIGWDLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFF 120

Query: 121 AGCELMSSLRINDESLVRFIVEEEPVMDPENEDSGDETYXXXXXXXXXXXXXXXXNAVKD 180
           AGCELMSSLRINDESLVRFIVEEEPVMDPENEDSGDETY                NAVKD
Sbjct: 121 AGCELMSSLRINDESLVRFIVEEEPVMDPENEDSGDETYTEDEGSSDKTEEEEEKNAVKD 180

Query: 181 SPTPKSANESIPDLKEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEA 240
           SPTPKSANESIPDLKEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEA
Sbjct: 181 SPTPKSANESIPDLKEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEA 240

Query: 241 VEAFSRFNLQNNEDVDDCLFILRRLYSFIRGYIPPSPPPDADKQVSAXXXXXXXXXXXXX 300
           VEAFSRFNLQNNEDVDDCLFILRRLYSFIRGYIPPSPPPDADKQVSA             
Sbjct: 241 VEAFSRFNLQNNEDVDDCLFILRRLYSFIRGYIPPSPPPDADKQVSAEELEEIKVSEEVL 300

Query: 301 QRKLLCNILTSALHQLLKARTCISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLAT 360
           QRKLLCNILTSALHQLLKARTCISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLAT
Sbjct: 301 QRKLLCNILTSALHQLLKARTCISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLAT 360

Query: 361 SFDIDVSAEFKRLCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVK 420
           SFDIDVSAEFKRLCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVK
Sbjct: 361 SFDIDVSAEFKRLCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVK 420

Query: 421 EILLDPAGILILRSFSNEDFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLAR 480
           EILLDPAGILILRSFSNEDFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLAR
Sbjct: 421 EILLDPAGILILRSFSNEDFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLAR 480

Query: 481 TWILFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCL 540
           TWILFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCL
Sbjct: 481 TWILFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCL 540

Query: 541 LPEDFAFNFIRDTLLSCPYEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIKN 600
           LPEDFAFNFIRDTLLSCPYEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIKN
Sbjct: 541 LPEDFAFNFIRDTLLSCPYEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIKN 600

Query: 601 SPPPLPSRAYMLLNDDRIATLHSITLLAIDSCAADPESKKVKTLLTYLNFLNAFLTKWDS 660
           SPPPLPSRAYMLLNDDRIATLHSITLLAIDSCAADPESKKVKTLLTYLNFLNAFLTKWDS
Sbjct: 601 SPPPLPSRAYMLLNDDRIATLHSITLLAIDSCAADPESKKVKTLLTYLNFLNAFLTKWDS 660

Query: 661 VFLKEICDAVNDKLIKNEKVGDKDEPHYSLL 691
           VFLKEICDAVNDKLIKNEKVGDKDEPHYSLL
Sbjct: 661 VFLKEICDAVNDKLIKNEKVGDKDEPHYSLL 691

>Kwal_14.1812
          Length = 684

 Score =  423 bits (1087), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 249/673 (36%), Positives = 380/673 (56%), Gaps = 48/673 (7%)

Query: 13  EKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGW 72
           +KL  AF E K D ++L+TI+DLY+ EVN K   E+K ++L  +L  +Q +  ++ ++GW
Sbjct: 9   DKLNHAFDECKEDPLSLITIIDLYASEVNKKEGGEEKAQFLEILLKRIQDDHHLIQQVGW 68

Query: 73  DLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLRIN 132
           DLPK+LI+FI+  N +          +   +KCFNE+AL GN KECF  GCEL+  L ++
Sbjct: 69  DLPKVLIRFINTRNVDLNTRLLYNGVVATSLKCFNEIALHGNAKECFLTGCELLGELELH 128

Query: 133 DESLVRFIVEEEPVMDPENEDSGDETYXXXXXXXXXXXXXXXXNAVKDSPTPKSANESIP 192
                      E V +   ED+ +                    A+K   TP+ AN   P
Sbjct: 129 ---------PSEKVQEEHEEDATEAV-------------EVEAQAIKS--TPEEANG--P 162

Query: 193 DLKEGYAF------YGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSR 246
            +    +         R P+E++ E++ + ++EL+ STL+RI T +PS+FL+ AV +   
Sbjct: 163 KMNAQTSSRTVVRPLSRDPEELVLEVKLHMLLELINSTLRRIRTCYPSRFLAMAVSSIFS 222

Query: 247 FNLQNNEDVDDCLFILRRLYSFIRGYIPPSPPPDADKQVSAXXXXXXXXXXXXXQRKLLC 306
           F   N+ D+DD  F+LRR+Y+F R +IPP    +A K +S              QRKLL 
Sbjct: 223 FVRSNSIDIDDTTFVLRRVYTFARNFIPPQSNAEAYKDMSTEEILKVRDDEEALQRKLLR 282

Query: 307 NILTSALHQLLKARTCISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDV 366
            +LT ++ QL++ R       Y   L+   T     E    L  ILSRYYQLA SFDIDV
Sbjct: 283 CLLTFSIGQLVRPRVLNIATEYFFRLKNKYTTDFEYEMRVNLKHILSRYYQLAYSFDIDV 342

Query: 367 SAEFKRLCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLDP 426
             EF + CV +S  IY+SLP DSE+ +D     IT  VYQL+Y+Y +++  N K + LDP
Sbjct: 343 KEEFLKQCVKDSSAIYQSLPNDSELINDAARNGITQLVYQLSYSYGLQRSINEKNLSLDP 402

Query: 427 AGILILRSFSNEDFLPPS---DAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWI 483
           AG+L+L   + + +L      D+ I    AIYMYLRFVTP M++   +N  + D    W+
Sbjct: 403 AGLLVL---ATQHYLETGQILDSTIRADCAIYMYLRFVTPEMYNPAMKNTYACDCCNFWL 459

Query: 484 LFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPE 543
             A+T +S  D  ++L+++PSY+   +LQ  L+++  +  ++ R   F++LTR+LCL+PE
Sbjct: 460 WVAVTKSSCKDSKEALQNIPSYLSLTFLQILLLKSFNETLEHARMVSFTLLTRLLCLMPE 519

Query: 544 DFAFNFIRDTLLSCPYEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDMEKLKI----- 598
           +  F F +DTLLSCP+   KCC L ILKD+M +  K+P      +LA ++ +LK+     
Sbjct: 520 ETTFEFAKDTLLSCPFIDLKCCMLGILKDLMLNS-KIPV----SNLATELSELKLSEDEK 574

Query: 599 KNSPPPLPSRAYMLLNDDRIATLHSITLLAIDSCAADPESKKVKTLLTYLNFLNAFLTKW 658
            +S PPLPSR ++++N+DR+AT+HS+ LL+ +    + +   ++  LTY+NF      KW
Sbjct: 575 SHSKPPLPSRPFIMINEDRMATIHSLALLSFEDTIENADKGNLRLSLTYINFFVGLRLKW 634

Query: 659 DSVFLKEICDAVN 671
           D   L E+  A +
Sbjct: 635 DKHLLAEVEGAAS 647

>Scas_686.19
          Length = 663

 Score =  375 bits (962), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 232/682 (34%), Positives = 368/682 (53%), Gaps = 58/682 (8%)

Query: 15  LLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGWDL 74
           L+ AF E   D ++L  IL++Y +++N  G ++ K ++L+ +L L++ + DVV  I WD 
Sbjct: 11  LVNAFDEYSDDSVSLTAILEMYIDQINMDGEIDDKEQFLTALLGLMKDHPDVVARISWDF 70

Query: 75  PKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLRINDE 134
           PK ++KF+   N +          ++++MKCFNE+A    PKEC   GCEL+S+L + +E
Sbjct: 71  PKEILKFLTTANVDVTKRLGYSVIISLVMKCFNEIAFSAEPKECLLTGCELLSNLSLENE 130

Query: 135 SLVRFIVEEEPVMDPENEDSGDETYXXXXXXXXXXXXXXXXNAVKDSPTPKSANESIPDL 194
           +     +E E        + GD T                        +    + S  ++
Sbjct: 131 N-----IELEM-------EQGDHT-----------------------NSKGQTHYSSAEI 155

Query: 195 KEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQNNED 254
            + +A   R P +    ++ Y + EL+G+TL+RI TL+PSK+L  A  A  RF   N + 
Sbjct: 156 GKYHA--ERTPADFFVSVKMYILFELIGTTLQRIPTLNPSKYLGLATSAMIRFIKANCDG 213

Query: 255 VDDCLFILRRLYSFIRGYIPP--SPPPDADKQVSAXXXXXXXXXXXXXQRKLLCNILTSA 312
           ++D   ++RR++SF R Y+PP  S     D+ ++              QR++L N+ T  
Sbjct: 214 INDVRIVMRRIFSFCRNYVPPDTSLCVIKDRSLTKEDLIRIEERELASQRRILRNLCTIG 273

Query: 313 LHQLLKARTCISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFKR 372
           L   LKA    + + Y   L    T  T + +   ++++ SR++ LA SFDID+  EF  
Sbjct: 274 LETCLKAINGRTDVKYFYFLSN--TEFTLAGFYKDISEVNSRFFNLALSFDIDIKKEFLE 331

Query: 373 LCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLDPAGILIL 432
            CV  S  IY+ LPKDS I S+E  K I   VY+LAY+YE+++IA  K + LDP GI+IL
Sbjct: 332 -CVKTSHDIYKGLPKDSSIGSEEAKKLIQQTVYKLAYSYELQRIAKHKNVQLDPLGIVIL 390

