Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B13024g1241015331e-71
ABL015C2201013492e-42
Sklu_1837.2161843424e-42
YMR233W226853242e-38
CAGL0M04939g233833242e-38
Kwal_55.2030878562211e-24
CAGL0G07557g2411001946e-19
YOR295W (UAF30)228751892e-18
Scas_665.26249681174e-08
Kwal_14.167059955650.67
KLLA0E20361g69364603.0
ACR220C94943594.4
CAGL0H09416g75020584.5
Scas_684.286452576.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B13024g
         (122 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B13024g complement(1138572..1138946) some similarities with...   209   1e-71
ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W (U...   139   2e-42
Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement        136   4e-42
YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containi...   129   2e-38
CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces c...   129   2e-38
Kwal_55.20308                                                          90   1e-24
CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces c...    79   6e-19
YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the U...    77   2e-18
Scas_665.26                                                            50   4e-08
Kwal_14.1670                                                           30   0.67 
KLLA0E20361g 1801106..1803187 some similarities with sp|P34226 S...    28   3.0  
ACR220C [1267] [Homologous to ScYFL034W - SH] (738430..741279) [...    27   4.4  
CAGL0H09416g 921571..923823 highly similar to sp|P39925 Saccharo...    27   4.5  
Scas_684.2                                                             27   6.5  

>KLLA0B13024g complement(1138572..1138946) some similarities with
           sp|Q05024 Saccharomyces cerevisiae YMR233w, hypothetical
           start
          Length = 124

 Score =  209 bits (533), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 22  VANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD 81
           VANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD
Sbjct: 22  VANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD 81

Query: 82  AMKPIFGEKMTMFTLNKILSKHLFNLAKSEKDEITEQHSDL 122
           AMKPIFGEKMTMFTLNKILSKHLFNLAKSEKDEITEQHSDL
Sbjct: 82  AMKPIFGEKMTMFTLNKILSKHLFNLAKSEKDEITEQHSDL 122

>ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W
           (UAF30) - SH] (371210..371872) [663 bp, 220 aa]
          Length = 220

 Score =  139 bits (349), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 83/101 (82%), Gaps = 3/101 (2%)

Query: 24  NDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDDAM 83
           +DNPNS H++ V LS  LQ  L  E++PRTQVVK+VWDYIK+H LQNP+DRREI+CD AM
Sbjct: 116 SDNPNSFHMRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAM 175

Query: 84  KPIFGEKMTMFTLNKILSKHLFN---LAKSEKDEITEQHSD 121
           +P+FG+KMTMF++NKILS+HL N   ++ S++D  TE+HSD
Sbjct: 176 EPVFGKKMTMFSMNKILSQHLTNPKDVSGSDQDANTEEHSD 216

>Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement
          Length = 161

 Score =  136 bits (342), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 61/84 (72%), Positives = 73/84 (86%)

Query: 23  ANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDDA 82
            ++N NSI  +KV LS +L++FL   E+PRTQVVK VWDYIKEHDLQNP DRREI+CDDA
Sbjct: 41  VSENANSIQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDA 100

Query: 83  MKPIFGEKMTMFTLNKILSKHLFN 106
           M+PIFG+KMTMF++NKILSKHLFN
Sbjct: 101 MEPIFGKKMTMFSMNKILSKHLFN 124

>YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containing
           a BAF60b domain of the SWIB complex, has moderate
           similarity to S. cerevisiae Uaf30p, which is a component
           of the Upstream Activation Factor (UAF) complex and is
           involved in activation of RNA polymerase I [681 bp, 226
           aa]
          Length = 226

 Score =  129 bits (324), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 2/85 (2%)

Query: 24  NDNP--NSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD 81
           ND+P  NSI ++KV LS  LQ+FL  EE+PRTQVVK +W YIKEHDLQNP+DRREI+CD+
Sbjct: 111 NDSPDSNSISVRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDE 170

Query: 82  AMKPIFGEKMTMFTLNKILSKHLFN 106
            M+PIFG+KMTMF++NK+L+KHLFN
Sbjct: 171 KMEPIFGKKMTMFSMNKLLTKHLFN 195

>CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces
           cerevisiae YMR233w or tr|Q08747 Saccharomyces cerevisiae
           YOR295w, hypothetical start
          Length = 233

 Score =  129 bits (324), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%)

Query: 22  VANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD 81
           VAN N N+I+  K+ LS +L +FL   E+PRTQVVK VWDYIKEH+LQ+PEDRREIICDD
Sbjct: 126 VANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIICDD 185

Query: 82  AMKPIFGEKMTMFTLNKILSKHL 104
            M+PIFG+KMTMF LNKILSKHL
Sbjct: 186 RMRPIFGDKMTMFALNKILSKHL 208

>Kwal_55.20308
          Length = 78

 Score = 89.7 bits (221), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 38/56 (67%), Positives = 46/56 (82%)

