Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B13068g67166031900.0
Kwal_55.203146572295021e-54
ABL013C6982294699e-50
Scas_594.16512313936e-40
YMR232W (FUS2)6772353706e-37
CAGL0M04917g5862611551e-10
Kwal_47.1688731344702.2
CAGL0M09867g10697634.6
Kwal_34.1608272650675.6
Scas_626.12120293676.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B13068g
         (660 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B13068g complement(1140423..1142438) weakly similar to sp|Q...  1233   0.0  
Kwal_55.20314                                                         197   1e-54
ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH] (372925..375...   185   9e-50
Scas_594.1                                                            155   6e-40
YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required fo...   147   6e-37
CAGL0M04917g 537760..539520 weakly similar to sp|Q05670 Saccharo...    64   1e-10
Kwal_47.16887                                                          32   2.2  
CAGL0M09867g 978062..978382 similar to tr|Q06071 Saccharomyces c...    29   4.6  
Kwal_34.16082                                                          30   5.6  
Scas_626.12                                                            30   6.8  

>KLLA0B13068g complement(1140423..1142438) weakly similar to
           sp|Q05670 Saccharomyces cerevisiae YMR232w FUS2 required
           for cell fusion during mating singleton, start by
           similarity
          Length = 671

 Score = 1233 bits (3190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/660 (91%), Positives = 603/660 (91%)

Query: 1   MIKSRYSTYLLNYPSNNSVTPIRTCREDKYVLPNFYQTNHNPYSNSLWNTSEENREALKR 60
           MIKSRYSTYLLNYPSNNSVTPIRTCREDKYVLPNFYQTNHNPYSNSLWNTSEENREALKR
Sbjct: 1   MIKSRYSTYLLNYPSNNSVTPIRTCREDKYVLPNFYQTNHNPYSNSLWNTSEENREALKR 60

Query: 61  IKESAASKRTREDDCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARPDSK 120
           IKESAASKRTREDDCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARPDSK
Sbjct: 61  IKESAASKRTREDDCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARPDSK 120

Query: 121 TLSFIQTLQKLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKLLNRASNDELLLFGNLDT 180
           TLSFIQTLQKLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKLLNRASNDELLLFGNLDT
Sbjct: 121 TLSFIQTLQKLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKLLNRASNDELLLFGNLDT 180

Query: 181 MAELSKLFCKNLSECLKVTDAGTQSRIWKEIKGSDKLCQIILDTDFSTLIKSHLHRIKSP 240
           MAELSKLFCKNLSECLKVTDAGTQSRIWKEIKGSDKLCQIILDTDFSTLIKSHLHRIKSP
Sbjct: 181 MAELSKLFCKNLSECLKVTDAGTQSRIWKEIKGSDKLCQIILDTDFSTLIKSHLHRIKSP 240

Query: 241 YHSYCICHEERKRFLDSIKLQNTETFYKWYELCLKKSQFXXXXXXXXXXXXXXGQWGSLF 300
           YHSYCICHEERKRFLDSIKLQNTETFYKWYELCLKKSQF              GQWGSLF
Sbjct: 241 YHSYCICHEERKRFLDSIKLQNTETFYKWYELCLKKSQFEKLEDLLELPLERLGQWGSLF 300

Query: 301 ENLCLFGDNLLSPERSVQMNAISKEYISYLRDLNDELNNSGRAKESILGEENAVTQEKEN 360
           ENLCLFGDNLLSPERSVQMNAISKEYISYLRDLNDELNNSGRAKESILGEENAVTQEKEN
Sbjct: 301 ENLCLFGDNLLSPERSVQMNAISKEYISYLRDLNDELNNSGRAKESILGEENAVTQEKEN 360

Query: 361 DNXXXXXXXXXXXXXXXXXXXXXXXXXFTRVEEEVPQGEPTGAVLHNSHLXXXXXXXXXX 420
           DN                         FTRVEEEVPQGEPTGAVLHNSHL          
Sbjct: 361 DNISSKSGSRGGSQISKSSSFYSDIPSFTRVEEEVPQGEPTGAVLHNSHLNSIEEKEESK 420

Query: 421 XXXXXXXXDCIKEFNNIYANLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMF 480
                   DCIKEFNNIYANLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMF
Sbjct: 421 FNSSNSLKDCIKEFNNIYANLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMF 480

Query: 481 HSGDNERTIYGTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSL 540
           HSGDNERTIYGTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSL
Sbjct: 481 HSGDNERTIYGTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSL 540

