Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B13090g1021100650540.0
ABL012C1020102322090.0
Scas_594.21029102821930.0
YMR231W (PEP5)1029103021590.0
CAGL0M04895g1036102919270.0
Kwal_55.2031889990018130.0
YAL002W (VPS8)127455890.027
YLR148W (PEP3)91887880.028
Scas_679.28815130830.13
CAGL0M02805g87281780.47
Scas_670.26130532770.60
AFR002C123030770.68
Kwal_27.1134191082760.77
ABL168C79897760.78
CAGL0J01529g67156750.91
Sklu_2306.5126131751.2
Kwal_26.803066048731.7
YLR032W (RAD5)116970732.1
CAGL0M04653g95982722.2
Sklu_2377.186576713.1
KLLA0E11297g51276703.6
AGL032C72368686.1
Scas_600.1096827687.1
KLLA0E16016g688121687.6
KLLA0C18491g119830688.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B13090g
         (1006 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B13090g complement(1142698..1145763) similar to sp|P12868 S...  1951   0.0  
ABL012C [580] [Homologous to ScYMR231W (PEP5) - SH] (375053..378...   855   0.0  
Scas_594.2                                                            849   0.0  
YMR231W (PEP5) [4187] chr13 (733544..736633) Vacuolar peripheral...   836   0.0  
CAGL0M04895g 534252..537362 similar to sp|P12868 Saccharomyces c...   746   0.0  
Kwal_55.20318                                                         702   0.0  
YAL002W (VPS8) [64] chr1 (143711..147535) Protein involved in va...    39   0.027
YLR148W (PEP3) [3557] chr12 (434642..437398) Vacuolar peripheral...    39   0.028
Scas_679.28                                                            37   0.13 
CAGL0M02805g 317204..319822 similar to tr|Q02931 Saccharomyces c...    35   0.47 
Scas_670.26                                                            34   0.60 
AFR002C [3194] [Homologous to ScYAL002W (VPS8) - SH] (438503..44...    34   0.68 
Kwal_27.11341                                                          34   0.77 
ABL168C [424] [Homologous to ScYNL212W (VID27) - SH] (84649..870...    34   0.78 
CAGL0J01529g complement(143666..145681) similar to sp|Q04779 Sac...    33   0.91 
Sklu_2306.5 YAL002W, Contig c2306 8660-12445 reverse complement        33   1.2  
Kwal_26.8030                                                           33   1.7  
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    33   2.1  
CAGL0M04653g 505982..508861 similar to sp|P27801 Saccharomyces c...    32   2.2  
Sklu_2377.1 YPL126W, Contig c2377 154-2751                             32   3.1  
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    32   3.6  
AGL032C [4279] [Homologous to ScYLL029W - SH] (650019..652190) [...    31   6.1  
Scas_600.10                                                            31   7.1  
KLLA0E16016g 1423143..1425209 weakly similar to sp|P32900 Saccha...    31   7.6  
KLLA0C18491g 1632791..1636387 weakly similar to sp|P39702 Saccha...    31   8.3  

>KLLA0B13090g complement(1142698..1145763) similar to sp|P12868
            Saccharomyces cerevisiae YMR231w PEP5 vacuolar biogenesis
            protein singleton, start by similarity
          Length = 1021

 Score = 1951 bits (5054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 960/1006 (95%), Positives = 960/1006 (95%)

Query: 1    MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH 60
            MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH
Sbjct: 1    MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH 60

Query: 61   DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA 120
            DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA
Sbjct: 61   DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA 120

Query: 121  EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT 180
            EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT
Sbjct: 121  EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT 180

Query: 181  ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL 240
            ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL
Sbjct: 181  ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL 240

Query: 241  KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVLVSNITTSSLHLGKTPNETIRAVI 300
            KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVLVSNITTSSLHLGKTPNETIRAVI
Sbjct: 241  KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVLVSNITTSSLHLGKTPNETIRAVI 300

Query: 301  LDIKTKIISYSLLITSSVIDIFSDGASVNLLTSNGVIHKLRQKKLDDQLNTICQKDMYSV 360
            LDIKTKIISYSLLITSSVIDIFSDGASVNLLTSNGVIHKLRQKKLDDQLNTICQKDMYSV
Sbjct: 301  LDIKTKIISYSLLITSSVIDIFSDGASVNLLTSNGVIHKLRQKKLDDQLNTICQKDMYSV 360

Query: 361  ALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIISKFGVEHK 420
            ALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIISKFGVEHK
Sbjct: 361  ALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIISKFGVEHK 420

Query: 421  TNSEDSINLKDFLWKLVKDGKAXXXXXXXXXXXXXXXXXIEGLGSFLSHFKRDGVFNENP 480
            TNSEDSINLKDFLWKLVKDGKA                 IEGLGSFLSHFKRDGVFNENP
Sbjct: 421  TNSEDSINLKDFLWKLVKDGKAKVDHITLLLTLLIKLHDIEGLGSFLSHFKRDGVFNENP 480

Query: 481  EEFGNWSMNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQKYVLKYSKDPSQVVSIVLLH 540
            EEFGNWSMN                             AQKYVLKYSKDPSQVVSIVLLH
Sbjct: 481  EEFGNWSMNDDSFFYSDSSLFDLDIALRLLLECNMLELAQKYVLKYSKDPSQVVSIVLLH 540

Query: 541  KKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPSNYDAVKE 600
            KKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPSNYDAVKE
Sbjct: 541  KKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPSNYDAVKE 600

Query: 601  NVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSSASSDDKPLTVESAQPTYHPPKPSLIFP 660
            NVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSSASSDDKPLTVESAQPTYHPPKPSLIFP
Sbjct: 601  NVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSSASSDDKPLTVESAQPTYHPPKPSLIFP 660

Query: 661  SFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYEDDIEERKAEWKGKA 720
            SFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYEDDIEERKAEWKGKA
Sbjct: 661  SFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYEDDIEERKAEWKGKA 720

Query: 721  EAVLEETEKYKIRQASERAPDSSLMLLISHMHDMNPFTLSSMQEDEQESNSIISHVSLSD 780
            EAVLEETEKYKIRQASERAPDSSLMLLISHMHDMNPFTLSSMQEDEQESNSIISHVSLSD
Sbjct: 721  EAVLEETEKYKIRQASERAPDSSLMLLISHMHDMNPFTLSSMQEDEQESNSIISHVSLSD 780