Query: 433 RS---FSNEDFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWILFALTN 489
                   +  L P   +IT+++AIY+YLR  TPS+FS  +EN S   + R W+  ++TN
Sbjct: 391 SGVYYMETDKHLYP---QITVKDAIYLYLRCTTPSLFSKFYENFSVESVVRYWLWVSITN 447

Query: 490 NSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNF 549
           +S+  L   L++LPSY++T +LQT L + C Q N+ +R   F++ TRILCL+PE   F F
Sbjct: 448 HSSAVLRKELEELPSYLLTTFLQTFLSKNCKQPNEEIRMVSFTLFTRILCLIPEAVTFKF 507

Query: 550 IRDTLLSCPYEQAKCCALAILKDMMQHERKVPQ--KSDEDD-LAKDMEKLKI---KNSPP 603
           I +TL +  Y   K   L ILKD+M   R       +D D+ L+  + KLKI   KN   
Sbjct: 508 ILETLTASSYPHVKSSVLGILKDLMSKRRSCQDLCANDNDEALSNSLAKLKINSKKNEGA 567

Query: 604 PLPSRAYMLLNDDRIATLHSITLLAIDSCAADPESK-KVKTLLTYLNFLNAFLTKWDSVF 662
            + S+ Y+ ++++R+  +H + L AI+S   +  ++  +  +L YL F N   ++WD   
Sbjct: 568 GVESQVYVEVSEERMNEIHHLALRAINSLEEEKTTRANIILILNYLEFFNGLHSEWDKSL 627

Query: 663 LKEICDAVNDKLIKNEKVGDKD 684
           L+ I D + DK+   E   D+D
Sbjct: 628 LQSIHDEIEDKV---ENCSDED 646

>Scas_563.10
          Length = 666

 Score =  343 bits (880), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 231/674 (34%), Positives = 353/674 (52%), Gaps = 58/674 (8%)

Query: 11  IEEKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEI 70
           I  KL  AF E+K D +TLVTI+D+Y +E+N  GS+++K +YL  + SLL  N  ++ EI
Sbjct: 12  IYAKLTRAFEEQKEDPVTLVTIIDMYGQEINEDGSIDEKNKYLEHLCSLLNDNPHILREI 71

Query: 71  GWDLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLR 130
            WDLPK L++F+   N +          ++ +MKCFNE+A+ GNPKEC  A CEL+S L 
Sbjct: 72  SWDLPKGLLEFLSLENIDVHKRLADSSIVSNVMKCFNEIAINGNPKECLLAACELLSELT 131

Query: 131 INDESLVRFIVEEEPVMDPENEDSGDETYXXXXXXXXXXXXXXXXNAVKDSPTPKSANES 190
           +            EPVM                               KD+   K+  + 
Sbjct: 132 V------------EPVM---------------------ENETEEEEGGKDNK--KTDGDE 156

Query: 191 IPDLKEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQ 250
            P       +  R   E I  L+ Y+I +L+ STL RI+TL+PSKFL+ A+ A  +F   
Sbjct: 157 TPTDLNSSDYIERDLTEFIPSLKVYAIFQLLNSTLGRIITLYPSKFLNMAISAIMKFMAT 216

Query: 251 NNEDVDDCLFILRRLYSFIRGYIPPSPPPDA--DKQVSAXXXXXXXXXXXXXQRKLLCNI 308
           N  D+ D  F+LRR++ F   Y   +P         ++              Q KL+  +
Sbjct: 217 NINDIADVTFLLRRIHEFCNNYDVHAPDRKLIDGSDLNDEEIKKLTDDEFDLQNKLIKEL 276

Query: 309 LTSALHQLLKARTCISLLNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSA 368
             SAL   LK +     + Y   L        S  Y      I ++Y  L   + ID+  
Sbjct: 277 FCSALSICLKNQPTTFDVKYFESLTH-QKFEESEHY----AVIRTQYLGLVNKYKIDIKE 331

Query: 369 EFKRLCVDESVRIYRSLPKDSEIKSDEELKEITN-FVYQLAYTYEVEKIANVKEILLDPA 427
           EF + C+ ES +IY SLP D + +SDE+ K   N  +YQL+Y Y+++KI+N   + +D  
Sbjct: 332 EFLQ-CLQESRQIYESLPSDID-ESDEKKKSALNQVIYQLSYRYQMQKISNQDTLEIDFN 389

Query: 428 GILILR-SFSNE---DFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWI 483
            I++L  S+  E     LP    +I++Q+A+Y+YLR  T S++S  F N +   + R W+
Sbjct: 390 SIILLSGSYYAETGLHLLP----QISIQDAVYLYLRCSTISLYSDTFSNEAVKGVTRYWL 445

