Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0C05676g51150318020.0
AAR158W571613352e-33
YBR215W (HPC2)623693353e-33
Kwal_14.1817547613307e-33
Scas_686.20515653032e-29
CAGL0K06721g438492491e-22
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0C05676g
         (503 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0C05676g 506539..508074 weakly similar to sp|Q01448 Saccharo...   698   0.0  
AAR158W [346] [Homologous to ScYBR215W (HPC2) - SH] complement(6...   133   2e-33
YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for ...   133   3e-33
Kwal_14.1817                                                          131   7e-33
Scas_686.20                                                           121   2e-29
CAGL0K06721g 654788..656104 some similarities with sp|Q01448 Sac...   100   1e-22

>KLLA0C05676g 506539..508074 weakly similar to sp|Q01448
           Saccharomyces cerevisiae YBR215w HPC2 cell cycle
           regulatory protein singleton, start by similarity
          Length = 511

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/503 (72%), Positives = 367/503 (72%)

Query: 1   MNEVXXXXXXXXXXXXXXXXXXLTDEQPPTKKMKVVPNIAEELAKNRSPPLSNSHNNVKK 60
           MNEV                  LTDEQPPTKKMKVVPNIAEELAKNRSPPLSNSHNNVKK
Sbjct: 1   MNEVTASDNNSASSSTSGSTSALTDEQPPTKKMKVVPNIAEELAKNRSPPLSNSHNNVKK 60

Query: 61  QISISSLLSDPQPPKPVIRAPTIILPSQRPGTSNIEETDTNDILIARTKSPVSVLLDRPQ 120
           QISISSLLSDPQPPKPVIRAPTIILPSQRPGTSNIEETDTNDILIARTKSPVSVLLDRPQ
Sbjct: 61  QISISSLLSDPQPPKPVIRAPTIILPSQRPGTSNIEETDTNDILIARTKSPVSVLLDRPQ 120

Query: 121 SNTQNPTDSHDRGLTIPVTSIDTLLKNGSAMSTAPATDSTNAALKINGDGDSTKIEPAXX 180
           SNTQNPTDSHDRGLTIPVTSIDTLLKNGSAMSTAPATDSTNAALKINGDGDSTKIEPA  
Sbjct: 121 SNTQNPTDSHDRGLTIPVTSIDTLLKNGSAMSTAPATDSTNAALKINGDGDSTKIEPASS 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXVPRXXXXXXXXXXXXXXXXXXXXXXXXXXEPVKKDSRAX 240
                                VPR                          EPVKKDSRA 
Sbjct: 181 TTSSTKDQKTKGKTKEETNNKVPRTTAKNTKSAASKSAKNSKATTAKNKKEPVKKDSRAK 240

Query: 241 XXXXXXXXXXPKSESSTPGSTIATLSNNTPEVSALNETKVKLEQTELETAXXXXXXXXXX 300
                     PKSESSTPGSTIATLSNNTPEVSALNETKVKLEQTELETA          
Sbjct: 241 QDNKNKQDNKPKSESSTPGSTIATLSNNTPEVSALNETKVKLEQTELETADNKEDAKKDK 300

Query: 301 XXXXXVETPRKLVPAPSIKSPKVTSMEVNGKPIVVLDIPLHDVSSNDYLDENGQVVFNVY 360
                VETPRKLVPAPSIKSPKVTSMEVNGKPIVVLDIPLHDVSSNDYLDENGQVVFNVY
Sbjct: 301 SKKKKVETPRKLVPAPSIKSPKVTSMEVNGKPIVVLDIPLHDVSSNDYLDENGQVVFNVY 360

Query: 361 NLIQEKYGSQLNKAKRNLMVDLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           NLIQEKYGSQLNKAKRNLMVDLN                                     
Sbjct: 361 NLIQEKYGSQLNKAKRNLMVDLNDDVEAAEDNEGEEAADIEHGGEDDDDDDDDDDEEEED 420

Query: 421 XXXXXXPSKNKDNSVSPKKKRPHPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFF 480
                 PSKNKDNSVSPKKKRPHPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFF
Sbjct: 421 DVAASDPSKNKDNSVSPKKKRPHPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFF 480