Query: 541 KKEYMAYLRQRDTETHDAKKQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLM 600
           KKEYMAYLRQRDTETHDAKKQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLM
Sbjct: 541 KKEYMAYLRQRDTETHDAKKQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLM 600

Query: 601 MEYMQIISGGDQFLNKELELVNSGQRDLGDNFDILQLFCSSRYYTRHAIRENWTYHGDPR 660
           MEYMQIISGGDQFLNKELELVNSGQRDLGDNFDILQLFCSSRYYTRHAIRENWTYHGDPR
Sbjct: 601 MEYMQIISGGDQFLNKELELVNSGQRDLGDNFDILQLFCSSRYYTRHAIRENWTYHGDPR 660

>Kwal_55.20314
          Length = 657

 Score =  197 bits (502), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 96/229 (41%), Positives = 148/229 (64%), Gaps = 2/229 (0%)

Query: 429 DCIKEFNNIYANLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMFHSGDNERT 488
           DCI+ F  + ++  K +K L KL+LA +LD  L  A  W+N+ EFEP +++     N  +
Sbjct: 417 DCIRRFKLVESHAIKLEKELTKLDLAAILDENLRQAEEWRNIFEFEPLSDLLTEHTNVES 476

Query: 489 IYGTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSLKKEYMAYL 548
           IY  Y++KI +QRQ+VM+++L DL+ KV+ PL+H++Q    V  K+ D   LKK+YMA+L
Sbjct: 477 IYTIYIDKIHQQRQEVMLIKLGDLQEKVLSPLRHIIQCCKAVHVKIQDLKYLKKDYMAFL 536

Query: 549 RQRDTETHDAKKQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLMMEYMQIIS 608
           + +DT   + K +I+   F  LQ +L   LP F     +    L+S Y  +M++Y++++S
Sbjct: 537 QAKDTR--NVKMEIVVKHFLSLQGELLSELPTFLHLTSQFTIYLISFYNRIMLDYLRVLS 594

Query: 609 GGDQFLNKELELVNSGQRDLGDNFDILQLFCSSRYYTRHAIRENWTYHG 657
           GG + L +EL+L+ +G+R+ GDNFDILQ F SSR+YT+  I ENW  HG
Sbjct: 595 GGSRLLKRELQLLETGEREPGDNFDILQSFSSSRFYTKQLIHENWNCHG 643

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 166/351 (47%), Gaps = 41/351 (11%)

Query: 1   MIKSRYSTYLLNYPSNNSVTPIRTCREDKYVLPN----FYQ------TNHNPYSNSLWNT 50
           MIKS  S Y ++YP+ + +TPIR   +D +V       F Q       + NPY+ S+W T
Sbjct: 1   MIKSTNSIYNIDYPAKSVLTPIRDSGQDFFVTKGNAGKFGQFGSRIPEDFNPYAKSMWTT 60

Query: 51  SEENREALKRIKESAASKRTREDDCSDDLEKQSIIWESEQEPQSKKTYS-------PLDV 103
            +  +   +++K+  + +R +                S QE  SK+  +       PLD+
Sbjct: 61  EDGYKNNAQKLKKITSMRRDKV---------------SFQEADSKELIASNLSPTEPLDL 105

Query: 104 ETFSQKMNLDSARPDSKTLSFIQTLQKLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKL 163
           +   +  +  S+    K  +F+ +    L+ E+ Y          Y++E  H+ K +++L
Sbjct: 106 KLQKETKSQLSSEFTDKGKAFLTSFYSFLKREEDYAYFTDSLNMVYRKE-LHDHKSKHRL 164

Query: 164 LNRASNDELLLFGNLDTMAELSKLFCKNLSECLKV-TDAGTQSRIW----KEIKGSDKLC 218
           ++R SNDE+LLFGN+DT+++LS++  K+L   +K   D G     W      +  +DK  
Sbjct: 165 IDRNSNDEILLFGNMDTISQLSRILVKSLKNYMKACCDTGNILFQWDGYDSHMNVTDKFE 224

Query: 219 QIILDTDFSTLIKSHLHRIKSPYHSYCICHEERKRFLDSIKLQNTETFYKWYELCLKKSQ 278
            +   +DF   + SHL++I+S Y +Y +  +++ + +  ++   +  +YKWYE CLKK+ 
Sbjct: 225 DLFDPSDF---LISHLNKIRSTYSTYILSRQKQLQLICELRKLKSAAYYKWYETCLKKAD 281