Query: 484 LFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPE 543
             A+T +   ++  +L  +PS+  TV+LQ  L+  C + +  +R   F++LTRILCL+PE
Sbjct: 446 WVAITQSPIKEIEQNLLKIPSHFNTVFLQMLLLNNCNEKDGKIRMATFTLLTRILCLMPE 505

Query: 544 DFAFNFIRDTLLSCPYEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIKNSPP 603
           D +F FI DTLL+CPY  AK   LAILKD+M  + ++ +  +E+    D+     KN  P
Sbjct: 506 DLSFQFILDTLLTCPYNSAKSSVLAILKDLMLKDNQISKPLEEELSTLDISSE--KNKGP 563

Query: 604 PLPSRAYMLLNDDRIATLHSITLLAIDSCAA--DPESK-KVKTLLTYLNFLNAFLTKWDS 660
            LP R Y+L+N+DR+A+LHS+  + I +     +P  + ++  LL Y+NF  +   KW+ 
Sbjct: 564 TLPPRPYILINEDRMASLHSVASMCISNLKLLDNPNKRTELSLLLNYMNFFISLRYKWNV 623

Query: 661 VFLKEICDAVNDKL 674
             L+ I D V+ KL
Sbjct: 624 NLLQIIHDEVDAKL 637

>YBR216C (YBP1) [397] chr2 complement(655533..657557) Protein with
           moderate similarity to S. cerevisiae Ygl060p, which is
           involved in stress resistance [2025 bp, 674 aa]
          Length = 674

 Score =  335 bits (858), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 219/695 (31%), Positives = 353/695 (50%), Gaps = 71/695 (10%)

Query: 18  AFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGWDLPKI 77
           AF  +K D++ LVT++D+Y E+VN +GS E+K  ++  + +LL+ N     EIGWDLPK 
Sbjct: 14  AFKTQKEDLLELVTLIDIYGEQVNQEGSYEEKTRFIETLNTLLEDNPSTTGEIGWDLPKG 73

Query: 78  LIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSL------RI 131
           L+KF+   N +  G   +   +  +MKCF  +++ G PK+C   G EL+SSL      + 
Sbjct: 74  LLKFLSKDNVDVNGRLGTNMIVQGVMKCFYAISIQGEPKKCLITGLELLSSLCSKDFSKS 133

Query: 132 NDESLVRFIVEEEPVMDPEN--EDSGDETYXXXXXXXXXXXXXXXXNAVKDSPTPKSANE 189
           + ++   F+ ++   + PE   E+S +                      KD P+   +  
Sbjct: 134 DQQNKEDFVDKKANTLPPEGVIENSSNR---------------------KDFPSYGESKS 172

Query: 190 SIPDLKEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNL 249
           S                E   +L+ Y + E +G++LKRI TL PSK+L  AV    +F  
Sbjct: 173 S---------------NEFFLKLKSYILFEFIGASLKRISTLFPSKYLGAAVSTIEKFVY 217

Query: 250 QNNEDVDDCLFILRRLYSFIRGYIPPSPPPDA--DKQVSAXXXXXXXXXXXXXQRKLLCN 307
            + +  +D LF+LRR+Y+F R YIPP PP D   ++  +              Q +LL  
Sbjct: 218 SHADTFEDALFLLRRVYTFCRNYIPPDPPKDIQLNEDFTREMFDKVVEEESELQVRLLRR 277

Query: 308 ILTSALHQLLKARTCISLLNYHSHL--QGIPTLSTSSEYLGQLTDILSRYYQLATSFDID 365
           + T  +   +K  T  + + Y+  L  Q     +  +EYL    ++  RYYQ+A S D+D
Sbjct: 278 LCTFGISTPIKTVTTNADVKYYCALNQQKFELSAYYTEYL----ELFCRYYQMAFSLDVD 333

Query: 366 VSAEFKRLCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLD 425
           +  EF+ + + E   IY+S+P++    +DE    +   VY+LAYT+EV+K A  K + LD
Sbjct: 334 IEGEFQNV-IKECRIIYKSVPQEISAVNDEAKLVLERMVYKLAYTFEVQKAAKEKNVGLD 392

Query: 426 PAGILILRSFSNEDFLPPSD---AKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTW 482
             G+++   FS   +L  +     ++ + +AIY+YLRF TPS++S ++ N +   ++R W
Sbjct: 393 YNGVIL---FSGIHYLETNQHLVKEMNITDAIYLYLRFTTPSLYSKVYYNVAVESVSRYW 449

Query: 483 ILFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLP 542
           + +A+T     D+   LK+L  ++    L   L + C+Q+N  LR   F++LTR+LCL+P
Sbjct: 450 LWYAITTEPLEDVKKELKNLSVFVTKTLLHVLLQKNCIQVNQQLRMITFTLLTRLLCLIP 509