Query: 781  VFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSKQIYEDIGGESVFREKILNKV 840
            VFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSKQIYEDIGGESVFREKILNKV
Sbjct: 781  VFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSKQIYEDIGGESVFREKILNKV 840

Query: 841  LKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAEIQKNELLVKSYEKELDLKVS 900
            LKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAEIQKNELLVKSYEKELDLKVS
Sbjct: 841  LKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAEIQKNELLVKSYEKELDLKVS 900

Query: 901  KLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHLYHQRCLNEETDSDLLYSCPQ 960
            KLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHLYHQRCLNEETDSDLLYSCPQ
Sbjct: 901  KLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHLYHQRCLNEETDSDLLYSCPQ 960

Query: 961  CVVETESAKKTMATYKNSSQNANLLRAALSDLDAKEDRFAIISEFI 1006
            CVVETESAKKTMATYKNSSQNANLLRAALSDLDAKEDRFAIISEFI
Sbjct: 961  CVVETESAKKTMATYKNSSQNANLLRAALSDLDAKEDRFAIISEFI 1006

>ABL012C [580] [Homologous to ScYMR231W (PEP5) - SH] (375053..378115)
            [3063 bp, 1020 aa]
          Length = 1020

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1023 (43%), Positives = 658/1023 (64%), Gaps = 29/1023 (2%)

Query: 1    MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH 60
            MS N+ RQFQL+E  PIRDP   +D PLYSDPTL+AV  L    +AIAV++  ++ +DL 
Sbjct: 1    MSFNSQRQFQLFEITPIRDPNFGTDTPLYSDPTLSAVTPLGNGTIAIAVRSVYIQTIDLK 60

Query: 61   DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA 120
                  EF+AY  +YQ+TYLE V D ++VSVGEC+GKP  IK+W+L K PKD   +H+  
Sbjct: 61   TPASLAEFKAYGDDYQITYLEYVKDGMLVSVGECVGKPTSIKIWNLGKTPKDAFDFHSTC 120

Query: 121  EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT 180
            EVRNG+N +PVS +S + D SCI +GF +GR+ILVRGDL RDRGS+ RIIYED N EPIT
Sbjct: 121  EVRNGNNTFPVSAISLSQDLSCIVLGFVNGRIILVRGDLYRDRGSRQRIIYEDLNNEPIT 180

Query: 181  ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL 240
            AL L+ND S  F +TT++IMLF T+GRNNG+P+ +LN + G+DLNC   N   DE +C L
Sbjct: 181  ALFLNNDYSVTFASTTSRIMLFRTTGRNNGEPERVLNANTGIDLNCSCFNPERDELLCCL 240

Query: 241  KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVL--VSNITTSSLHLGKTPNETIRA 298
               ++ Y  +G K SL+V++P  KRIF I  DHIL+L  VS   +++L L  T   T + 
Sbjct: 241  DKSVEFYKATGEKHSLLVEVPMKKRIFLIDNDHILLLSSVSTPNSTALQLSSTGTITKKV 300

Query: 299  VILDIKTKIISYSLLITSSVIDIFSDGA----SVNLLTSNGVIHKLRQKKLDDQLNTICQ 354
            +ILD+K ++I+ + L+ S+++ I+SD      SV L+T++GVI+++ +K +D Q+  I Q
Sbjct: 301  LILDLKNQLIAMNHLLASNIVHIYSDTVDGVYSVYLVTTDGVINRITEKPVDKQIKLITQ 360

Query: 355  KDMYSVALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIISK 414
            +++Y +AL+LA+Q S+  +++QEI++ YGD L+KK  K EA+EQY+ C+++ + +EIIS+
Sbjct: 361  RELYPIALQLAEQRSVSPLRIQEIRRQYGDALYKKNMKEEAVEQYIQCLDITETSEIISR 420

Query: 415  FGVEHKTNSEDSINLKDFLWKLVKDGKAXXXXXXXXXXXXXXXXXIEGLGSFLSHFKRDG 474
            FG++  +  +DS NL  +LW ++K   +                 ++G+  F+SHF R+G
Sbjct: 421  FGIQKTSRPDDSRNLATYLWSMIKQKLSHSDHVTLLLAILIKLKDVDGIDYFISHFSRNG 480

Query: 475  VFNENPEEFGNWSMNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQKYVLKYSKDPSQVV 534
             F E  E+  +WS++                             A   V K+SKDP QVV
Sbjct: 481  EFVEEGEDESSWSVDDETFFYSDIVLMDLDTILQLLKDSELDAQAFSLVHKFSKDPIQVV 540

Query: 535  SIVLLHKKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPSN 594
             ++L    D   AL YIKSL VDD LRVLI+FS+ LL+ +PN+TN LLID+F G+Y+ S 
Sbjct: 541  DVILNTLDDPHSALKYIKSLHVDDTLRVLIEFSKVLLEKLPNDTNALLIDVFTGRYQRST 600

Query: 595  YDAVKENVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSSASSDDKPLTVESAQPTYHPPK 654
               V    + +KKQ+    +   +F++Y++F  YM  ++      P + +  +PTYHPPK
Sbjct: 601  KCEVN---IREKKQT--ISRNNPVFHSYKAFVTYMYSTAGGV---PNSEDIQEPTYHPPK 652

Query: 655  PSLIFPSFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYEDDIEERKA 714
            PSL+F SF+ +PFQFVVFLEACLESY +FQG+ +D+Q+ILTTLYDIYLSL   D E    
Sbjct: 653  PSLVFTSFIDRPFQFVVFLEACLESYNKFQGFLRDKQEILTTLYDIYLSLAATD-EAHNE 711

Query: 715  EWKGKAEAVLEETEKYKIRQASERAP-------DSSLMLLISHMHDMNPFTLSSMQEDEQ 767
            +W+ KA AV +E+EK      S +AP       D+SLM+LISH+++++   L S++ D  
Sbjct: 712  DWRTKATAVYKESEKLAGTCRSPQAPKASNTQFDNSLMMLISHINNVD---LYSVEGDAS 768

Query: 768  ESNSI-ISHVSLSDVFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSKQIYEDI 826
             +  + ++  +L++ FRSMCLT +   C++FLEKYG  E +LY++A+ FF+SSKQ+Y+ I
Sbjct: 769  GTEDLSVNKANLTNTFRSMCLTKEAKKCMNFLEKYGSVEPELYRMALGFFLSSKQVYDSI 828

Query: 827  GGESVFREKILNKVLKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAEIQKNEL 886
            GG  VF+ ++L+KV++ DL+ PL+I+  LS T+V  +G ++DFL++++K +  E   NE 
Sbjct: 829  GGAPVFKARVLDKVIEMDLLQPLDILFVLSSTSVATFGLVRDFLINHIKAQQRETHNNEK 888

Query: 887  LVKSYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHLYHQRCL 946
            L++SY+ EL  K  +LK  L+   PLQV+VK   C  C+ LL+ P    +          
Sbjct: 889  LIQSYQGELQEKEMQLKTLLSESEPLQVKVKNNFCKMCHTLLDLPGDILQMWPYLPPALP 948

Query: 947  NEETDSD---LLYSCPQCVVETESAKKTMATYKNSSQNANLLRAALSDLDAKEDRFAIIS 1003
             E++ S     L   P+C V+  +++  +   K++   A+LL+AALS+ D+  DRF ++S
Sbjct: 949  PEDSISAEMVRLILMPKCAVDNGASETWIKPKKDNDTKASLLQAALSNEDSSGDRFKVVS 1008

Query: 1004 EFI 1006
            EFI
Sbjct: 1009 EFI 1011

>Scas_594.2
          Length = 1029

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1028 (42%), Positives = 661/1028 (64%), Gaps = 33/1028 (3%)

Query: 1    MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH 60
            MSL+ WRQFQ YE++PI+DP   SD+PLYSDPTL A A ++ T L IAV+++ +K+++L 
Sbjct: 1    MSLSNWRQFQFYESVPIKDPELGSDEPLYSDPTLCASAPVDATELFIAVKSTYIKLINLA 60

Query: 61   DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA 120
            +  + + F A+  +YQ+T L+ +    +V++GEC+GKP LIK++ L+K+P + + YH+L 
Sbjct: 61   ESKVTYHFNAFEEDYQITCLKVIDKIFLVAIGECIGKPSLIKVYKLDKLPSNPTSYHSLV 120

Query: 121  EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT 180
            E++NGSN YP+S +S + D SCIAVG+ +G++IL+RGD+ RDRGS+ R+IYEDS KEPIT
Sbjct: 121  ELKNGSNTYPISVISISNDLSCIAVGYVNGKIILIRGDISRDRGSRQRMIYEDSGKEPIT 180

Query: 181  ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL 240
            +L+L+ D S  F +TT++ +LFNT+GRN G PD+ILN  +GVDLNC  LN  TDE+IC  
Sbjct: 181  SLNLNRDASICFASTTSRTLLFNTTGRNKGSPDLILNAQKGVDLNCSCLNPFTDEYICFT 240

Query: 241  KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVLVSNITTSSLHLGKTPNETI-RAV 299
             D ++ Y  +G K  ++ D+   KRIFP+S D I+ ++    T ++ +      T+ R +
Sbjct: 241  DDSIEFYKETGEKHKILSDLAVPKRIFPVSKDDIVFVIEEKQTQNISVNGGSFSTLNRVI 300

Query: 300  ILDIKTKIISYSLLITSSVIDIF--SDGAS--VNLLTSNGVIHKLRQKKLDDQLNTICQK 355
            ++D   ++IS S+ I+ ++IDIF  +DG +  + +LTS GV++++ +K + +QLN + QK
Sbjct: 301  VIDTLNQVISMSIYISHAIIDIFLVNDGKNDILFMLTSEGVLYRITKKSIHEQLNILMQK 360

Query: 356  DMYSVALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIISKF 415
            + +  AL L+KQH+L  +++++I KS+GD+L+KKG K +A ++Y+ C++V + +E+ISKF
Sbjct: 361  EAFQFALTLSKQHNLNALEIEKIHKSFGDFLYKKGKKNDATKEYIQCLDVIETSEVISKF 420

Query: 416  GVEHKTNSEDSINLKDFLWKLVKDGKAXXXXXXXXXXXXXXXXXIEGLGSFLSHFKRDGV 475
            G++   ++ ++ NL DF+W L+K   A                  +G+  FL HF R G 
Sbjct: 421  GIDGNPDTNNTENLADFIWSLIKKNIANSDHVTLLLVVLIKLKDEKGMDYFLQHFTRAGT 480

Query: 476  FNENPEEFGNWS-MNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQKYVLKYSKDPSQVV 534
            F+      GN   +N                             A  +  K++KDP  +V
Sbjct: 481  FDAT----GNAEDLNDEEYFYSDVPVFDLYLIVTLLKNSAFNKKAYFFAKKFAKDPLTIV 536

Query: 535  SIVLLHKKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPSN 594
            SI+L    D  GAL Y++SLP+DD LR L+ +S+ LL  +PNETN +LID+F G+YKP  
Sbjct: 537  SILLSTLNDPSGALEYVRSLPIDDTLRALVSYSKTLLQELPNETNAILIDVFTGKYKPKE 596

Query: 595  Y-DAVKENVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSSASSDDKPLTVESAQ-PTYHP 652
            Y D   E V   +  +    K   +FY+Y +FF YM  +      +  T+++   PTYHP
Sbjct: 597  YRDDNIEPVTPDETTTSDLKK---VFYSYTTFFNYMNKTVNPLLSEEHTLDAINTPTYHP 653

Query: 653  PKPSLIFPSFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYEDDIEER 712
            PKPS++F SF+ KPF+FVVFLEACL+SY+R++G++ D+QDILTTLYD+YL+L   DIEER
Sbjct: 654  PKPSIVFSSFLSKPFEFVVFLEACLDSYQRYEGFNNDKQDILTTLYDLYLNLSNTDIEER 713

Query: 713  KAEWKGKAEAVLEET-EKYKIRQASERAP------DSSLMLLISHMHDMNPFTLSSMQED 765
            + +WK +A  +L+++ E   +++A+ +A       D+SLM+LISHM+ ++P+   SM E+
Sbjct: 714  RHDWKSRARKILKQSNELVALQEAATQASTTNKQFDNSLMMLISHMNKIDPY---SMLEE 770

Query: 766  EQESNSIISH----VSLSDVFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSKQ 821
            E     I+ +    +    +F+ M LT+    C  F +KY   E  L +IA+ FFVSSK 
Sbjct: 771  EDGEPMIVGNNPNELDYISLFKFMTLTDSAVNCFKFFQKYSSREPGLNRIALIFFVSSKH 830