Query: 481 VYFGPLIEKGQYASFQRVDGTMK 503
           VYFGPLIEKGQYASFQRVDGTMK
Sbjct: 481 VYFGPLIEKGQYASFQRVDGTMK 503

>AAR158W [346] [Homologous to ScYBR215W (HPC2) - SH]
           complement(628892..628910,628995..630691) [1716 bp, 571
           aa]
          Length = 571

 Score =  133 bits (335), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 54/61 (88%), Positives = 61/61 (100%)

Query: 443 HPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIEKGQYASFQRVDGTM 502
           +P+KGKSR+GKYDIEDPFIDDSELLWEEQRAAT+DGFFVYFGPLI+KGQYA+F+RVDGTM
Sbjct: 503 NPMKGKSRVGKYDIEDPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQYATFERVDGTM 562

Query: 503 K 503
           K
Sbjct: 563 K 563

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 48/80 (60%), Gaps = 10/80 (12%)

Query: 307 ETPRKLVPAPSIKSPKV----------TSMEVNGKPIVVLDIPLHDVSSNDYLDENGQVV 356
            TP+ L PA  IKSP V          T       P++V+D+PL+ V +NDYLDENGQVV
Sbjct: 371 HTPKVLAPAQPIKSPSVMDVLDQKFIGTQAAEEDDPVIVVDVPLYQVDTNDYLDENGQVV 430

Query: 357 FNVYNLIQEKYGSQLNKAKR 376
           FN YNL+ EK+ +Q N   R
Sbjct: 431 FNFYNLVHEKFNTQQNSQSR 450

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 31 KKMKVVPNIAEELAKNRS 48
          KK K +PNIA ELAKNR+
Sbjct: 37 KKQKSIPNIANELAKNRA 54

>YBR215W (HPC2) [396] chr2 (653403..655274) Protein required for
           regulation of histone gene transcription throughout the
           cell cycle [1872 bp, 623 aa]
          Length = 623

 Score =  133 bits (335), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 1/69 (1%)

Query: 435 VSPKKKRPHPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIEKGQYAS 494
           +SPKKK  HP+KGK+ IGKYD+EDPFIDDSELLWEEQRAAT+DGFFVYFGPLIEKG YAS
Sbjct: 549 ISPKKK-SHPMKGKNLIGKYDVEDPFIDDSELLWEEQRAATKDGFFVYFGPLIEKGHYAS 607

Query: 495 FQRVDGTMK 503
            +R +GTMK
Sbjct: 608 LERANGTMK 616

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 58/85 (68%), Gaps = 8/85 (9%)

Query: 306 VETPRKLVPAPSIKSPKV-TSMEVNGK-PIVVLDIPLHDVSSNDYLDENGQVVFNVYNLI 363
            ++P++LV AP++  PK+  + E   K P +++D+PL+   +NDYLDENGQV+FN+  LI
Sbjct: 420 AKSPKRLVAAPTVSPPKILQTAETKAKEPSILIDVPLYQADTNDYLDENGQVIFNLSTLI 479

Query: 364 QEKYG------SQLNKAKRNLMVDL 382
           +EKY       +QL  +KRNL++ L
Sbjct: 480 KEKYHPKSKELAQLKDSKRNLLMQL 504

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 14/61 (22%)

Query: 63  SISSLLSDPQPPKPVIRAPTIILPSQRPGTSNIEETDTND---------ILIARTKSPVS 113
           SI SL+  P  P+     P +ILP+Q     N++ T   D         ILIA+T SPV+
Sbjct: 212 SIESLIKPPSSPRNKSLTPKVILPTQ-----NMDGTIAKDPHLGDNTPGILIAKTSSPVN 266

Query: 114 V 114
           +
Sbjct: 267 L 267

>Kwal_14.1817
          Length = 547

 Score =  131 bits (330), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 53/61 (86%), Positives = 58/61 (95%)

Query: 443 HPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIEKGQYASFQRVDGTM 502
           HP+KG+S IGKYD EDPFIDDSELLWEEQR AT+DGFFVYFGPLIEKGQYASF+RV+GTM
Sbjct: 479 HPMKGRSLIGKYDTEDPFIDDSELLWEEQRVATKDGFFVYFGPLIEKGQYASFERVNGTM 538