Query: 543 EDFAFNFIRDTLLSCPYEQAKCCALAILKDMMQHERKVPQKSDEDDL-AKDMEKLKIKNS 601
           E  AF FI D L + P   AK   L + KD+ +          E DL  + + KLK+ +S
Sbjct: 510 EKVAFEFILDVLKTSPLPLAKTSVLCVFKDLSRRRISTKDNDSETDLIVEKLSKLKVNDS 569

Query: 602 PPPLPS--RAYMLLNDDRIATLHSITLLAI-DSCAADPESKKVKTLLTYLNFLNAFLTKW 658
                S  R Y+ L+  ++  +H   L  I DS  AD +   +  LLTYLN        W
Sbjct: 570 NKAQQSNIRHYIQLDSSKMKAVHDCCLQTIQDSFTADAKKSDILLLLTYLNIFIVLKKTW 629

Query: 659 DSVFLKEICDAVN--------DKLIKNEKVGDKDE 685
           D   LK +C  ++        DKL K +++ DK+E
Sbjct: 630 DEDLLKIVCSKIDSNLKSVEPDKLPKYKEIVDKNE 664

>YGL060W (YBP2) [1919] chr7 (390068..391993) Protein involved in
           stress resistance [1926 bp, 641 aa]
          Length = 641

 Score =  300 bits (769), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 201/641 (31%), Positives = 324/641 (50%), Gaps = 60/641 (9%)

Query: 35  LYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGWDLPKILIKFIHWGNNNHLGADR 94
           +Y+E+VN   S+++K  YL  +L +L+ N   + EIGWDLPK L++F    N N      
Sbjct: 1   MYNEQVNSGKSIKEKERYLDALLKILKDNPVTLKEIGWDLPKGLLQFFSRKNINVNIHLV 60

Query: 95  SKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLRINDESLVRFIVEEEPVMDPENEDS 154
               ++ +M+CFNE+A+ GNPKEC    CEL+S+L I        ++ E    D ENED 
Sbjct: 61  FSPLVSSVMECFNELAINGNPKECLLTACELVSTLHI--------VLTETGDSDEENEDL 112

Query: 155 GDETYXXXXXXXXXXXXXXXXNAVKDSPTPKSANESIPDLKEGYAFYGRLPQEVITELRF 214
            D                      ++  +  +   S+   + G+ +  +   E I  L+ 
Sbjct: 113 NDSN--------------------RNDASNITDELSVITPEIGH-YMAKNTVEFIPNLKI 151

Query: 215 YSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQNNEDVDDCLFILRRLYSFIRGYIP 274
           Y + E M   LKR+ TL+PSKFL+    A  ++   N + +DD  FILR +Y+F   Y P
Sbjct: 152 YVLFEFMSLLLKRVDTLYPSKFLAMVTSAIIKYVTTNVQAMDDPHFILRIVYNFCTNYSP 211

Query: 275 PSPPPDADKQVSAXXXXXXXXXXXXXQRKLLCNILTSALHQLLKARTCISLLNYHSHLQG 334
             P       +S              Q+KLL N+    +   LK        N+  ++  
Sbjct: 212 AQPSASLTDGISTNDLEKIHDDESALQKKLLANLSVFVISNCLK--------NHPGNIDK 263

Query: 335 I--PTL----STSSEYLGQLTDILSRYYQLATSFDIDVSAEFKRLCVDESVRIYRSLPKD 388
           I   TL    +  +E    +  I  +YY+  TS D+ +  E    C+ ES  IY SL  +
Sbjct: 264 IYFKTLMHKKTDENEIDASVLQICHQYYEYVTSLDVHMK-ELLEKCLVESRSIYNSLLMN 322

Query: 389 SEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLDPAGILILRSF---SNEDFLPPSD 445
               + E  +EI   VY+++Y Y+++K+A+ K + LD  G++IL +     N   L P  
Sbjct: 323 PAASTPEFKEEINQLVYEVSYAYQIKKLADEKNLELDQYGVVILSAIHYSKNGTHLLP-- 380

Query: 446 AKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWILFALTNNSTHDLMDSLKDLPSY 505
            +I +Q AIY+YLR  T S+FS ++EN+      R W+  + T  ST  +  +L++LP +
Sbjct: 381 -QIDIQSAIYLYLRCTTASLFSEIYENKFLESSVRYWLWVSTTETSTEKIKCALQELPGH 439

Query: 506 IITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNFIRDTLLSCPYEQAKCC 565
           I T +LQ  L++ C + N++ + T+ ++L R+L L+PE  +F FI +TLL CPY  AK  
Sbjct: 440 ITTAFLQMLLMKTCNESNNDTKLTEITLLRRLLYLMPESTSFTFIFETLLHCPYITAKIA 499

Query: 566 ALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIKNSP------PPLPSRAYMLLNDDRIA 619
            L IL+DMM    + P+ ++ D+    +E+    N+       P LP R Y+ +N+DR+A
Sbjct: 500 VLDILRDMM---IRSPEAANRDETVGLIEQQNPGNTANSVPIMPTLPPRPYITINEDRMA 556