Query: 822  IYEDIGGESVFREKILNKVLKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAEI 881
            I ++IGGE V +E++LNK+++ +LMS LEIIQ LS TNV  +G ++D L++Y+  E  EI
Sbjct: 831  ILKEIGGELVLKEEVLNKIIEDELMSVLEIIQVLSTTNVATFGLVQDLLINYVNKEEIEI 890

Query: 882  QKNELLVKSYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHLY 941
             KN  L++SY++EL  K +KLKE L    P+ + +K + C  CN +L+ P+VFFKCGH+Y
Sbjct: 891  NKNRKLIESYQQELTEKNNKLKELLQTTEPIHIGIKNQKCFMCNGVLDLPIVFFKCGHIY 950

Query: 942  HQRCLNEET---DSDLLYSCPQCVVETESAKKTMATYKNSSQNANLLRAALSDLDAKEDR 998
            HQRCLNEE    D + L+ CP+C+VE E+A          ++    L   L + D K DR
Sbjct: 951  HQRCLNEENSARDGEKLFKCPKCMVELETANNLYLAQTAIARKKGQLEILLEN-DGKNDR 1009

Query: 999  FAIISEFI 1006
            F  I++FI
Sbjct: 1010 FKGITDFI 1017

>YMR231W (PEP5) [4187] chr13 (733544..736633) Vacuolar peripheral
            membrane protein required for vacuole biogenesis [3090
            bp, 1029 aa]
          Length = 1029

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1030 (42%), Positives = 648/1030 (62%), Gaps = 37/1030 (3%)

Query: 1    MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH 60
            MSL++WRQFQL+ENIPIRDP    D  LYSDPTL A   ++   L IAV ++++KVV L+
Sbjct: 1    MSLSSWRQFQLFENIPIRDPNFGGDSLLYSDPTLCAATIVDPQTLIIAVNSNIIKVVKLN 60

Query: 61   DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA 120
               +  EF+++  ++Q+T+L+ ++   +V++ E +GKP LI+++ LEK+P  E  YH+  
Sbjct: 61   QSQVIHEFQSFPHDFQITFLKVINGEFLVALAESIGKPSLIRVYKLEKLPNREQLYHSQV 120

Query: 121  EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT 180
            E++NG+N YP+S VS + D SCI VGF +G++IL+RGD+ RDRGS+ RIIYED +KEPIT
Sbjct: 121  ELKNGNNTYPISVVSISNDLSCIVVGFINGKIILIRGDISRDRGSQQRIIYEDPSKEPIT 180

Query: 181  ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL 240
            AL L+ND +  F  TT++I+LFNT+GRN G+P ++LN   G+DLNCG  N +T+EFIC L
Sbjct: 181  ALFLNNDATACFAATTSRILLFNTTGRNRGRPSLVLNSKNGLDLNCGSFNPATNEFICCL 240

Query: 241  KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVLV--SNITTSSLHLGK-TPNETIR 297
             + ++ +  SG K     D+   KRIF +  DHIL++   + + T+S+ + + +P    R
Sbjct: 241  SNFIEFFSSSGKKHQFAFDLSLRKRIFCVDKDHILIVTEETGVPTTSISVNELSPTIINR 300

Query: 298  AVILDIKTKIISYSLLITSSVIDIFSDGAS----VNLLTSNGVIHKLRQKKLDDQLNTIC 353
              I+D K KIIS + +++S++IDIFS   S      LLTS GV+H++  K L++Q+N I 
Sbjct: 301  IFIIDAKNKIISLNFVVSSAIIDIFSTSQSGKNITYLLTSEGVMHRITPKSLENQINIII 360

Query: 354  QKDMYSVALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIIS 413
            QK++Y  AL+LAKQHSL  + VQEI K YGDYLFKKG ++EA +QY+ C++V + +EIIS
Sbjct: 361  QKELYPFALQLAKQHSLSPLDVQEIHKKYGDYLFKKGLRKEATDQYIQCLDVVETSEIIS 420

Query: 414  KFGVEHKTNSEDSINLKDFLWKLVKDGKAXXXXXXXXXXXXXXXXXIEGLGSFLSHFKRD 473
            KFGV+   + E   NL D+LW L+K+  +                 +EG+ +F+ HF R 
Sbjct: 421  KFGVKEVPDPESMRNLADYLWSLIKNSISQRDHVTLLLIVLIKLKDVEGIDTFIQHFDRK 480

Query: 474  GVFNENPEEFGNWSMNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQKYVLKYSKDPSQV 533
            G++NE         M+                             + +   KYSKD   +
Sbjct: 481  GIWNEG---VVMDDMDDVTFFYSDNDFFDLDLILELMKESDFKRLSYRLAKKYSKDSLII 537

Query: 534  VSIVLLHKKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPS 593
            V I+L    +   A+ YIKSLP+D+ LR L+ +S+KLL+  PNETN LLI++F G++KPS
Sbjct: 538  VDILLNLLHNPVKAIKYIKSLPIDETLRCLVTYSKKLLEESPNETNALLIEVFTGKFKPS 597

Query: 594  NYDAVKENVVNQKKQSEPADKEPIIFYNYRSFFEYM---LPSSASSDDKPLTVESAQPTY 650
             ++    ++  +    + ++    +FY+Y++FF YM     S A S+    + E  +PTY
Sbjct: 598  TFEV---DLDRRDTTGDFSENIRTVFYSYKTFFNYMNSNGTSDAMSESSEASHEHEEPTY 654

Query: 651  HPPKPSLIFPSFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYEDDIE 710
            HPPKPS++F SFV KPF+FVVFLEACL  Y++++G+D+DRQ ILTTLYD+YL+L ++D+ 
Sbjct: 655  HPPKPSIVFSSFVTKPFEFVVFLEACLACYQQYEGFDEDRQVILTTLYDLYLNLAQNDVP 714

Query: 711  ERKAEWKGKAEAVLEETEKYKIRQASERAP---DSSLMLLISHM-------HDMNPFTLS 760
            ER  +W+ +A  VL E+ K     AS       D+S+MLLISHM        D     ++
Sbjct: 715  ERIDDWRSRATGVLRESNKLVYSAASNNTSKRVDNSIMLLISHMDQSSASAKDKTKIDIA 774

