Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B13002g1377135663280.0
ABL016C13289487894e-86
YOR296W12899316018e-63
CAGL0G07579g12778894882e-49
Scas_665.2512727954695e-47
Kwal_55.203027106874107e-41
CAGL0C05357g50926722.9
CAGL0M05885g48898713.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B13002g
         (1356 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B13002g complement(1134173..1138306) weakly similar to sgd|...  2442   0.0  
ABL016C [576] [Homologous to ScYOR296W - SH] (367026..371012) [3...   308   4e-86
YOR296W (YOR296W) [5080] chr15 (870199..874068) Protein containi...   236   8e-63
CAGL0G07579g 716580..720413 similar to tr|Q08748 Saccharomyces c...   192   2e-49
Scas_665.25                                                           185   5e-47
Kwal_55.20302                                                         162   7e-41
CAGL0C05357g 510471..512000 similar to sp|P06700 Saccharomyces c...    32   2.9  
CAGL0M05885g complement(620069..621535) similar to sp|P36146 Sac...    32   3.5  

>KLLA0B13002g complement(1134173..1138306) weakly similar to
            sgd|S0005822 Saccharomyces cerevisiae YOR296w,
            hypothetical start
          Length = 1377

 Score = 2442 bits (6328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1213/1356 (89%), Positives = 1213/1356 (89%)

Query: 1    MNQFRILSTDSSFSTPSLGETFDFVPLDTGYSLCDDLDLVYSNVLKVVLFAYINEPRFRR 60
            MNQFRILSTDSSFSTPSLGETFDFVPLDTGYSLCDDLDLVYSNVLKVVLFAYINEPRFRR
Sbjct: 1    MNQFRILSTDSSFSTPSLGETFDFVPLDTGYSLCDDLDLVYSNVLKVVLFAYINEPRFRR 60

Query: 61   KWKRVGSNVNSQRLRVKGASHDNGSNRLSTWFSHDPSXXXXXXXXXRSSIGGSSYNKESM 120
            KWKRVGSNVNSQRLRVKGASHDNGSNRLSTWFSHDPS         RSSIGGSSYNKESM
Sbjct: 61   KWKRVGSNVNSQRLRVKGASHDNGSNRLSTWFSHDPSDDEDEDDNNRSSIGGSSYNKESM 120

Query: 121  KQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDVFLDSQFKQTLGTMTKPEDLIILF 180
            KQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDVFLDSQFKQTLGTMTKPEDLIILF
Sbjct: 121  KQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDVFLDSQFKQTLGTMTKPEDLIILF 180

Query: 181  VKSANKELTKLETKDPKSDLFVQMSRFINILIDLSRDTKMGPTYVKRLNAYKNSLKQGDN 240
            VKSANKELTKLETKDPKSDLFVQMSRFINILIDLSRDTKMGPTYVKRLNAYKNSLKQGDN
Sbjct: 181  VKSANKELTKLETKDPKSDLFVQMSRFINILIDLSRDTKMGPTYVKRLNAYKNSLKQGDN 240

Query: 241  NKRSPSPINGNVMTSKDEESKLVDDTLQPTFRLSEITHSKILTTIFGVDELKLQRDVIRL 300
            NKRSPSPINGNVMTSKDEESKLVDDTLQPTFRLSEITHSKILTTIFGVDELKLQRDVIRL
Sbjct: 241  NKRSPSPINGNVMTSKDEESKLVDDTLQPTFRLSEITHSKILTTIFGVDELKLQRDVIRL 300

Query: 301  SLSVKNDLYLHELSQYEQAIMKDEAELKPIDFGTMDQYSDWKDHQLKHLSELKDKVKHGF 360
            SLSVKNDLYLHELSQYEQAIMKDEAELKPIDFGTMDQYSDWKDHQLKHLSELKDKVKHGF
Sbjct: 301  SLSVKNDLYLHELSQYEQAIMKDEAELKPIDFGTMDQYSDWKDHQLKHLSELKDKVKHGF 360

Query: 361  SGHNESGKNITKDMQLIPNDPRLIFQTLVNLILKHDFVRQERDNEASISLDSKFLLSRCL 420
            SGHNESGKNITKDMQLIPNDPRLIFQTLVNLILKHDFVRQERDNEASISLDSKFLLSRCL
Sbjct: 361  SGHNESGKNITKDMQLIPNDPRLIFQTLVNLILKHDFVRQERDNEASISLDSKFLLSRCL 420

Query: 421  RYWLIDYGSAVFVNAVSGCLHLIRNLDFPEGMKMTQYVFGFMETRLSVEAPEHTDPLGWN 480
            RYWLIDYGSAVFVNAVSGCLHLIRNLDFPEGMKMTQYVFGFMETRLSVEAPEHTDPLGWN
Sbjct: 421  RYWLIDYGSAVFVNAVSGCLHLIRNLDFPEGMKMTQYVFGFMETRLSVEAPEHTDPLGWN 480

Query: 481  KKDQDQWSTNQVTIFLWLTDEVYRCIECMFSSKTRDTKLKSVISTYHALVEHDSVLIERD 540
            KKDQDQWSTNQVTIFLWLTDEVYRCIECMFSSKTRDTKLKSVISTYHALVEHDSVLIERD
Sbjct: 481  KKDQDQWSTNQVTIFLWLTDEVYRCIECMFSSKTRDTKLKSVISTYHALVEHDSVLIERD 540

Query: 541  FQKSDMYKKQIHKLKKKTFLTIEQRYISLIRHVPTDSEISIKHLHGLCESILDDIALIET 600
            FQKSDMYKKQIHKLKKKTFLTIEQRYISLIRHVPTDSEISIKHLHGLCESILDDIALIET
Sbjct: 541  FQKSDMYKKQIHKLKKKTFLTIEQRYISLIRHVPTDSEISIKHLHGLCESILDDIALIET 600