Query: 279 FXXXXXXXXXXXXXXGQWGSLFENLCLFGDNLLSPERSVQMNAISKEYISY 329
           F                +     ++    +  +SPE   ++ +    Y+ +
Sbjct: 282 FNRLEDILEAPMKRIHDFYDDLLDVSTHAEGFISPEACGKIKSFLNRYLEF 332

>ABL013C [579] [Homologous to ScYMR232W (FUS2) - SH]
           (372925..375021) [2097 bp, 698 aa]
          Length = 698

 Score =  185 bits (469), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 93/229 (40%), Positives = 151/229 (65%), Gaps = 2/229 (0%)

Query: 431 IKEFNNIYANLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMFHSGDNERTIY 490
           I +F ++   LQ     L +L+LA+++ + L  A TW  L++FEP NE  ++     +IY
Sbjct: 460 ICQFFSVRKGLQDLLVELEQLDLAEIICQQLANAKTWHRLMDFEPHNENCNNSIYISSIY 519

Query: 491 GTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSLKKEYMAYLRQ 550
             +++K++ QR+++ +L+++ L++ VI PL  LL R  +V+ K+ D   L KEY AY++Q
Sbjct: 520 TAFIDKLNHQREEISVLRVKHLKKGVIDPLLVLLARTDSVRGKIDDLKVLSKEYKAYMKQ 579

Query: 551 RDTETHDAKKQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLMMEYMQIISGG 610
           RD   HD KK+++A SF+D Q  LA+ LP F  +  ++I+ L+ +Y  L++EY++I+ GG
Sbjct: 580 RDY--HDIKKKVMAQSFEDAQALLAKELPQFMAFMHKSISYLLLRYHSLVLEYLKILCGG 637

Query: 611 DQFLNKELELVNSGQRDLGDNFDILQLFCSSRYYTRHAIRENWTYHGDP 659
           ++ L KEL      +R+LGDNFDILQ+F SSR+YT+ A+R NW + G P
Sbjct: 638 EKLLKKELTFFEESERELGDNFDILQMFSSSRFYTKQAVRGNWQFPGIP 686

 Score =  166 bits (420), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 111/341 (32%), Positives = 177/341 (51%), Gaps = 17/341 (4%)

Query: 1   MIKSRYSTYLLNYPSNNSVTPIRT-CREDKYVLPNFYQ--TNHNPYSNSLWNTSEENREA 57
           MIKS+ S Y L YP+   +TPIR    E +    N  Q     NPYS SLW    EN+  
Sbjct: 44  MIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGKVRRNPYSESLWEALGENKRT 103

Query: 58  LKRIKESAASKRTREDDCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARP 117
           ++RI       R R    S  LE+++ I      P  KK  SPL++ TF   M L S + 
Sbjct: 104 IQRINTQV---RNRHRPRSLKLEQEADI------PVRKKVDSPLNLRTFGDYMTLKSPKV 154

Query: 118 DSKTLSFIQTLQKLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKLLNRASNDELLLFGN 177
           D K L+ +  +++L+++E++Y + L L  S Y+ E    KK  + LL++  NDELLLFG+
Sbjct: 155 DPKLLNTLDVVKRLVQTEREYIKKLELGNSVYRFE-LQAKKVGSMLLDKERNDELLLFGD 213

Query: 178 LDTMAELSKLFCKNLSECLKVT---DAGTQSRIWKEIK-GSDKLCQIILDTDFSTLIKSH 233
           L+T+A +SK+  K L E +      D G   +I KE++   DKL   I   D  T+++ H
Sbjct: 214 LETLASVSKILVKQLEEKIAEAYGGDKGDSDQILKELRVHPDKLRAFIERLDIGTVLEHH 273

Query: 234 LHRIKSPYHSYCICHEERKRFLDSIKLQNTETFYKWYELCLKKSQFXXXXXXXXXXXXXX 293
             RIK  Y +Y + H+++   L  I+ +++  ++KWY+ CL+K+                
Sbjct: 274 FERIKYLYLTYSVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADLIKLEDILKLPVERL 333

Query: 294 GQWGSLFENLCLFGDNLLSPERSVQMNAISKEYISYLRDLN 334
             WG++ E + L+ + + S   + Q++    +Y  YLR ++
Sbjct: 334 RTWGAITEQVLLYTEGISSDLATAQLSDFYDQYCVYLRGVS 374