Query: 761  SMQEDEQESNSIISHVSLSDVFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSK 820
            S   D  E       + L   FR+M L  +P  CL FLEKYG  E  L ++A+ +FVS+K
Sbjct: 775  SFANDNPE-------MDLLSTFRAMTLNEEPSTCLKFLEKYGTEEPKLLQVALSYFVSNK 827

Query: 821  QIYEDIGGESVFREKILNKVLKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAE 880
             I++++GG  V +EK+L  +++ + M  L+II+ LS TNV  +G I+D ++D++K E+ E
Sbjct: 828  LIFKEMGGNEVLKEKVLRPIIEGERMPLLDIIKALSRTNVAHFGLIQDIIIDHVKTEDTE 887

Query: 881  IQKNELLVKSYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHL 940
            I++NE L++SY+KEL  K  KLK  +  + PL V +K + C  C + L+ P+VFFKCGH+
Sbjct: 888  IKRNEKLIESYDKELKEKNKKLKNTINSDQPLHVPLKNQTCFMCRLTLDIPVVFFKCGHI 947

Query: 941  YHQRCLNEETDS----DLLYSCPQCVVETESAKKTMATYKNSSQNANLLRAALSDLDAKE 996
            YHQ CLNEE D+      L+ CP+C+V+ E++ K         +  +LL  AL+  +   
Sbjct: 948  YHQHCLNEEEDTLESERKLFKCPKCLVDLETSNKLFEAQHEVVEKNDLLNFALNSEEGSR 1007

Query: 997  DRFAIISEFI 1006
            DRF +I+EF+
Sbjct: 1008 DRFKVITEFL 1017

>CAGL0M04895g 534252..537362 similar to sp|P12868 Saccharomyces
            cerevisiae YMR231w PEP5, start by similarity
          Length = 1036

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1029 (38%), Positives = 641/1029 (62%), Gaps = 30/1029 (2%)

Query: 1    MSLNTWRQFQLYENIPIRDPFTESDQPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLH 60
            MSL +WR FQ Y+N+PI DP   +D  LYSDPTL+A A++NE    IAV+++ ++   L 
Sbjct: 1    MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLFFIAVRSNYIRHFSLK 60

Query: 61   DMTLQFEFEAYTSEYQLTYLERVSDTLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALA 120
               +  EF+A+   +Q++YL  V  + +++VGE +  P  +KL+ +  +P +E  YH+L 
Sbjct: 61   KAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLFKINDLPTNEFHYHSLV 120

Query: 121  EVRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPIT 180
            E++N  NA+P+S+VS + + +CI VGF +G+++L++GDL RDRGS+ RI+YEDS  +PIT
Sbjct: 121  EIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDRGSQQRILYEDSTGDPIT 180

Query: 181  ALSLSNDGSRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICAL 240
            +L L++D S  F TTT++IM+FN   ++   P+ +L+  EGV LNC   ++ T+E IC +
Sbjct: 181  SLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGVALNCASFSKFTNENICCM 240

Query: 241  KDKLDIYMGSGSKRSLIVDIPTAKRIFPISADHILVLVS---NITTSSLHLGKTPNETIR 297
             D +  Y G+G +  + + I   K++ PI+   +L++       TTS  +     N   +
Sbjct: 241  NDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEERQKTTSIEYESGASNNICK 300

Query: 298  AVILDIKTKIISYSLLITSSVIDIF----SDGASVNLLTSNGVIHKLRQKKLDDQLNTIC 353
            A+++D++  I+S+S   TS+++D+      D + + L+T+ G+++K+ +K LD++L+ + 
Sbjct: 301  AIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTAEGLMYKVSKKSLDERLSIVM 360

Query: 354  QKDMYSVALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIIS 413
             K+M+  AL+LA   +LPD K+Q+I K YGDYL+ KG   EA +QYM CI++ D ++II+
Sbjct: 361  NKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLHTEAAQQYMKCIDILDISDIIT 420

Query: 414  KFGVEHKTNSEDSINLKDFLWKLVKDGKAXXXXXXXXXXXXXXXXXIEGLGSFLSHFKRD 473
            K G     + +   NL DF+W+L++ G+A                  +GL  F+S+F+R 
Sbjct: 421  KLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLLSVLIKLKDEDGLKRFVSYFRRS 480

Query: 474  GVFNENPEEFGNWSMNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQKYVLKYSKDPSQV 533
            G + E  E + +  ++                               ++V K+SKDP  +
Sbjct: 481  GKYIET-ENYKD--LDDESYFFSDLRLFDLELIRSLLIDSKLNQLCYQFVFKFSKDPIMI 537

Query: 534  VSIVLLHKKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPS 593
              ++L   K++   L Y+KSL VDD LRVL++FS++LL L PNETNLLLI++F G+Y+PS
Sbjct: 538  TDVLLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLYLSPNETNLLLIEVFTGKYRPS 597

Query: 594  NYDAVKENVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSS------ASSDDKPLTVESAQ 647
            +Y +   NVVN K  ++ ++K P+ FY+Y +F +YM P +      AS +   L V+  +
Sbjct: 598  SYVSDINNVVNTKTGTK-SEKNPV-FYSYTAFLKYMNPLADASVLDASENGDRLDVD--R 653

Query: 648  PTYHPPKPSLIFPSFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYED 707
            PTYHPPKPSL+F +F+ +PF+FVVFLEACLESYK+F G+  DRQ+ILTTLYD+YL+L + 
Sbjct: 654  PTYHPPKPSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKNDRQEILTTLYDLYLTLSKQ 713

Query: 708  DIEERKAEWKGKAEAVLEETEKY--KIRQASER---APDSSLMLLISHMHDMNPFTLSS- 761
            D+ ERK+EW  KA  VL E+ +   ++ Q S       D+SLM LI+HM+ +N   +SS 
Sbjct: 714  DVGERKSEWTEKANLVLNESNELANELDQNSNNNLNKVDNSLMKLIAHMNGLNVADISSP 773

Query: 762  MQEDEQESNSIISHVSLSDVFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSKQ 821
            + E+++ SN +  +  + + FR++    +   C+ F E++ ++  DL+ +A+ +F+S K+
Sbjct: 774  INENKEFSNDVTDNARIINGFRNLTYMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKE 833

Query: 822  IYEDIGGESVFREKILNKVLKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAEI 881
            I E IGGE    +KI+  +++ ++MS L+++Q LS  + + YG +KD L+D +K E+A  
Sbjct: 834  ILEFIGGEDQLVKKIIKPIIENNIMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVA 893