Query: 601  KYKPLTNLSSRYKFVGIIIHTYFSALFRDLKILMQRIKKYNKPIDTDALDTYKLLNELRW 660
            KYKPLTNLSSRYKFVGIIIHTYFSALFRDLKILMQRIKKYNKPIDTDALDTYKLLNELRW
Sbjct: 601  KYKPLTNLSSRYKFVGIIIHTYFSALFRDLKILMQRIKKYNKPIDTDALDTYKLLNELRW 660

Query: 661  KNYXXXXXXXXXXXXLEPIFYKYLLSFCENTGDVVKQGCERIIIHETWEPMDKEADQWYS 720
            KNY            LEPIFYKYLLSFCENTGDVVKQGCERIIIHETWEPMDKEADQWYS
Sbjct: 661  KNYEESGSISSEGSILEPIFYKYLLSFCENTGDVVKQGCERIIIHETWEPMDKEADQWYS 720

Query: 721  RSAYDISRLISDTLRLVEQLQWNDLAQLGTAYSVVLGKISECVLHYARCMEDIVREDLCI 780
            RSAYDISRLISDTLRLVEQLQWNDLAQLGTAYSVVLGKISECVLHYARCMEDIVREDLCI
Sbjct: 721  RSAYDISRLISDTLRLVEQLQWNDLAQLGTAYSVVLGKISECVLHYARCMEDIVREDLCI 780

Query: 781  SENDEQNGQGQGMGHRLGNDVSIFKDMKSAIQSSKLWNNQWKQQLQGKRRRSNVXXXXXX 840
            SENDEQNGQGQGMGHRLGNDVSIFKDMKSAIQSSKLWNNQWKQQLQGKRRRSNV      
Sbjct: 781  SENDEQNGQGQGMGHRLGNDVSIFKDMKSAIQSSKLWNNQWKQQLQGKRRRSNVDAVDAA 840

Query: 841  XXXXXXXXXXXXXXXXXXXXXGYVISMRSCVCLNNMASILNMIDEVEKSFQLNQLSEEVR 900
                                 GYVISMRSCVCLNNMASILNMIDEVEKSFQLNQLSEEVR
Sbjct: 841  SAASASDTESATTTTTATAATGYVISMRSCVCLNNMASILNMIDEVEKSFQLNQLSEEVR 900

Query: 901  AHVTDDNNKKIKSEIKGQLWSIVPIAAEGAPCVGGKDNQSPRYSLSIVDTAKRHEIYRTL 960
            AHVTDDNNKKIKSEIKGQLWSIVPIAAEGAPCVGGKDNQSPRYSLSIVDTAKRHEIYRTL
Sbjct: 901  AHVTDDNNKKIKSEIKGQLWSIVPIAAEGAPCVGGKDNQSPRYSLSIVDTAKRHEIYRTL 960

Query: 961  VGGFPXXXXXXXXXXXXXPQERMSLSLVLWQEKQEAGANXXXXXXXXXKYNSGTGTRTSE 1020
            VGGFP             PQERMSLSLVLWQEKQEAGAN         KYNSGTGTRTSE
Sbjct: 961  VGGFPEWWEDEELDLELEPQERMSLSLVLWQEKQEAGANRQRRHRRQRKYNSGTGTRTSE 1020

Query: 1021 TQXXXXXXXXXXXXXXXXXRCYLDLDMPRDMLKSRKNESGLEKSLVLPLDTQGRIHVRVC 1080
            TQ                 RCYLDLDMPRDMLKSRKNESGLEKSLVLPLDTQGRIHVRVC
Sbjct: 1021 TQGTGGNGGGGNGSGVPVGRCYLDLDMPRDMLKSRKNESGLEKSLVLPLDTQGRIHVRVC 1080

Query: 1081 LEVERAEPDCIVGKTRRIVARILTQSLKQVTNRFEPCINDXXXXXXXXXXXXXXVPGQRP 1140
            LEVERAEPDCIVGKTRRIVARILTQSLKQVTNRFEPCIND              VPGQRP
Sbjct: 1081 LEVERAEPDCIVGKTRRIVARILTQSLKQVTNRFEPCINDSFSKKSLSMSLSSSVPGQRP 1140

Query: 1141 TDDDIYDSLVPLFDHLNENLTVLAQALPTALLHQIMLQVWNKILVXXXXXXXXXXXXXXX 1200
            TDDDIYDSLVPLFDHLNENLTVLAQALPTALLHQIMLQVWNKILV               
Sbjct: 1141 TDDDIYDSLVPLFDHLNENLTVLAQALPTALLHQIMLQVWNKILVAADALLLPPLQLASI 1200

Query: 1201 XXXXNSEYNFGSRGNRMXXXXXXXXXXXVWDTAVSGFQKVLQKPGFTGWXXXXXXXXXXX 1260
                NSEYNFGSRGNRM           VWDTAVSGFQKVLQKPGFTGW           
Sbjct: 1201 SSSANSEYNFGSRGNRMSYSGSTRGSSSVWDTAVSGFQKVLQKPGFTGWSSPFSNNSNYN 1260

Query: 1261 XTVGTSLEVEIVFMWIDILCRDFFHNNGEGPPLDKLKNDQYQQLMLIASLFDNETCELKQ 1320
             TVGTSLEVEIVFMWIDILCRDFFHNNGEGPPLDKLKNDQYQQLMLIASLFDNETCELKQ
Sbjct: 1261 NTVGTSLEVEIVFMWIDILCRDFFHNNGEGPPLDKLKNDQYQQLMLIASLFDNETCELKQ 1320

Query: 1321 TIEEEDQRSVPSLSQSVMVALRILWSRGDHKYVMSQ 1356
            TIEEEDQRSVPSLSQSVMVALRILWSRGDHKYVMSQ
Sbjct: 1321 TIEEEDQRSVPSLSQSVMVALRILWSRGDHKYVMSQ 1356

>ABL016C [576] [Homologous to ScYOR296W - SH] (367026..371012) [3987
           bp, 1328 aa]
          Length = 1328

 Score =  308 bits (789), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 248/948 (26%), Positives = 462/948 (48%), Gaps = 111/948 (11%)