>Scas_594.1
          Length = 651

 Score =  155 bits (393), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 137/231 (59%), Gaps = 12/231 (5%)

Query: 429 DCIKEFNNIYANLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMFHSGDNERT 488
           D I +F +I+  L+     +  L+   VLD  L +  TWK +++F+      H  D+  T
Sbjct: 185 DHIHKFKHIHKKLKILVGLIGNLDFHAVLDFNLRLGKTWKKMLDFD------HPHDSHDT 238

Query: 489 IYGTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSLKKEYMAYL 548
            Y  Y++ I K ++Q  IL+L DL   V+ PL  + +    VK +L D  SLKK+YM YL
Sbjct: 239 KYSRYMDTILKLKEQETILKLTDLETTVLLPLARMGKYCEVVKLRLKDLKSLKKDYMIYL 298

Query: 549 RQRDTETHDAKKQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLMMEYMQIIS 608
           ++R T+ HD K+ ++   F+++Q QL + LPIF +       ++V  Y+ +M++Y++ +S
Sbjct: 299 QERKTKIHDVKRDVIGKHFENMQRQLTDELPIFIDLFHRIFEVVVINYSQVMLKYLETMS 358

Query: 609 GGDQFLNKELELVNSGQRDLGDNFDILQLFCSSRYYTRHAIRENWTYHGDP 659
           GG+  L+++   V+S Q+    NFDIL+ F  SRY T+ AIRENW++ GDP
Sbjct: 359 GGEADLSQD---VSSLQK---KNFDILEAFSESRYNTKRAIRENWSFPGDP 403

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 90/170 (52%), Gaps = 14/170 (8%)

Query: 11  LNYPSNNSVTPIRTCREDKYVLPNFYQTNHNPYSN-SLWNTSEENREALKRIKESAASKR 69
           L+YP+ +S+TPIR  + D      ++  + N   N + +     + +    +K++     
Sbjct: 433 LHYPATDSLTPIRDYKND------YFHRDDNKLPNVTRFPVLNNSTKISSHLKDTTNFYE 486

Query: 70  TREDDCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARPDSKTLSFIQTLQ 129
             +   S DL +         EP +KK YSPL+++ F + + L++   +  T+  +  ++
Sbjct: 487 NIKRPASLDLSEIG-------EPLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLDIIR 539

Query: 130 KLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKLLNRASNDELLLFGNLD 179
           +L ESE +Y E L++  S Y++       FR+KLL + SN+ELLLFGNLD
Sbjct: 540 RLYESELEYAEFLTIADSAYRKTLHEITTFRDKLLRKDSNEELLLFGNLD 589

>YMR232W (FUS2) [4188] chr13 (736925..738958) Protein required for
           cell fusion during mating, localizes to dots beneath the
           tip of mating projection (shmoo) [2034 bp, 677 aa]
          Length = 677

 Score =  147 bits (370), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 137/235 (58%), Gaps = 4/235 (1%)

Query: 429 DCIKEFNNIYANLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMFHSGDNE-R 487
           D I +F  +   L +  K L K +L+ ++D +L     WK +IE E P+  F + DN   
Sbjct: 431 DHISKFKKVMKGLLELKKNLLKNDLSGIIDISLRRINAWKKVIECERPSGAFFAHDNLIS 490

Query: 488 TIYGTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSLKKEYMAY 547
           T+  +Y++K+ +Q+ QV IL+L +L   V+ PL+ ++    TVK KL D  +LKK+YM +
Sbjct: 491 TMCSSYIDKLHEQKNQVTILKLTELETDVMNPLERIIAHCTTVKSKLKDLQALKKDYMLF 550

Query: 548 LRQRDTETHDAKKQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLMMEYMQII 607
           L+++     D K+ +L   FQ+LQ+Q+   LP+F     + I  ++  Y  + ++Y++II
Sbjct: 551 LQEKKANVRDIKRDLLGMHFQNLQNQMKRELPVFITLIHDTIECILLNYIKVFLKYLEII 610

Query: 608 SGGDQFLNKELE---LVNSGQRDLGDNFDILQLFCSSRYYTRHAIRENWTYHGDP 659
           +GG ++L K+LE   L +S       N DILQ +  SRY T+  +R++W + GDP
Sbjct: 611 AGGKKYLQKDLENMSLNDSIATGQIKNLDILQCYSKSRYMTKRMVRKDWPFPGDP 665