Query: 620 TLHSITLLAIDSCAADPESKK-VKTLLTYLNFLNAFLTKWD 659
           ++HSI L+   +      ++  +  +LTY+ F  +   KWD
Sbjct: 557 SIHSIALICFSAAKQKKRTQGDLLLVLTYMKFFVSLRNKWD 597

>CAGL0K06743g complement(656238..658205) similar to sp|P38315
           Saccharomyces cerevisiae YBR216c, hypothetical start
          Length = 655

 Score =  294 bits (752), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 203/669 (30%), Positives = 340/669 (50%), Gaps = 62/669 (9%)

Query: 8   FKEIEEKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVV 67
           F+E+ + L  +F ++K D +TLVT++D  SEEV+    +++K ++L  +L+LL+ + ++V
Sbjct: 5   FEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKEKEQFLELLLNLLEADTELV 64

Query: 68  YEIGWDLPKILIKFIHWGNNNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMS 127
             +GWDLP+ L++F +  N  +    R  K +T+ M  FN +AL   P+EC     EL+S
Sbjct: 65  SAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFNLLALHAKPQECLVTTLELLS 124

Query: 128 SLRINDESLVRFIVEEEPVMDPENEDSGDETYXXXXXXXXXXXXXXXXNAVKDSPTPKSA 187
            L   +      IVEE   +  +  D+                            T +  
Sbjct: 125 ELNFKN------IVEECHQLSEDGSDNN---------------------------TAEED 151

Query: 188 NESIPDLKEGYAFYGRLPQEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRF 247
           N+++ D  +      R   E+I  ++ Y++ EL GS ++R+ TLHPSK+L EAV A  ++
Sbjct: 152 NDAVEDYMK-----DRDQPEIIFGVKSYALFELAGSLIRRVATLHPSKYLEEAVTAIRKY 206

Query: 248 NLQNNEDVDDCLFILRRLYSFIRGYIPPSPPPD--ADKQVSAXXXXXXXXXXXXXQRKLL 305
              N E V+D  FILRR+++F RGYIPP PP     D +++              Q +LL
Sbjct: 207 VTNNTEVVEDVKFILRRVFAFCRGYIPPEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLL 266

Query: 306 CNILTSALHQLLKARTCISLLNYHSHLQGIPTLSTSS----EYLGQLTDILSRYYQLATS 361
            N+ T ++        C+  LN  + +     L        E+   + DI+SRYYQ+A S
Sbjct: 267 RNLCTFSVAY------CVKFLNDKTEVVYFHKLINKDLQLPEFYRSVHDIISRYYQIAFS 320

Query: 362 FDIDVSAEFKRLCVDESVRIYRSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKE 421
           FDID++ EF  + + E+  IY  + K     ++ +    ++ + +  Y YEV+K A  KE
Sbjct: 321 FDIDLNDEFNDI-LRETRGIYEDVIKRINETNNTDKNAKSDILLKAGYYYEVQKTAREKE 379

Query: 422 ILLDPAGILILRSFS---NEDFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDL 478
           I  D  GI++L  F+   N D L      I + +A+Y+YLRF + S+FS    N +   +
Sbjct: 380 INPDTKGIILLSGFNYIENGDHL----IDIDIADALYLYLRFASESLFSPTCHNVTIEGV 435

Query: 479 ARTWILFALTNNSTHDLMDSLKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRIL 538
           AR WI  ALT    + L + L +L   ++   L   L++ C Q+N+ +R   F+++TRIL
Sbjct: 436 ARYWIWAALTTTDNNILKEKLAELSPLVLHSVLNLLLVKNCHQVNEEIRMITFTLITRIL 495

Query: 539 CLLPEDFAFNFIRDTLLSCPYEQAKCCALAILKDM-MQHERKV-PQKSDEDDLAKDMEKL 596
           CLLPE+ ++ F+ D L +C     K C L IL+D+ ++ +  V    +D +DL++ M +L
Sbjct: 496 CLLPENCSYEFLMDELDNCAVVFGKSCVLGILRDLVIKVDHSVSSNNTDTEDLSESMAQL 555

Query: 597 KIKNSPPPLPSRAYMLLNDDRIATLHSITLLAIDSCAADPESKKVKTLLTYLNFLNAFLT 656
           KI N       + ++ L+  R   +  + +  +       +   +  +L Y+ F + F  
Sbjct: 556 KINNEKR--AKKTFITLDPKRAGEIEDLAIKTLKETKKSMKKDYILLVLNYIKFFSTFAH 613

Query: 657 KWDSVFLKE 665
           KW+   L E
Sbjct: 614 KWNKSKLNE 622

>AAR159C [347] [Homologous to ScYBR216C - SH; ScYGL060W - SH]
           (630860..632701) [1842 bp, 613 aa]
          Length = 613