Query: 40  VYSNVLKVVLFAYINEPRFRRKWKRVGSNVNSQRL--RVKGASHDNGSNRLSTWFSHDPS 97
           +Y ++LKVVL  YINEPRFRR+++R+ ++V +  L  R +         + +TWF  +  
Sbjct: 38  LYQSLLKVVLLEYINEPRFRRQYQRL-NDVETGELFPRERQPVRSRDDRKRATWFWPNGE 96

Query: 98  XXXXXXXXXRSSIGGSSYNKESMKQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDV 157
                           S    ++K+V   LE +L+ IA+ +  I    LRRSLLK YND+
Sbjct: 97  L--------------ESTEGNALKKVRPILEGRLSDIAIGKYKIRSDFLRRSLLKLYNDL 142

Query: 158 FLDSQFKQTLGTMTKPEDLIILFVKSANKELTKLETKDPKSDLFVQMSRFINILID-LSR 216
           +LD      L  M + E+LI+LF K+A+ E+ KL+ +D + +L+ Q+S+FI+ILID L+R
Sbjct: 143 YLDPNMSNLLENMGRFEELIMLFAKAASGEMMKLDVEDTQKELYQQVSQFIDILIDLLAR 202

Query: 217 DTKMGPTYVKRLNAYKNSLK--QGDNNKRSPS-----PINGNVMTSKDEESKLVDDTLQP 269
                P +V +L +Y +S K   G+ + RS S      + GN           ++ T++P
Sbjct: 203 CEVSTPEFVSKLRSYTDSFKPEDGEGSIRSRSSQGVPAVGGNC----------IEVTVKP 252

Query: 270 TFRLSEITHSKILTTIFGVDELKLQRDVIRLSLSVKNDLYLHELSQYEQAIMKDEAELKP 329
            F +SEI+HS  +  +FGVDE +   DV+ L   +KND Y +EL   + +I K       
Sbjct: 253 AFTVSEISHSVYIMELFGVDEKQFMADVLHLKDGIKNDYYQYELDAIKHSI-KSNGGFTA 311

Query: 330 IDFGTMDQYSDWKDHQLKHLSELKDKVKHGFSGHNESGKNITKDMQLIPNDPRLIFQTLV 389
            DF T + Y  WK+++L  + +L ++++   + HNES       +++IP + R +   L+
Sbjct: 312 DDFPTKELYEQWKEYELHAIDDLINRLEENKARHNESLSK-KAGVKVIPANSRGMLVKLL 370

Query: 390 NLILKHDFVRQERDNEASISLDSKFLLSRCLRYWLIDYGS---AVFVNAVSGCLHLIRNL 446
            ++L+    R++    + +S D++FL+S+C RYW +DY S   ++F  A +  L     L
Sbjct: 371 CILLE----REQPSQTSPLSSDAQFLISKCARYWRLDYFSTRVSLFYTAYNLTL-----L 421

Query: 447 DFPEGMK-MTQYVFGFMETRLSVEAPEHTDPLGWNKKDQDQWSTNQVTIFLWLTDEVYRC 505
           D  E +K   +++    +++ +  +    +   WN  D+ QW  N    F+   + ++  
Sbjct: 422 DDGEMLKDDIEHLVQAAQSKGAQVSDTEFNSTNWNAVDRHQWLINLNHTFISCMNVLHLM 481

Query: 506 IECMFSSKTRDTKLKSVISTYHALVEHDSVLIERDFQKSDMYKKQIHKLKKKTFLTIEQR 565
           +  ++S      K   V++ Y+  V+ D ++I+ +F ++D Y K + +LK+    T E  
Sbjct: 482 LSGIYSKPK--PKFSPVLNIYYNYVKTDPLMIQYNFPETDFYGKWMKQLKRCLTHTSEDY 539

Query: 566 YISLIRHVPTDSEISIKHLHGLCESILDDIALIETKY-KPLTNLSSRYKFVGII-IHTYF 623
           Y SL++    +    +  +  + E I+  + +I+ +Y KPL +  +  +   ++ I  + 
Sbjct: 540 YASLVKQAKKEP-FGMYSIQDIAEGIVQQLKIIQKRYPKPLLDEINITRTCAVVTIQKFL 598

Query: 624 SALFRDLKILMQRIKKYNKPI-DTDALDTYKLLNELRWKNYXXXXXXXXXXXXLEPIFYK 682
           + L   +    Q     N  +    AL+ Y+ + EL+                +   FYK
Sbjct: 599 ADLPEFINDAEQNALAENTEVLPAVALEAYRAIQELKDIWVQLKPKDLSFNTAVHNPFYK 658

Query: 683 YLLSFCENTGDVVKQGCERIIIHETWEPMDKEADQWYSRSAYDISRLISDTLRLVEQLQW 742
           YL+  C +T   V +     +  ETWEP+D+     YS S  DI +++++++++ E+LQW
Sbjct: 659 YLVRLCADTCVRVHEVIHNSLKEETWEPIDE--SHHYSSSVLDIFKMMNESVQIFEKLQW 716

Query: 743 NDLAQLGTAYSVVLGKISECVLHYARCMEDIVREDLCISE----NDEQNGQG----QGMG 794
            +  ++    + +L   S+ +  YA  +  I+ EDL  ++    +D+ + +     QG  
Sbjct: 717 ENEYEIAKTKTRLLKSFSDGLCQYAAKVLAIIEEDLSQADSALHSDDNSYENLITLQGTA 776

Query: 795 HRLGNDVSIFKDMKSAIQSSKLWNNQWKQQLQGKRRRSNVXXXXXXXXXXXXXXXXXXXX 854
            R+ N   +F +M++A+  +                                        
Sbjct: 777 ERMKN-TWLFNEMRNALMPA---------------------------------------- 795

Query: 855 XXXXXXXGYVISMRSCVCLNNMASILNMIDEVEKSFQLNQLSEEVRAHVTDDNNKKIKSE 914
                   Y    R+CVCLNN++ ++  I+++E++    ++S+ +  H     +KK +S+
Sbjct: 796 -LAEPPETYEFKQRTCVCLNNLSEMMQKINDLEETVNAEKISDTISKHQVKVEDKKDRSD 854