 Score =  130 bits (326), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 99/345 (28%), Positives = 169/345 (48%), Gaps = 22/345 (6%)

Query: 1   MIKSRYSTYLLNYPSNNSVTPIRTCREDKYVLPNFYQTNHNPYSNSLWNTSEENREALKR 60
           M K+ Y+ Y LNYP N+S+TPIR  + D      ++  N +     +    +  R+  K 
Sbjct: 1   MFKTSYNLYDLNYPKNDSLTPIRDYKND------YFHKNDDKLPEIV---RKPTRKLSKH 51

Query: 61  IKESAASKRTREDDCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQ--KMNLDSARPD 118
             +    K T +   S DL   SI+    +   +KK YSP++ E F    ++NL    P+
Sbjct: 52  ENKLNDKKFTNKRPASLDL--HSIV----ESLSNKKIYSPINTEIFQNVVRLNLSPQIPN 105

Query: 119 S--KTLSFIQTLQKLLESEQQYFEMLSLCLSTYKEEACHNKKFRNKLLNRASNDELLLFG 176
           S  +   F + +Q+   SE +Y+  L    + Y++    + +F+NKL+   S+DELLLFG
Sbjct: 106 SPHEGCKFYKIVQEFYLSEVEYYNNLLTANNVYRKALNSDPRFKNKLVKLDSSDELLLFG 165

Query: 177 NLDTMAELSKLFCKNLSECLKVTDAGTQ--SRIWKEIKGSDKLCQIILDT-DFSTLIKSH 233
           N+DT+A +SK+    + + L     G    +  W++I   +++ Q +  T D S   + H
Sbjct: 166 NIDTIASISKILVTAIKDLLLAKQRGKMLDANEWQKIFTKNEVQQQLYSTFDISEAFEQH 225

Query: 234 LHRIKSPYHSYCICHEERKRFLDSIKLQNTETFYKWYELCLKKSQFXXXXXXXXXXXXXX 293
           L RIKS Y SY + H+++     ++++     F KWYE CLK+S                
Sbjct: 226 LLRIKSTYTSYFVSHQKQMELFTTLRMNKNHFFNKWYEYCLKESGCIKLEDILKSPMKRL 285

Query: 294 GQWGSLFENLCLFGDNLLSPERSVQMNAISKEYISYLRDLNDELN 338
            QW    E L    +++LSPE  ++++   ++Y  +   L  E++
Sbjct: 286 TQWIDTLETLESCYEDILSPELGLKLSPTRRKYSLFSNKLETEVS 330

>CAGL0M04917g 537760..539520 weakly similar to sp|Q05670
           Saccharomyces cerevisiae YMR232w FUS2 required for cell
           fusion during mating, hypothetical start
          Length = 586

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 116/261 (44%), Gaps = 57/261 (21%)

Query: 15  SNNSVTPIRTCREDKYVLPNFYQTNHNPYSNSLWNTSEENREALKRIKESAASKR-TRED 73
           S NS+TPIR                   Y+N  ++ ++     L R+K+     R +  D
Sbjct: 9   SKNSLTPIRD------------------YNNDFFHANDSKLPNLTRVKDGYGGARASYSD 50

Query: 74  DCSDDLEKQSIIWESEQEPQSKKTYSPLDVETFSQKMNLDSARPDSKTLSFIQTLQKLLE 133
               DL+      +++ + + KK+ +              S   D K ++  + L+K + 
Sbjct: 51  SIGGDLDTM----DNKIDDRVKKSSNS-------------SVLTDMKNINLREMLKKFIF 93

Query: 134 SEQQYFEMLSLCLSTYKEEACHNKKFRNK-LLNRASNDELLLFGNLDTMAELSKLFCKNL 192
           SE++Y EM    L++Y+     NKK R+K + +  S ++++LFGNL+T+  +S L+  +L
Sbjct: 94  SEEKYIEMTEKALTSYRFN-MQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLNSL 152

Query: 193 SECLKVTDAGTQSRIWKEIKGSDKLCQIILDTDFSTLIKSHL---HRIKSPYHSYCICHE 249
           S+ +   +    S                +D  +  L++ H+   +R+K PY SY I ++
Sbjct: 153 SKIVTKLELNPSS----------------IDVIYDELVELHVTLFNRMKQPYTSYIIAYQ 196