 Score =  242 bits (617), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 155/473 (32%), Positives = 246/473 (52%), Gaps = 35/473 (7%)

Query: 206 QEVITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRFNLQNNEDVDDCLFILRRL 265
           +E +  L+F+ ++E + +TL R  T +PS+FL E +    +   +N +++ D   +LRRL
Sbjct: 139 REEMFALKFHMLMEFVTTTLGRTTTAYPSRFLGEIIGVLVKLVERNADELCDVHLLLRRL 198

Query: 266 YSFIRGYIPPSPPPDADKQVSAXXXXXXXXXXXXXQRKLLCNILTSALHQLLKARTCISL 325
           Y+F R Y  P         VS+             QR L  + L  AL QLL+ ++    
Sbjct: 199 YTFCRDYTAP---------VSSSEDEELRAQEDYLQRTLFRSFLAYALAQLLRRQSVRWA 249

Query: 326 LNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFKRLCVDESVRIYRSL 385
             Y +   G+       +++ +L + L RY+QLA SFDID+   F++ C+ ES  +Y  +
Sbjct: 250 PEYFAKSHGLE-FKLHDDHV-ELRETLGRYFQLAHSFDIDIEGAFQKQCILESRDVYACV 307

Query: 386 PKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEILLDPAGILILRSFSNEDFLPPSD 445
             D++     E+      +YQLAYTYE++KIA ++ + +D  GI +L    + +   P  
Sbjct: 308 SADADKADGAEV------IYQLAYTYELKKIAELQSMPIDARGIFVLAVLHHFETGKPIC 361

Query: 446 AKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWILFALTNNSTHDLMDSLKDLPSY 505
             + L +AIYM+LRF TP ++S  F N +  D +  ++L AL  NS  +    +++ P  
Sbjct: 362 LSLRLDDAIYMFLRFNTPEIYSKSFGNIAVTDASLYFVLLALEGNSHEENHKLVREFPQT 421

Query: 506 IITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNFIRDTLLSCPYEQAKCC 565
           +  V++Q  L+  C   +  + R   SIL R+L L  E  AF+F+ DTLL CPYE AK  
Sbjct: 422 VFAVFIQVLLLNMCRLPSREIGRMTHSILARVLFLASETTAFDFVIDTLLQCPYETAKQI 481

Query: 566 ALAILKDMMQHE------RKVPQKSDEDDLAKDMEKLKIKNSPPPLPSRAYMLLNDDRIA 619
            L I K MM  +      R VP  +  D  A            PPLP R ++ LNDDR+A
Sbjct: 482 ILEIAKIMMVSDQYTICTRDVPSHTRTDTKA------------PPLPPRPFIKLNDDRMA 529

Query: 620 TLHSITLLAIDSCAADPESKKVKTLLTYLNFLNAFLTKWDSVFLKEICDAVND 672
             H++ +++   C    + K++ TLL+YLN +     KWD V L+E+  AV++
Sbjct: 530 AFHTLAMMSAKFCTETEDPKQLTTLLSYLNLITVLRKKWDQVLLRELTVAVSN 582

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 67/125 (53%), Gaps = 6/125 (4%)

Query: 13  EKLLTAFVEEKSDIITLVTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQNKDVVYEIGW 72
           E L   F E+  D+I+L   ++L +E+    G+  +   +L  +   L+++  +V ++GW
Sbjct: 10  ESLGVLFAEQAGDVISLAAGIELCAEQALASGNAGRVASFLEALWEQLREHPALVGDLGW 69

Query: 73  DLPKILIKFIHWGN---NNHLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSL 129
           D+PK+L++ I   N   N  LG D   + L   + CF EV   GN +ECF  GC+ ++ L
Sbjct: 70  DIPKVLVRCIRADNFNLNEGLGDDMVWRLL---VGCFREVGREGNARECFLTGCQQLAEL 126

Query: 130 RINDE 134
            +  E
Sbjct: 127 SVAAE 131

>CAGL0F06985g 684832..686724 similar to sp|P53169 Saccharomyces
           cerevisiae YGL060w, hypothetical start
          Length = 630

 Score =  163 bits (412), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 168/661 (25%), Positives = 284/661 (42%), Gaps = 108/661 (16%)

Query: 30  VTILDLYSEEVNFKGSLEQKYEYLSEVLSLLQQ-NKDVVYEIGWDLPKILIKFIHWGNNN 88
           +T L L  E +N     E +  +  E+  LL Q    +  E+ W LPK LIK I   N  
Sbjct: 24  ITYLVLLEECINGLSGSEDQALFFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKNV- 82