Query: 915 -IKGQLWSIVPIAAEGAPCVGGKDNQSPRYSLSIVDTAKRHEIYRTLV 961
               QL++I  + AE    +    + S   ++++VDT+ + EI +T V
Sbjct: 855 KAVPQLYTIRIVKAEN--ILSFNSDGSSNSAVTLVDTSVQREIAKTKV 900

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 116/268 (43%), Gaps = 27/268 (10%)

Query: 1060 GLEKSLVLPLDTQGRIHVRVCLEVERAEPDCIVGKTRRIVARILTQSLKQVTNRFEPCIN 1119
            G  +   L LDTQGR+ ++V LE ER +    VG+  R ++R   +++  + ++F   +N
Sbjct: 961  GYPQETNLDLDTQGRLILQVSLESERFDAMFCVGRAHRALSRACDRAIGLMVSKFTAFVN 1020

Query: 1120 ---DXXXXXXXXXXXXXXVPGQRPTDDDI-YDSLVPLFDHLNENLTVLAQALPTALLHQI 1175
                               PG   T  ++ YD+++PLFD+LN NL +LA  L  +LLH++
Sbjct: 1021 FSLSRAALKTVVSSTTASAPGGAGTKTNVVYDAILPLFDYLNSNLAILATELTRSLLHKV 1080

Query: 1176 MLQVWNKILVXXXXXXXXXXXXXXXXXXXNSEYNFGSRGNRMXXXXXXXXXXXVWDTAVS 1235
            MLQ WN IL                     S  +     N M                + 
Sbjct: 1081 MLQAWNTILHSADALLLPNLSCARSRKKVMSSKSMTLWENAMSMAKGDSSDSAAAAATIP 1140

Query: 1236 GFQKVLQKPGFTGWXXXXXXXXXXXXTVGTSLEVEIVFMWIDILCRDFFHNNGEGPPLDK 1295
            GF   L                       T  E+++VF W+  LC DFFHN GEGPPL  
Sbjct: 1141 GFGSAL-----------------------TPREIDVVFDWLRALCVDFFHNGGEGPPLHD 1177

Query: 1296 LKNDQYQQLMLIASLFDNETCELKQTIE 1323
            LKN  YQ L+L+   +D    EL+  +E
Sbjct: 1178 LKNQHYQNLLLVPVFYDKAADELQAEVE 1205

>YOR296W (YOR296W) [5080] chr15 (870199..874068) Protein containing
           a C2 domain, which may be involved in calcium-dependent
           phospholipid binding, has low similarity to
           uncharacterized C. albicans Orf6.5092p [3870 bp, 1289
           aa]
          Length = 1289

 Score =  236 bits (601), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 224/931 (24%), Positives = 420/931 (45%), Gaps = 139/931 (14%)

Query: 40  VYSNVLKVVLFAYINEPRFRRKWKRVGSNVNSQRLRVKGASHDNGSNR-LSTWFSHDPSX 98
           VY   LK++L  YINEPRF+                    S+  G++R LS   +H  + 
Sbjct: 35  VYLYTLKLILLDYINEPRFKE---------------AALLSNRTGTSRVLSDKTNHQQTQ 79

Query: 99  XXXXXXXXRSSIGGSSYNKESMKQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDVF 158
                   +         ++ ++  L+ L+ KL +I+ N+++  + M  +S++K Y  + 
Sbjct: 80  HGKKLVVDKQD---DMSERDIVQATLRILKGKLAQISGNKNLAPNEMHWKSIVKMYYSM- 135

Query: 159 LDSQFKQTLGTMTKPEDLIILFVKSANKELTKLETKDPKSDLFVQMSRFINILIDLSRDT 218
           LDS    T   M + E+++  F   A+ EL K+  K+ + +LF +++ FI+++ID+  D+
Sbjct: 136 LDSSSADTFSKMGQMEEVVGYFTNIASNELKKMTIKNSRDELFSEVAYFIDLVIDVLPDS 195

Query: 219 KMGPTYVKRLNAYKNSLKQGDNN---KRSPSP--------INGNVMTSKDEESKLVDDTL 267
                 +KRL  YK +LK+G+     KR+ SP        I+G+ +++K           
Sbjct: 196 --CANIIKRLLDYKINLKKGETTVKKKRAASPATVPQYRSISGSTISNK----------- 242

Query: 268 QPTFRLSEITHSKILTTIFGVDELKLQRDVIRLSLSVKNDLYLHELSQYEQAIMKDEAEL 327
           QP+F++ +I+H K    +F  DE KL +DV+ +     N ++  EL    + I KD   L
Sbjct: 243 QPSFKVQDISHMKYFMQLFETDETKLHQDVMAVKDDCTNPIFCGELRYLRKKIKKDNGTL 302

Query: 328 KPIDFGTMDQYSDWKDHQLKHLSELKDKVKHGFSGHNESGKNITKDMQLIPNDPRLIFQT 387
              DF +  +Y+ WK+++L  ++ L D+ + G        K  +   +LIP D + +F  
Sbjct: 303 TASDFSSDREYNLWKNYELLEIANLMDRFEIG-------EKVTSHGNRLIPKDAKSVFVR 355

Query: 388 LVNLILKHDFVRQERDNEASISLDSKFLLSRCLRYWLIDYGSAVFVNAVSGCLHLIRNL- 446
           L+ L+LK +       N  ++S ++ F   +  RYW I+Y S      +S  ++   NL 
Sbjct: 356 LIGLVLKKEC--SNAVNAINLSQEALFFFHKSARYWRIEYPS-----TISSLVYSAANLS 408

Query: 447 ---DFPEGMKMTQYVFGFMETRLSVEAPEHTDPLGWNKKDQDQWSTNQVTIFLWLTDEVY 503
              D    + +T+ +F  +  +  + + ++ DP  WN +D+  W+ N        TD+  
Sbjct: 409 VLGDEELNIPITENLFSVIRNKY-LCSEDNLDPSAWNAQDRYLWAAN----LFHTTDQSM 463