Query: 250 ERKRFLDSIKLQNTETFYKWY 270
            +   +  ++   ++    WY
Sbjct: 197 NQTHLVKILENSTSKIVASWY 217

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 96/205 (46%), Gaps = 2/205 (0%)

Query: 440 NLQKWDKALCKLELAKVLDRTLTIAITWKNLIEFEPPNEMFHSGDNERTIYGTYVEKIDK 499
           +L +  K L K ++  + D  +    +W +L+  E  +   +  +         V+   +
Sbjct: 370 HLTQLRKLLVKHDITNLADNFIMQIHSWTSLLSIEKDSVFQNIHEQLNNKINLCVKLYKE 429

Query: 500 QRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQKLADRNSLKKEYMAYLRQRDTETHDAK 559
           +++++   +   L   +IK L+ +L    TVK  + D   L K+Y+ + +++  +  D K
Sbjct: 430 KKEELGAFKFLKLESFIIKKLETVLALMKTVKGYINDLKVLHKDYLIFKKEKQMKLQDIK 489

Query: 560 KQILANSFQDLQHQLAESLPIFNEYAREAITLLVSQYTLLMMEYMQI-ISGGDQFLNKEL 618
           + +L   ++ +Q++L E LP F  Y  + + L +  +   + + + I IS     L+ E 
Sbjct: 490 RTLLGTHYEQIQNKLVEQLPRFLTYINQFMVLFLLSFNAYLRDALDILISVQADLLHTE- 548

Query: 619 ELVNSGQRDLGDNFDILQLFCSSRY 643
           E VN  ++D     ++++   +S Y
Sbjct: 549 EGVNEIEKDYDKRRNVMKKTVNSHY 573

>Kwal_47.16887
          Length = 313

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 2   IKSRYSTYLL-NYPSNNSVTPIRTCREDKYVLPNFYQTNHNPYS 44
           +K ++  + L NY   +       C+E  YVLP  YQ N+N ++
Sbjct: 120 VKGKFKKFGLSNYKPEDVRKVYSYCKEKGYVLPTVYQGNYNAFA 163

>CAGL0M09867g 978062..978382 similar to tr|Q06071 Saccharomyces
           cerevisiae YLR408c, hypothetical start
          Length = 106

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 19/97 (19%)

Query: 474 EPPNEMFHSGDNERTIYGTYVEKIDKQRQQVMILQLQDLRRKVIKPLQHLLQRFATVKQK 533
           EP   +   GDN     G Y+  +D Q ++++ L  Q    +   P++ L  R+A VK++
Sbjct: 22  EPGQSLKELGDN-----GKYI--MDVQMKKLLKLHDQSFIERCFTPMEELKNRYAKVKER 74

Query: 534 LADRNSLKKEYMAYLRQRDTETHDAKKQILANSFQDL 570
             D   L+KE  A L  RD        +I+  + QD+
Sbjct: 75  SGD---LQKE--AELVDRDI-------RIIEMAIQDI 99

>Kwal_34.16082
          Length = 726

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 612 QFLNKE-LELVNSGQRDLGDNFDILQLFCSSRYYTRHAIRENWTYHGDPR 660
           QFLN E L  + +G+R +    DIL+  C+         REN + +GDP+
Sbjct: 563 QFLNSEDLTKIKNGKRQVLFGIDILRKICNHPDLLEKDKRENESSYGDPK 612

>Scas_626.12
          Length = 1202

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (51%), Gaps = 8/93 (8%)

Query: 535 ADRNSLK---KEYMAYLRQRDTETHDAKKQILANSFQDLQHQL--AESLPIFNEYAREAI 589
           A RNS K   KEY  YL    T ++D  K ++AN + D +  +   E++P F E  + A 
Sbjct: 774 ALRNSFKAGLKEYKKYLDMGHTFSYDTYKTLIANRYLDKEIIIRSFETVPDFEETKKLA- 832

Query: 590 TLLVSQYTLLMMEYMQIISGGDQFLNKELELVN 622
            L+V Q  L  ++  ++I     F +K L L+N
Sbjct: 833 NLIVKQCNLKQID--ELIIPHPLFKDKILPLLN 863

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,624,646
Number of extensions: 870292
Number of successful extensions: 3637
Number of sequences better than 10.0: 69
Number of HSP's gapped: 3771
Number of HSP's successfully gapped: 74
Length of query: 660
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 552
Effective length of database: 12,857,365
Effective search space: 7097265480
Effective search space used: 7097265480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)