Query: 503 K 503
           K
Sbjct: 539 K 539

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 8/83 (9%)

Query: 308 TPRKLVPAPSIKSPKVTSM-------EVNGKPIVVLDIPLHDVSSNDYLDENGQVVFNVY 360
           +PRKL+P   +K P +          +   +P++++D+PL+   SN+YLDENGQVVFN Y
Sbjct: 351 SPRKLLPTAPLKMPSLLDSLDETKNPDDQEEPVILIDVPLYPAESNNYLDENGQVVFNFY 410

Query: 361 NLIQEKYGSQLNKAKRNLMVDLN 383
            L+ +K+G Q  KAKRNL+ +L+
Sbjct: 411 KLVNDKFG-QPAKAKRNLITELH 432

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 49/109 (44%), Gaps = 19/109 (17%)

Query: 80  APTIILPSQRPGTSNIEETDTNDILIARTKSPVSVLLDRPQSNTQNPTDSHDRGLTIPVT 139
           A  IILP+Q+   +         IL+ART SPVS L   P++N  N   +  +    P+ 
Sbjct: 74  AQKIILPTQK-VVAKAASDPVPGILVARTSSPVSAL---PKTN--NTALNRSQSTLSPLN 127

Query: 140 SIDTLLKNG------------SAMSTAPATDSTNAALKINGDGDSTKIE 176
           SI T    G            S++S+ PA   T AA K NG    TK E
Sbjct: 128 SIKTASGEGKTAALAGKTASLSSISSKPAVKRT-AAKKENGSVKKTKPE 175

>Scas_686.20
          Length = 515

 Score =  121 bits (303), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 50/65 (76%), Positives = 57/65 (87%)

Query: 439 KKRPHPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIEKGQYASFQRV 498
           KKR HP+KGKS IGKYDIEDPFIDDSELLWEEQ+A+T++GFFVYFGPLIEKGQ AS ++V
Sbjct: 443 KKRSHPMKGKSMIGKYDIEDPFIDDSELLWEEQQASTKEGFFVYFGPLIEKGQLASIEKV 502

Query: 499 DGTMK 503
               K
Sbjct: 503 SSNTK 507

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 334 VVLDIPLHDVSSNDYLDENGQVVFNVYNLIQE--KYGS----QLNKAKRNLMVDLN 383
           V+L+IPL+   +N+YLDENG VVFNV+ LIQE  K  S     L K KRNL   LN
Sbjct: 326 VILNIPLYSTQNNEYLDENGSVVFNVFKLIQEDKKVNSNDLQNLKKMKRNLFTQLN 381

>CAGL0K06721g 654788..656104 some similarities with sp|Q01448
           Saccharomyces cerevisiae YBR215w Histone promoter
           control 2 protein, hypothetical start
          Length = 438

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 41/49 (83%), Positives = 45/49 (91%)

Query: 440 KRPHPLKGKSRIGKYDIEDPFIDDSELLWEEQRAATRDGFFVYFGPLIE 488
           K+PHP KGK+ IGKYDIEDPFIDDSEL WEE RAATRDGFFV+FGPL+E
Sbjct: 367 KKPHPSKGKNLIGKYDIEDPFIDDSELQWEEYRAATRDGFFVFFGPLVE 415

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 10/77 (12%)

Query: 316 PSIKSPKVTSMEVNGK--------PIVVLDIPLHDVSSNDYLDENGQVVFNVYNLIQEKY 367
           P+ KSP + S+   GK        P +++D+PL    SN YL E+ QV+FN   LI EKY
Sbjct: 247 PTTKSPNIMSVLEKGKTDIKTLSRPDIIIDVPLSLDDSNAYLSEDNQVIFNFQKLIDEKY 306

Query: 368 G-SQLNKA-KRNLMVDL 382
           G S+  K  K+NL ++L
Sbjct: 307 GISKKAKVPKKNLTMNL 323

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.127    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,952,248
Number of extensions: 529901
Number of successful extensions: 1676
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1701
Number of HSP's successfully gapped: 47
Length of query: 503
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 397
Effective length of database: 12,926,601
Effective search space: 5131860597
Effective search space used: 5131860597
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 64 (29.3 bits)