Query: 504 RCIECMFSSKTRDTKLK--SVISTYHALVEHDSVLIERDFQKSDMYKKQIHKLKKKTFLT 561
           R I  + ++    TK K   V+S Y++ +  D V+   + Q   + K  I   KK  F  
Sbjct: 464 RTINNLLTAIFSGTKPKFSPVLSFYYSNIVGDPVMEFYETQSVAVKKYWIKLFKKTLFKA 523

Query: 562 IEQRYISLIRHVPTDSEISIKHLHGLCESILDDIALIETKY-KPLTNLSSRYKFVGIIIH 620
            E  ++SL++ +   + I I+++  L E+I++ I  I+ +Y KPL +  S  +   + + 
Sbjct: 524 SEDYFVSLLQDMLKANAIEIQNVQNLVETIIEAIKAIQKRYNKPLLDEISLPRQCAVFLC 583

Query: 621 TYFSALFRDL-----KILMQRIKKYNKPIDTDALDTYKLLNELRWKNYXXXXXXXXXXXX 675
             + +   +L     K  M+   +   PI  DALD Y +L ELR + Y            
Sbjct: 584 EVYGSDSLNLIKTAEKSTMKMTGQKLGPI--DALDMYDVLKELR-QIYLQVKPKGKFFFN 640

Query: 676 LEPIFYKYLLSFCENTGDVVKQGCERIIIHETWEPMDKEADQWYSRSAYDISRLISDTLR 735
           LE  F KYL   C++    V++  +  +  E W+P++ +    +SRS  DI ++I+++  
Sbjct: 641 LENYFIKYLTRLCDDVSRNVQKVIKSSLESENWQPVNDQ--DHFSRSVLDIFKMINESTS 698

Query: 736 LVEQLQWNDLAQLGTAYSVVLGKISECVLHYARCMEDIVREDLCISENDEQNG------- 788
           ++E+  W +  QL    +V+L   S+ +L Y+  + ++++ DL   E DE +        
Sbjct: 699 MLEKFGWQNEFQLAQMITVILKAFSDGMLSYSAQLMELIQRDL--QEGDEPSYSLESSDT 756

Query: 789 ------QGQGMGHRLGNDVSIFKDMKSAIQSSKLWNNQWKQQLQGKRRRSNVXXXXXXXX 842
                     + H       +F+D+K+ ++S+                            
Sbjct: 757 RSSLSLNNANVNHEKSRSSRLFEDLKNVVKSTP--------------------------- 789

Query: 843 XXXXXXXXXXXXXXXXXXXGYVISMRSCVCLNNMASILNMIDEVEKSFQLNQLSEEV--- 899
                               Y    R+CV LN++   L +++  E+    +++S  +   
Sbjct: 790 -------------KMVAPAPYQFKKRTCVLLNDLDKTLFLLESFEEKADPSKISSVIAQY 836

Query: 900 -RAHVTDDNNKKIKSEIKGQLWSIVPIAAEG 929
             +H  +DN K    +   Q++++  I AE 
Sbjct: 837 HSSHNLEDNGKSFDDQNMKQVYTLRIIGAEN 867

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 123/278 (44%), Gaps = 49/278 (17%)

Query: 1058 ESGLEKSLVLPLDTQGRIHVRVCLEVERAEPDCIVGKTRRIVARILTQSLKQVTNRFEPC 1117
            + G      L L+ QG ++ ++ LE E+ +    +G+  R  +R   +++  + N+F   
Sbjct: 957  DDGFPIDFSLTLNPQGTLYCQISLESEKIDAVSSMGRIYRSFSRSRDRAINLIVNKFSDF 1016

Query: 1118 INDXXXXXXXXXXXXXXVPGQR----PTDDDIYDSLVPLFDHLNENLTVLAQALPTALLH 1173
            I                V G       +D+ +YD+++PLFD+LN NL +LA  L   LL 
Sbjct: 1017 I-----AFAFSRTTLKTVCGHHGSALASDEAVYDAILPLFDYLNANLNILASELSQRLLF 1071

Query: 1174 QIMLQVWNKILVXXXXXXXXXXXXXXXXXXXNSEYNFGSRGNRMXXXXXXXXXXXVWDTA 1233
             +ML+ WN +L                    N++       N             +W+  
Sbjct: 1072 MVMLRAWNLVL-------------------ENADLLLLPALNSAKVNILRSAKKSLWENT 1112

Query: 1234 VSGFQKVLQKPGFTGWXXXXXXXXXXXXTVGTSLEVEIVFMWIDILCRDFFHNNGEGPPL 1293
            +S  + V      +G+               T  E+E VF W+D LC DFFHN GEGPPL
Sbjct: 1113 LSTTKTV------SGYGRPL-----------TQAEIEAVFKWLDALCVDFFHNKGEGPPL 1155

Query: 1294 DKLKNDQYQQLMLIASLFDNETCELKQTIEEEDQRSVP 1331
             +LKN+ YQ ++LI + +D    ELK    +E QR +P
Sbjct: 1156 AELKNEYYQNILLIPAFYDKSVSELK----DEVQRLIP 1189

>CAGL0G07579g 716580..720413 similar to tr|Q08748 Saccharomyces
           cerevisiae YOR296w, start by similarity
          Length = 1277

 Score =  192 bits (488), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 209/889 (23%), Positives = 377/889 (42%), Gaps = 126/889 (14%)

Query: 41  YSNVLKVVLFAYINEPRFRRKWKRVGSNVNSQRLRVKGASHDNGSNRLSTWFSHDPSXXX 100
           Y   L V+L  Y+ EPRF      V S    Q LR +          L            
Sbjct: 28  YHYTLIVILLEYMAEPRFH-----VNSTGAPQPLRDEMNQKSKSGEFL------------ 70