Query: 89  HLGADRSKKFLTVIMKCFNEVALFGNPKECFFAGCELMSSLRINDESLVRFIVEEEPVMD 148
                  K  +  I  C   VA  G     F  G EL+   R  D ++            
Sbjct: 83  -----EDKALVKAICNCMKLVARVGTDDYNFLFGTELLRECRAEDTNIY----------- 126

Query: 149 PENEDSGDETYXXXXXXXXXXXXXXXXNAVKDSPTPKSANESIPDLKEGYAFYGRLPQEV 208
               D  ++TY                                       AF  R+  E+
Sbjct: 127 ----DDSNDTYILE------------------------------------AFKVRV--EL 144

Query: 209 ITELRFYSIIELMGSTLKRIVTLHPSKFLSEAVEAFSRF---NLQNNEDVDDCLFILRRL 265
           + E      ++ +G T       +PSKFLS  V A       N+Q  E+++    +L  +
Sbjct: 145 LLEEFILPALKTLGQT-------NPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVI 197

Query: 266 YSFIRGYIPPSPPPDADKQVSAXXXXXXXXXXXXXQRKLLCNILTSALHQLLKARTCISL 325
             F   Y  PS       +V+               +K+L +  + ++ + +K ++C   
Sbjct: 198 IRFYDSYELPSA------KVTTPDGAMANKDEEDIVQKILESFWSFSIGRCIKNQSCFP- 250

Query: 326 LNYHSHLQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFKRL---CVDESVRIY 382
              +  L  IP +    + +    D + +   +    +  +  + +++   C +E+ +IY
Sbjct: 251 --EYILLSQIPRMDFVKQEIDVPDDFIIKSRNIIRITNEKLQLDLQKMMEACFEETRKIY 308

Query: 383 RSLPKDSEIKSDEELKEITNFVYQLAYTYEVEKIANVKEIL-LDPAGILILRSF---SNE 438
             LP +  ++   +L   T  +YQ++Y   V  +   K  L LD AG+L L      +N+
Sbjct: 309 ELLPPNPTVQDGNDL---TEEIYQMSYVNGVTTLEEQKGKLSLDTAGVLTLSGLYYIAND 365

Query: 439 DFLPPSDAKITLQEAIYMYLRFVTPSMFSALFENRSSHDLARTWIL-FALTNNSTHDLMD 497
           + L   + KI L +A+ +YLRF + S++S +F+N     + R W+  + L  N   + + 
Sbjct: 366 NKL---NVKINLYDAVLLYLRFSSASLYSPIFDNTFVEGICRFWLWSYTLGENRDKNTLQ 422

Query: 498 S-LKDLPSYIITVYLQTELIRACLQINDNLRRTQFSILTRILCLLPEDFAFNFIRDTLLS 556
           S L  +P Y++ V+ Q  L++ C + +   +R  F++LT++L     + AF+FI DT+LS
Sbjct: 423 SELMSVPDYVLKVFFQLLLLKTCNEASTLQKRINFNLLTQLLAFSNAEVAFDFIVDTILS 482

Query: 557 CPYEQAKCCALAILKDMMQHERKVPQKSDEDDLAKDMEKLKIK----NSPPPLPSRAYML 612
           CPY  AK     ILKD+M       +KSD+  L K+  ++K +    N PP LP R  + 
Sbjct: 483 CPYLDAKIAIAGILKDLM------AKKSDDIHL-KEARQVKNEPNNHNCPPKLPDRPPIT 535

Query: 613 LNDDRIATLHSITLLAIDSCAADPESKKVKTLLT---YLNFLNAFLTKWDSVFLKEICDA 669
           +++ RIA++HS+  L I+ C     +K    L+    Y+N L     +WD   LKEI D 
Sbjct: 536 VDEHRIASIHSLVKLCIEDCLKPLNNKTQGNLILLQYYINILITLYKQWDGFLLKEINDE 595

Query: 670 V 670
           +
Sbjct: 596 I 596

>CAGL0K07502g 741520..742161 no similarity, possibly noncoding,
           hypothetical start
          Length = 213

 Score = 29.3 bits (64), Expect = 8.7,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 324 SLLNYHSH--LQGIPTLSTSSEYLGQLTDILSRYYQLATSFDIDVSAEFKRLCVDESVRI 381
           S+L+Y  H  +     +S SS  LG  T +L  +  LATS +  V +E +R+C+  S+R 
Sbjct: 147 SVLHYTLHHIISTCIAISMSSRVLGYNTWLLFPFV-LATS-NKHVGSELQRMCLPSSLRN 204

Query: 382 YRSL 385
           YR++
Sbjct: 205 YRTM 208

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,654,320
Number of extensions: 994153
Number of successful extensions: 3209
Number of sequences better than 10.0: 22
Number of HSP's gapped: 3288
Number of HSP's successfully gapped: 26
Length of query: 691
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 582
Effective length of database: 12,822,747
Effective search space: 7462838754
Effective search space used: 7462838754
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)