Query: 50  MPRTQVVKSVWDYIKEHDLQNPEDRREIICDDAMKPIFGEKMTMFTLNKILSKHLF 105
           M RTQ+VK VW++IK++ LQNP+DRREI CDD MKP+FGEK TMF LNK LS H+ 
Sbjct: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHIL 56

>CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces
           cerevisiae YOR295w, hypothetical start
          Length = 241

 Score = 79.3 bits (194), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 64/100 (64%), Gaps = 2/100 (2%)

Query: 22  VANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD 81
           V N   + IH+K + ++PELQ  +      RT++V+++W YIKEH+LQNP+D+R+II D 
Sbjct: 116 VTNSKKSMIHIK-MTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDA 174

Query: 82  AMKPIFGEKMTMFTLNKILSKHLFNLAKSEKDEI-TEQHS 120
            ++P+ G+   +F +++ L  H+   A  E + I T+Q S
Sbjct: 175 MLEPVLGKTSDIFMMHRALKHHILGPAPIEAEVIRTDQES 214

>YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [687 bp, 228 aa]
          Length = 228

 Score = 77.4 bits (189), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%)

Query: 30  IHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDDAMKPIFGE 89
           I  +KV LS  L   L   E+ RT+VV+ +W YIK H+LQNP +++EI+CD+ ++ I G+
Sbjct: 119 ISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGK 178

Query: 90  KMTMFTLNKILSKHL 104
              MF ++KIL+ H+
Sbjct: 179 STNMFEMHKILASHM 193

>Scas_665.26
          Length = 249

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 40/68 (58%)

Query: 37  LSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDDAMKPIFGEKMTMFTL 96
           +S  L+ F    E+ +++++  +WDYI+ H L+   +  EI+CDD +  +FGE +    +
Sbjct: 125 ISEPLRGFFGETELTKSEIMNRIWDYIELHKLKRSNNSEEILCDDKLGLVFGEVVLAHKI 184

Query: 97  NKILSKHL 104
             + SK+L
Sbjct: 185 PTMTSKYL 192

>Kwal_14.1670
          Length = 599

 Score = 29.6 bits (65), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 58  SVWDYIKEHDLQNPEDRREIICDDAMKPIFGEKMTMFTLNKILSKHLFNLAKSEK 112
           S+WD++K +   NPE  R +I D ++KP    +         L +HL  + +  K
Sbjct: 129 SLWDFVKLYAKDNPETVRSLI-DGSLKPTINAQKAQINRVYQLHQHLKQIVEGGK 182

>KLLA0E20361g 1801106..1803187 some similarities with sp|P34226
           Saccharomyces cerevisiae YBL061c SKT5 protoplast
           regeneration and killer toxin resistance protein,
           hypothetical start
          Length = 693

 Score = 27.7 bits (60), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 42  QEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDDAMKPIFGE--KMTMFTLNKI 99
           ++ L VEE  R Q +K    Y+K+  ++  +D + ++ D     +FG+  +   F+L + 
Sbjct: 222 EDGLTVEEQ-RQQFLKEALHYLKKLSVKGYKDAQYLLADSYSSGVFGKVNQKEAFSLFQA 280

Query: 100 LSKH 103
            +KH
Sbjct: 281 SAKH 284

>ACR220C [1267] [Homologous to ScYFL034W - SH] (738430..741279)
           [2850 bp, 949 aa]
          Length = 949

 Score = 27.3 bits (59), Expect = 4.4,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 32  LKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDR 74
           LK++G++   +EF ++++ P  + VK     I  HDLQ+ +D+
Sbjct: 775 LKRLGVAVLSEEFTEIDDSPDPEQVKRERKLI--HDLQDVQDK 815

>CAGL0H09416g 921571..923823 highly similar to sp|P39925
           Saccharomyces cerevisiae YER017c AFG3 or sp|P40341
           Saccharomyces cerevisiae YMR089c YTA12, hypothetical
           start
          Length = 750

 Score = 26.9 bits (58), Expect = 4.5,   Method: Composition-based stats.
 Identities = 8/20 (40%), Positives = 14/20 (70%)

Query: 51  PRTQVVKSVWDYIKEHDLQN 70
           PR +++K+ W Y+K  + QN
Sbjct: 81  PREEMMKAFWQYVKSKEFQN 100

>Scas_684.2
          Length = 864

 Score = 26.6 bits (57), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 44  FLKVEEMPRTQVVKSVWDYI-KEHDLQNPEDRREIICDDAMKPIFGEKMTMF 94
           F K+  +P  + V+++ DY+ K+++ ++  D + II D  +K  +G  +T F
Sbjct: 584 FFKLSSIPMDESVRTLLDYVHKQNEQRDVNDLKTIISD--IKEQYGSTVTDF 633

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,588,614
Number of extensions: 135712
Number of successful extensions: 453
Number of sequences better than 10.0: 24
Number of HSP's gapped: 453
Number of HSP's successfully gapped: 24
Length of query: 122
Length of database: 16,596,109
Length adjustment: 88
Effective length of query: 34
Effective length of database: 13,549,725
Effective search space: 460690650
Effective search space used: 460690650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)