Query: 101 XXXXXXRSSIGGSSYNKESMKQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDVFLD 160
                 +SSIG    +  +   +L AL ++L+ I  NQ  ++D   +R LLKFYND FLD
Sbjct: 71  ---LREQSSIGSYQNSSSAKDYLLVALTERLSLITRNQIKVTDPNFKRCLLKFYNDYFLD 127

Query: 161 SQFKQTLGTMTKPEDLIILFVKSANKELTKLETKDPKSDLFVQMSRFINILIDLSRDTKM 220
              K  L   +  ED++  F +SANKEL K+   +   +L+ Q++ F+ +LI+ + +  M
Sbjct: 128 PNMKIKLKQTSNIEDIVAYFSQSANKELNKVLLDNFSLELYRQVASFLELLINCTPEKYM 187

Query: 221 GPTYVKRLNAYKNSLKQGDN---NKRSPSPINGNVMTSKDEESKLVDDTLQPTFRLSEIT 277
              +  +L A K++ +        KR    +N NV  +            QP++ L +I+
Sbjct: 188 A-DFKPKLEAMKSTFEPNRYRPLTKRYSLDMNSNVPITAQR---------QPSWNLDDIS 237

Query: 278 HSKILTTIFGVDELKLQRDVIRLSLSVKNDLYLHELSQYEQAIMKDEAELKPIDFGTMDQ 337
           H      +F +D++K+Q DV  +   +    Y +EL +    +      L   DF T  +
Sbjct: 238 HIGYFMKLFAMDKMKIQYDVNDILKHLSLSSYKNELLELRVKVKNSSFSLSVSDFPTERE 297

Query: 338 YSDWKDHQLKHLSELKDKVKHGFSGHNESGKNITKDMQLIPNDPRLIFQTLVNLILKHDF 397
           Y +W+++     ++L DK    FS   E   NI      IP++ + I   L  LI++ ++
Sbjct: 298 YRNWQNYIFGETTQLIDK----FSS--EQISNINAPTPCIPSNRKAIISKLFELIIQSEY 351

Query: 398 VRQERDNEASISLDSKFLLSRCLRYWLIDYGSAV---FVNAVSGCLHL--IRNLDFPEGM 452
              E+    ++S +S F + +C +YWL D+ S +   F  A++  L    + N++F E  
Sbjct: 352 KNDEK--VLALSKESTFFIFKCAKYWLSDFPSTIASLFFAAMNKVLFTNDMLNVEFVEKS 409

Query: 453 KMTQYVFGFMETRLSVEAPEHTDPLGWNKKDQDQWSTNQVTIFLWLTDEVYRCIECMFSS 512
            M       M + L + + E  +   WN  D+  W    V     +  + ++ I  +  S
Sbjct: 410 IM-------MVSNLFLRSRETKELTTWNNYDRILW----VKTLRVICSKTFKSISILL-S 457

Query: 513 KTRDTKLKSVIS--TYHALVEHDSVLIERDFQKSDMYKKQIHKLKKKTFLTIEQRYISLI 570
           K  D  L S     +++  +++     E   + +   KK    L+       +  Y SL+
Sbjct: 458 KLFDPNLPSFSPYLSFYFTIKYTDRYTEDYLKSTSFEKKWAESLRNNINRACQTYYQSLV 517

Query: 571 RHVPTDSEISIKHLHGLCESILDDIALIETKY-KPLTNLSSRYKFVGIIIHTYFSALFRD 629
             +P D  + I+H+  + E I   I  ++ KY KP+           ++     +A   D
Sbjct: 518 STLPRDETLEIQHIQDIAEKIYKMIEKLQKKYPKPMF---EDVNIAFVVADFLINAFLVD 574

Query: 630 LKILMQRIKKYNK-------PIDTDALDTYKLLNELRWKNYXXXXXXXXXXXXLEPIFYK 682
           L+ +++ +K Y+K       P+  D L+ YK + +LR + Y            LE +F +
Sbjct: 575 LETMLRFVKHYHKIASKSIAPV--DGLECYKAIVDLR-EIYVQIKPNELFPINLESMFGQ 631

Query: 683 YLLSFCENTGDVVKQGCERIIIHETWEPMDKEADQWYSRSAYDISRLISDTLRLVEQLQW 742
           +L +  ++    +    +  I  E W  M+     +YS S  DI RL+++ +++  +  W
Sbjct: 632 FLQALNDDIKKRIMHVVKSSIKAEKWVRMNDAT--YYSTSIVDIFRLVNEAVQIFTKFDW 689

Query: 743 NDLAQLGTAYSVVLGKISECVLHYARCMEDIVREDL------CISENDEQNGQGQGMGHR 796
            D  ++    + +L + +E + +Y   ++++   DL       I+   E      G+  +
Sbjct: 690 EDQYEIAYLTTNILSEFTEGLKYYCSKLQNLAENDLQMDVINLITVTPESTPLSSGI-EK 748

Query: 797 LGNDVSIFKDMKSAIQSSKLWN-NQWKQQLQGKRRRSNVXXXXXXXXXXXXXXXXXXXXX 855
           L              +  K W+ +Q K+ L+ K                           
Sbjct: 749 LD-------------KKGKTWSFHQMKRALKSK--------------------------P 769

Query: 856 XXXXXXGYVISMRSCVCLNNMASILNMI---DEVEKSFQLNQLSEEVRA 901
                  Y  ++R+CV LNN+ ++L MI   DE+ K  +L++   E +A
Sbjct: 770 SIMVPAPYEYTVRTCVILNNLDAMLGMITRLDELVKPQELSKYLSEAKA 818

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 115/274 (41%), Gaps = 46/274 (16%)

Query: 1055 RKNESGLEKSLVLPLDTQGRIHVRVCLEVERAEPDCIVGKTRRIVARILTQSLKQVTNRF 1114
            R +++GL   + + +  +G +++ V LE E+ +P   +G   R   R   + L  +  +F
Sbjct: 928  RFSDNGLPSEMSIAMSPKGHLNIHVTLETEKMDPLFCIGNAYRTALRSKEKLLNMIVTKF 987