Query: 882  QKNELLVKSYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHLY 941
            ++ + L+ SY +EL  K ++L+  L+ +    + +K + CD C+I LE P+++FKC H+Y
Sbjct: 894  KRTKKLIASYSEELQDKKTQLRTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIY 953

Query: 942  HQRCLNEETD----SDLLYSCPQCVVETESAKKTMATYKNSSQNANLLRAALSDLDAKED 997
            HQ+CLNEE D     DLLY CP+CV++ E++ K ++  +  +    LL  A  +     D
Sbjct: 954  HQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSD 1013

Query: 998  RFAIISEFI 1006
            RF I+S+FI
Sbjct: 1014 RFRIVSDFI 1022

>Kwal_55.20318
          Length = 899

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/900 (42%), Positives = 558/900 (62%), Gaps = 36/900 (4%)

Query: 129  YPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPITALSLSNDG 188
            YP+S VS   D +CIA+GF +GRVIL+RGD+L DRGS+ R+IY+D NKEPITAL L  D 
Sbjct: 2    YPMSAVSIWHDLTCIAIGFVNGRVILIRGDILHDRGSRQRVIYDDHNKEPITALMLDRDC 61

Query: 189  SRLFVTTTNKIMLFNTSGRNNGKPDMILNDSEGVDLNCGVLNRSTDEFICALKDKLDIYM 248
               F +TT+ + LFNT+GRN+GKPD++LN   G+DLNC  L+    EFIC     ++ Y 
Sbjct: 62   RMCFASTTSAMFLFNTAGRNSGKPDVVLNSETGIDLNCSCLSYDETEFICCSSSSIEFYK 121

Query: 249  GSGSKRSLIVDIPTAKRIFPISADHILVL----VSNITTSSLHLGKTPNETIRAVILDIK 304
             +G KRSL++DI   KR++ I  +HIL+L     SN T  S+    TPN   R VILDI+
Sbjct: 122  STGEKRSLVIDIAMIKRVYAIDQNHILILSGVQTSNSTALSVTNVSTPNN--RVVILDIQ 179

Query: 305  TKIISYSLLITSSVID----IFSDGASVNLLTSNGVIHKLRQKKLDDQLNTICQKDMYSV 360
             K+I+ + LIT S++D    IF+   SV LLT++G +HKL +K ++ +L+   QK+++ +
Sbjct: 180  NKLIAMNSLITGSILDIFPSIFAGEPSVVLLTNDGTLHKLTEKSIEQKLDITEQKELFPI 239

Query: 361  ALELAKQHSLPDVKVQEIKKSYGDYLFKKGSKREAIEQYMGCIEVCDPTEIISKFGVEHK 420
            AL+LAKQ+ L  ++++ I+K Y +YL++KG+K EAIEQY+ C+ V + +E+I KFG+   
Sbjct: 240  ALDLAKQNKLKPLQIENIRKKYAEYLYRKGAKAEAIEQYLQCLSVTETSEVIEKFGIGST 299

Query: 421  TNSEDSINLKDFLWKLVKDGKAXXXXXXXXXXXXXXXXXIEGLGSFLSHFKRDGVFNENP 480
            ++  D  +L  +L  ++K   +                  EG+  F+ HF R G + E  
Sbjct: 300  SDISDVSHLSYYLLAMIKKRLSNANHVTLYMITLIKLRDEEGIDRFIKHFSRSGYYLEEE 359

Query: 481  EEFGNWSMNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQKYVLKYSKDPSQVVSIVLLH 540
            E   +W                                + +   K++KDP+ VV + +  
Sbjct: 360  ESEEDWRKEDEAYFYSDSDLFDLDLSLRLLQEAGFFSQSYQLSRKFAKDPAIVVEMSIEG 419

Query: 541  KKDSFGALNYIKSLPVDDALRVLIKFSRKLLDLIPNETNLLLIDLFIGQYKPSNY-DAVK 599
              D   AL YIKSLPVDD LRVLI FS+KLL+L+PN+TN LLI+LF G+Y+P  Y +A +
Sbjct: 420  LNDPHSALRYIKSLPVDDTLRVLITFSKKLLELLPNDTNALLIELFTGKYQPLTYEEASR 479

Query: 600  ENVVNQKKQSEPADKEPIIFYNYRSFFEYMLPSSASSDDKPLTVESAQPTYHPPKPSLIF 659
             N +++KK       E  +FY+Y SF E+M  +SA+S D+P    +  PTY PPKP+LIF
Sbjct: 480  CNSLSEKK------PEKNVFYSYSSFIEHM-KTSATSKDQPHV--NNIPTYQPPKPALIF 530

Query: 660  PSFVQKPFQFVVFLEACLESYKRFQGYDQDRQDILTTLYDIYLSLYEDDIEERKAEWKGK 719
             SF+ +PF+FVVFLEACL SY  F G+D D+Q ILTTLYDIYLSL E D E+R+ EW+ K
Sbjct: 531  TSFINQPFEFVVFLEACLGSYSEFHGFDHDKQLILTTLYDIYLSLAEADEEDRQQEWRAK 590

Query: 720  AEAVLEETEKYKI------RQASERAP----DSSLMLLISHMHDMNPFTLSSMQEDEQES 769
            A  V +E+ K         + +S   P    D+SLM+LIS ++ ++      M ++E+ S
Sbjct: 591  ASRVYKESTKLLAATAASNKSSSSEKPAKPIDNSLMMLISQVNGIDLALEECMSKEEEVS 650

Query: 770  NSIISHVSLSDVFRSMCLTNDPHVCLSFLEKYGESEHDLYKIAMPFFVSSKQIYEDIGGE 829
            +     + L+  F+S+ LT+ P   L F+EK+GE E  LY +A+  F++SK   + IGGE
Sbjct: 651  S--FEKLDLTYRFQSLSLTSSPQNALEFVEKFGEREPALYTMALSHFITSKSAMKAIGGE 708

Query: 830  SVFREKILNKVLKFDLMSPLEIIQTLSGTNVVKYGAIKDFLVDYLKGENAEIQKNELLVK 889
            +VFR K+L KVL+ DLM  L+++Q L  TNV  +G +++ L+D+L+ ++ EI+KN+ L+ 
Sbjct: 709  AVFRSKVLQKVLEKDLMPLLDVLQVLGSTNVASFGLVQEILIDHLRSDSQEIKKNKKLID 768