Query: 1115 EPCINDXXXXXXXXXXXXXXVPGQRP------TDDDIYDSLVPLFDHLNENLTVLAQALP 1168
               +                V  ++        ++ +YD++VPLFD+LN NL++LA  LP
Sbjct: 988  STVV-----AHIISKNTLKFVKAEKKNYVGKDAEEVVYDAIVPLFDYLNSNLSILASELP 1042

Query: 1169 TALLHQIMLQVWNKILVXXXXXXXXXXXXXXXXXXXNSEYNFGSRGNRMXXXXXXXXXXX 1228
              LL +++L+ W+ IL+                   NS                      
Sbjct: 1043 KELLFEVILKAWDVILLRADSMLLPSLSSISSSGLVNS------------------ARKS 1084

Query: 1229 VWDTAVSGFQKVLQKPGFTGWXXXXXXXXXXXXTVGTSLEVEIVFMWIDILCRDFFHNNG 1288
            +W  ++S        P  +G+               T  ++ IVF W+D LC DFFHN G
Sbjct: 1085 IWRNSISS------NPTISGFGKPL-----------TEEDISIVFKWLDALCIDFFHNEG 1127

Query: 1289 EGPPLDKLKNDQYQQLMLIASLFDNETCELKQTI 1322
             GP ++ LKN +Y  ++ I   +     ELK+ I
Sbjct: 1128 AGPSIENLKNVKYTSMLNIPKFYGTSVPELKKLI 1161

>Scas_665.25
          Length = 1272

 Score =  185 bits (469), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 194/795 (24%), Positives = 356/795 (44%), Gaps = 93/795 (11%)

Query: 5   RILSTDSSFST---------PSLGETFDFVPLDTGYSLCDDLDLVYSNVLKVVLFAYINE 55
           R++S  SSFS+         PS  +T D           ++    Y + L++VL  Y +E
Sbjct: 3   RVVSDTSSFSSGNLPIICSNPSPFKTTD-----------EERRTAYRHALQIVLLEYSHE 51

Query: 56  PRFRRKWKRVGSNVNSQRLRVKGASHD-NGSNR--LSTWFSHDPSXXXXXXXXXRSSIGG 112
           PRF++++ + G+   S+R  V   +     SNR  ++T FS +                 
Sbjct: 52  PRFQKQYMQQGAL--SERKDVSNITLSMTQSNRDPMATTFSEE----------------- 92

Query: 113 SSYNKESMKQVLQALEQKLTRIAMNQDIISDSMLRRSLLKFYNDVFLDSQFKQTLGTMTK 172
                +++  VL  L + + +I + +  + +  LRRS  +FY ++            MT 
Sbjct: 93  -----QALNYVLTLLREYIYKIIIREVDLQNENLRRSYSRFYGNILAGG----PPSAMT- 142

Query: 173 PEDLIILFVKSANKELTKLETKDPKSDLFVQMSRFINILIDLSRDTKMGPTYVKRLNAYK 232
            E+LI+ F K+A+ EL KL  KD   ++  +   F+N L+ L    K  PT         
Sbjct: 143 VEELIMQFSKAASNELCKLPIKDVSKEVTKETEEFVNFLLSLV--PKEAPT--------- 191

Query: 233 NSLKQGDNNKRSPSPINGNVMTSKDEESKLVDDTL--QPTFRLSEITHSKILTTIFGVDE 290
             L Q   N R    +   V   +    + +D T   +P F +S ITH+K    +F V++
Sbjct: 192 --LSQKIKNIRDIQKVRKPVSNRRPLPRQQLDGTQINRPNFTVSSITHAKYFANLFEVED 249

Query: 291 LKLQRDVIRLSLSVKNDLYLHELSQYEQAIMKDEAELKPIDFGTMDQYSDWKDHQLKHLS 350
             LQRD+  +  +V + +Y  ELS+    + K +  L   DF    +Y+ WK+++   ++
Sbjct: 250 DYLQRDIDVILPNVTSKIYCWELSRLSNNLKKGKGSLSRNDFHNEREYNSWKNYEQGEIA 309

Query: 351 ELKDKVKHGFSGHNESGKNITKDMQLIPNDPRLIFQTLVNLILKHDFVRQERDNEASISL 410
              D+   G    + +  N      +IP  PR  F  L+  + + +     +    ++S 
Sbjct: 310 SQLDRF--GVESRDLASMNFP---NIIPQYPRETFVALLCFVFRKECPADSKS--INLSQ 362

Query: 411 DSKFLLSRCLRYWLIDYGSAVFVNAVSGCLHLIRNLDF--PEGMKMTQYVFGFMETRLSV 468
            + F L++C +YW +D+ + +     S     I + DF  PE   +T+ +F  +  R+ +
Sbjct: 363 AAMFFLTKCSKYWRVDFPTTLAALVYSAANKSILSQDFLNPE---LTENLFSMIRRRI-L 418

Query: 469 EAPEHTDPLGWNKKDQDQWSTNQVTIFLWLTDEVYRCIECMFSSKTRDTKLKSVISTYHA 528
           ++ ++ D   WN  D+DQW  N +T      + +   I  ++           ++  Y  
Sbjct: 419 KSDDNIDTSIWNTTDRDQWILNLLTTGKQCINSLCGLISQLYEEP--KPTFSPILRFYFQ 476

Query: 529 LVEHD---SVLIERDFQKSDMYKKQIHKLKKKTFLTIEQRYISLIRHVPTDSEISIKHLH 585
            +E D   S L+E +  K     K I KL+KK   T    Y+S IR +P D+ I  +H  
Sbjct: 477 YIEEDPFISSLLESN--KFTEKSKWIKKLRKKLKDTSVDFYMSQIRKIPRDNTIEFQHYQ 534

Query: 586 GLCESILDDIALIETKY-KPLTNL-SSRYKFVGIIIHTYFSALFRDLKILMQRIKKYNKP 643
            + ESI   I L++ KY KPL ++ +       I++  + + + + L  + ++ KK +  
Sbjct: 535 DVVESIYRQIKLLQKKYSKPLLDMINIPVSCADILLKVFCTDVVKILGTIEKKGKK-DSL 593