Query: 890  SYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACNILLEFPMVFFKCGHLYHQRCLNEE 949
            SYE EL  K S+L   L   +P Q+++K + C+ C+  L  P+V+FKCGH+YHQRCLNEE
Sbjct: 769  SYEAELQEKESRLLSLLDDTNPSQIRLKNQNCNTCHTTLNAPIVYFKCGHIYHQRCLNEE 828

Query: 950  TD---SDLLYSCPQCVVETESAKKTMATYKNSSQNANLLRAALSDLDAKEDRFAIISEFI 1006
                     + CPQCV++ E+++        +  +A+LL+ AL D + K DRF +++EFI
Sbjct: 829  ESLERGSRFFKCPQCVIDFETSEGMKNAQIKAQMDADLLKLALKDQNNK-DRFRVVTEFI 887

>YAL002W (VPS8) [64] chr1 (143711..147535) Protein involved in
            vacuolar sorting [3825 bp, 1274 aa]
          Length = 1274

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 918  KRLCDACNILLEFPMVFFKCGHLYHQRCLNEETDSDLLYSCPQCVVETESAKKTM 972
            +R  D  ++ L+ P+V FKC H +HQ CL         YSC  C  +TES  K +
Sbjct: 1222 QRHQDMISVDLKTPLVIFKCHHGFHQTCLENLAQKPDEYSCLIC--QTESNPKIV 1274

>YLR148W (PEP3) [3557] chr12 (434642..437398) Vacuolar peripheral
           membrane protein involved in vacuolar protein sorting
           and required for vacuole biogenesis [2757 bp, 918 aa]
          Length = 918

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 864 GAIKDFLVDYLKGENA---EIQKNELLVKSYEKELDLKVSKLKEALAIESPLQVQVKKRL 920
             +K+ L+ +L+  N    EI ++ +  K+ + E++ ++SK  E   I  P       + 
Sbjct: 772 ANLKEELIKFLENHNMKMNEISEDIINSKNLKVEINTEISKFNEIYRILEP------GKS 825

Query: 921 CDACNILLEFP-MVFFKCGHLYHQRCL 946
           CD C   L+    + F CGH +H  C+
Sbjct: 826 CDECGKFLQIKKFIVFPCGHCFHWNCI 852

>Scas_679.28
          Length = 815

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 63/130 (48%), Gaps = 9/130 (6%)

Query: 26  QPLYSDPTLTAVASLNETYLAIAVQASVVKVVDLHDMTLQFEFEAYTSEYQLTYLERVSD 85
           +P+Y+  +  A  S + T LA  +   + +++ L     +    A   E ++T L+   D
Sbjct: 13  RPIYAGSSAIATVSADGTVLATPILDDI-EIISLTTPQRRLHSIANDDEQEITALKLTPD 71

Query: 86  TLIVSVGECLGKPVLIKLWDLEKMPKDESKYHALAEVRNGSNAYPVSTVSCNLDASCIAV 145
              +S    + +  L+K++ L++  KD+ K      +R+   + P   + C+  ++ +A+
Sbjct: 72  AQYLSF---ISQNQLLKIFKLDQEKKDQGKI-----IRSMKMSSPCYIMDCDSTSTLVAL 123

Query: 146 GFTDGRVILV 155
           G TDG + +V
Sbjct: 124 GGTDGSITVV 133

>CAGL0M02805g 317204..319822 similar to tr|Q02931 Saccharomyces
           cerevisiae YPL126w NAN1, hypothetical start
          Length = 872

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 122 VRNGSNAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPITA 181
           V   SN+  VST++ + +   +AVGF  G + +V    L+ R  K+ I       + + +
Sbjct: 245 VSQSSNSKTVSTIAIDNNGIQLAVGFFSGVITIVDLADLQTRLLKWHI-------DSVLS 297

Query: 182 LSLSNDGSRLFVTTTNKIMLF 202
           L+ ++DGS L      K++ F
Sbjct: 298 LTFTDDGSYLLSGGWEKVLSF 318

>Scas_670.26
          Length = 1305

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 930  FPMVFFKCGHLYHQRCLNEETDSDLLYSCPQC 961
            + +  FKC H YH +CL     S+  Y C  C
Sbjct: 1269 YRIAVFKCHHGYHTKCLENMGQSNTTYKCLMC 1300

>AFR002C [3194] [Homologous to ScYAL002W (VPS8) - SH] (438503..442195)
            [3693 bp, 1230 aa]
          Length = 1230

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 932  MVFFKCGHLYHQRCLNEETDSDLLYSCPQC 961
            ++ F+C H +H+RCL     S   YSC  C
Sbjct: 1197 LIIFRCRHGFHERCLRNMGQSQDSYSCLAC 1226

>Kwal_27.11341
          Length = 910

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 866 IKDFLVDYLKGENAEIQKNELLVKSYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACN 925
           +KD LV  L+  N+ +    L +   EK + +K    ++  A+++  Q  V    CD C+
Sbjct: 762 VKDDLVRSLEKHNSVMINVSLEI---EKSIRIKKEIAEDIKALKTRYQKLVPGASCDCCS 818

Query: 926 ILLEFPMVF-FKCGHLYHQRCL 946
            +L+    + F CGH +H  CL
Sbjct: 819 RVLQTRKFYVFPCGHSFHTDCL 840

>ABL168C [424] [Homologous to ScYNL212W (VID27) - SH] (84649..87045)
           [2397 bp, 798 aa]
          Length = 798

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 39/97 (40%), Gaps = 9/97 (9%)

Query: 136 CNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPITALSLSNDGSRLFVTT 195
           C      +AVG   G + L       D+  K       +  EPI  L  S DG  L  T 
Sbjct: 588 CTTQLGYVAVGSNKGEIRLY------DKLGKRAKTLIPALGEPIRHLCASADGKWLLATC 641

Query: 196 TNKIMLFNT---SGRNNGKPDMILNDSEGVDLNCGVL 229
            + I+LF+T    GRN G      + S+G    C VL
Sbjct: 642 KSSILLFDTEVKEGRNAGALAYQKSFSQGALPQCYVL 678

>CAGL0J01529g complement(143666..145681) similar to sp|Q04779
           Saccharomyces cerevisiae YMR075w, hypothetical start
          Length = 671

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 5/56 (8%)

Query: 921 CDACNILLEFPMVFFKCGHLYHQRCLNEETDSDLL----YSCPQCVVETESAKKTM 972
           C AC     F +    C   +H  CLN   D D L    +SCPQC+V+   A  T 
Sbjct: 276 CSACFQTGSF-LCCDTCPKSFHFLCLNPPLDPDHLPEGDWSCPQCMVKLRYANNTQ 330

>Sklu_2306.5 YAL002W, Contig c2306 8660-12445 reverse complement
          Length = 1261

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 932  MVFFKCGHLYHQRCLNEETDSDLLYSCPQCV 962
            +V FKC H +HQ CL     ++  Y+C  C+
Sbjct: 1227 LVVFKCHHGFHQMCLTNLGQTERYYACLICM 1257

>Kwal_26.8030
          Length = 660

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 9/48 (18%)

Query: 923 ACNILLEF------PMVFFK-CGHLYHQRCLNEETDSDLLYSCPQCVV 963
           +C I  +F      P+V+   CGH  HQ C +E T     Y CP C V
Sbjct: 385 SCPICGDFMFTSVKPVVYMSPCGHAIHQHCFDEYTKHS--YKCPSCQV 430

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
           DNA-dependent ATPase of the Snf2p family of DNA
           helicases, member of the RAD6 epistasis group, involved
           in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 924 CNILLEFPM-----VFFKCGHLYHQRCLNE----ETDSDLLYSCPQCVVETESAKKTMAT 974
           C+I    PM     +F +CGH + ++CL E    +   +L   CP C  + + A + +A 
Sbjct: 914 CSICTTEPMDLDKALFTECGHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQID-ACRLLAL 972

Query: 975 YKNSSQNANL 984
            + +S + NL
Sbjct: 973 VQTNSNSKNL 982

>CAGL0M04653g 505982..508861 similar to sp|P27801 Saccharomyces
           cerevisiae YLR148w PEP3 vacuolar membrane protein,
           hypothetical start
          Length = 959

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 866 IKDFLVDYLKGENAEIQKNELLVKSYEKELDLKVSKLKEALAIESPLQVQVKKRLCDACN 925
           +KD LV  L+  N EI     +    +  L+LK   + E    +   ++    + CD C 
Sbjct: 812 LKDELVRSLEEHNHEIIT---IRDKIKHSLELKKDIIHETEKFKERYRILEPGKSCDQCQ 868

Query: 926 ILLEF-PMVFFKCGHLYHQRCL 946
            +L+    + F CGH +H  CL
Sbjct: 869 KMLQTRKFLVFPCGHCFHTDCL 890

>Sklu_2377.1 YPL126W, Contig c2377 154-2751
          Length = 865

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 127 NAYPVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPITALSLSN 186
           NA  V+T++ + +   +AVGF  G + L+    L +R  K+ I       + + +L  ++
Sbjct: 241 NANFVTTIAMDNNCEQVAVGFASGVINLISIGDLSNRLLKWHI-------DAVLSLCFTS 293

Query: 187 DGSRLFVTTTNKIMLF 202
           DGS L      K++ F
Sbjct: 294 DGSYLLSGGWEKVLSF 309

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 8/76 (10%)

Query: 130 PVSTVSCNLDASCIAVGFTDGRVILVRGDLLRDRGSKYRIIYEDSNKEPITALSLSNDGS 189
           P+ +VS + D   +  G T G +      L   +G    I+  DS++ PI A+  + D +
Sbjct: 211 PIISVSWSPDGELVLTGTTSGEL-----RLWNKQGKLKNIL--DSHRSPIVAMKWNQDCT 263

Query: 190 RLFVT-TTNKIMLFNT 204
            L  T  +N ++L++T
Sbjct: 264 HLLTTDVSNVVILWST 279

>AGL032C [4279] [Homologous to ScYLL029W - SH] (650019..652190)
           [2172 bp, 723 aa]
          Length = 723

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 880 EIQK----NELLVKSYE------KELDLKVSKLKEALAIESPLQVQVKKRLCDACNILLE 929
           EI+K    N++ VKSY       KELD+K+   KEA+ + S     +   + +A   L+ 
Sbjct: 356 EIEKYLADNDVAVKSYAEVWSDLKELDVKLESAKEAILLPSTASWAITSNVSNATYKLVS 415

Query: 930 FPMVFFKC 937
            P+  FK 
Sbjct: 416 SPLAAFKA 423

>Scas_600.10
          Length = 968

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 921 CDACNILLEF-PMVFFKCGHLYHQRCL 946
           CD+C+  L+    + F CGH +H  CL
Sbjct: 870 CDSCHKFLQTRKFLVFPCGHCFHTDCL 896

>KLLA0E16016g 1423143..1425209 weakly similar to sp|P32900
           Saccharomyces cerevisiae YHR149c, start by similarity
          Length = 688

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 55/121 (45%), Gaps = 17/121 (14%)

Query: 697 LYDIYLSLYEDDIEERKAEWKGKAEAVLEETEKYKIRQASERAPDSSLMLLISHMH---- 752
           LY +Y    ++++E+   ++ G AE + +  +++++    ER  D S M + S       
Sbjct: 65  LYKVYKRNKKEELEDNDPDFDGDAEFLPDFGQEFEM----ERNVDPSGMRIPSSATRAFS 120

Query: 753 -DMNPFTLSSMQEDEQESNSIISHVSLSDVFRSMCLTNDPHVCLSFLEKYGESEHDLYKI 811
              NPF          E+ S     S ++ F+   +T+D     +F + +  S+ D YK+
Sbjct: 121 VQPNPFN--------DETKSFAYSQSATNPFQLPTVTDDSETLRNFAKTFQNSDFDGYKL 172

Query: 812 A 812
           A
Sbjct: 173 A 173

>KLLA0C18491g 1632791..1636387 weakly similar to sp|P39702
            Saccharomyces cerevisiae YAL002w VPS8 vacuolar sorting
            protein, 134 kD singleton, start by similarity
          Length = 1198

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 14/30 (46%)

Query: 932  MVFFKCGHLYHQRCLNEETDSDLLYSCPQC 961
            +V F CGH +H  CL      +  + C  C
Sbjct: 1166 LVVFSCGHSFHSSCLENMGQHEGAFKCLTC 1195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,446,670
Number of extensions: 1439811
Number of successful extensions: 4854
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4971
Number of HSP's successfully gapped: 49
Length of query: 1006
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 894
Effective length of database: 12,718,893
Effective search space: 11370690342
Effective search space used: 11370690342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)