Query: 644 IDTDALDTYKLLNELRWKNYXXXXXXXXXXXXLEPIFYKYLLSFCENTGDVVKQGCERII 703
             ++ALD YK + +LR+  Y            LE  F KYL   C        +  ++ +
Sbjct: 594 GPSNALDLYKSMKDLRFI-YVQVETEEDFPIKLEDFFNKYLRRLCNEATLTEDKIIKKSL 652

Query: 704 IHETWEPMDKEADQWYSRSAYDISRLISDTLRLVEQLQWNDLAQLGTAYSVVLGKISECV 763
             E WE +  +A    S S  DI + I+  +++ ++++W D  Q+    + +L    + +
Sbjct: 653 KDEKWESIHDDAR--ISFSVTDIFKSINQNIKMFQEIEWGDEYQIAKVLTKLLNSFLDGL 710

Query: 764 LHYARCMEDIVREDL 778
             Y++ + D+++ D+
Sbjct: 711 QFYSKFVLDLIQRDM 725

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 117/273 (42%), Gaps = 45/273 (16%)

Query: 1055 RKNESGLEKSLVLPLDTQGRIHVRVCLEVERAEPDCIVGKTRRIVARILTQSLKQVTNRF 1114
            R  + G    + LPL+ QG I+++V LE E+ +    +GK+ R + R   + L  +  +F
Sbjct: 933  RFKDDGYPNDVSLPLNDQGMIYLQVSLESEKDDVSFSLGKSYRTLDRTCDRVLDLIVEKF 992

Query: 1115 EPCINDXXXXXXXXXXXXXXVPGQRPTDDDIYDSLVPLFDHLNENLTVLAQALPTALLHQ 1174
               I                   Q  T+D I D++VPL+++++ NL +L   + T LL+ 
Sbjct: 993  TLFIKFSFSRETLVSLHGSEGTNQ-VTEDQIGDAIVPLYNYIDLNLNILGSGVSTELLNA 1051

Query: 1175 IMLQVWNKILVXXXXXXXXXXXXXXXXXXXNSEYNFGSRGNRMXXXXXXXXXXXVWDTA- 1233
            I+L+VW  I+                     +E    S+ +RM           +W    
Sbjct: 1052 IILKVWLVIMT--------SADFLMLPSLSTAEQKHRSKSSRM----------SLWGGHS 1093

Query: 1234 --VSGFQKVLQKPGFTGWXXXXXXXXXXXXTVGTSLEVEIVFMWIDILCRDFFHNNGEGP 1291
              +SG+ + L                       T  E++ +F W+  +  DF +NNG+GP
Sbjct: 1094 HDISGYGRPL-----------------------TFNEIKTIFRWLRSISVDFLYNNGQGP 1130

Query: 1292 PLDKLKNDQYQQLMLIASLFDNETCELKQTIEE 1324
            PL +L N  Y+ L +I   +D     LK+ +E+
Sbjct: 1131 PLKELHNHYYENLQIILKYYDKNVHSLKKKVEK 1163

>Kwal_55.20302
          Length = 710

 Score =  162 bits (410), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 158/687 (22%), Positives = 278/687 (40%), Gaps = 122/687 (17%)

Query: 647  DALDTYKLLNELRWKNYXXXXXXXXXXXXLEPIFYKYLLSFCE----NTGDVVKQGCERI 702
            DA +TYK L EL    Y            LE  F KYL   C+    +T  V++   E+ 
Sbjct: 21   DATETYKSLRELA-DIYAQVEPSKSFPFKLERYFIKYLSELCDEACSSTLGVIQTALEK- 78

Query: 703  IIHETWEPMDKEADQWYSRSAYDISRLISDTLRLVEQLQWNDLAQLGTAYSVVLGKISEC 762
               ETWEP+  E    YS S  D+ ++I ++  L  +L W +  Q+   Y+ +L  +++ 
Sbjct: 79   ---ETWEPI--EYSTGYSTSVVDVFKMIHESFDLFLKLNWGNGYQISKIYTFLLKAVADG 133

Query: 763  VLHYARCMEDIVREDLCISENDEQNGQGQGMGHRLGNDVSIFKDMKSAIQSSKLWNNQWK 822
            +  YA  +  ++ +++  ++++E   +  G  ++    +SI     +A +  K W     
Sbjct: 134  LSLYASNVAKLIEDEVKSTQSEETEAESYGNENK---RLSILSQTAAA-KMKKTW----- 184

Query: 823  QQLQGKRRRSNVXXXXXXXXXXXXXXXXXXXXXXXXXXXGYVISMRSCVCLNNMASILNM 882
              L G+ + +                              +    ++CVCL+N+  ++ M
Sbjct: 185  --LYGEMKNA-------------------LKSNEISIPKPFKFQNKTCVCLSNLDRMMQM 223

Query: 883  IDEVEKSFQLNQLSEEVRAHVTDDNNKKIKSEIKGQ----LWSIVPIAAEGAPCVGGKDN 938
            + E+E+    +++S+ V  H   +   + K+E++ +    ++++  I AE         N
Sbjct: 224  VTELEERVNPDEVSKAVNKHEISNAKSRKKAEMQNRGLRHIYTVKVIRAENIRVAANDSN 283

Query: 939  QSPRYSLSIVDTAKRHEIYRTLVGGFPXXXXXXXXXXXXXPQERM-SLSLVLWQEKQEAG 997
                 S+SI+DT  R E   T                   P + +   + +LW  KQ   
Sbjct: 284  TLS--SISIIDTNNRREFATTREVLKVTRPIWNEEFEIEIPMDDVRPFNFILWHHKQ--- 338

Query: 998  ANXXXXXXXXXKYNSGTGTRTSETQXXXXXXXXXXXXXXXXXRCYLDLDMPRDMLKSRKN 1057
                        +NS                           R +L L+ P  M      
Sbjct: 339  -----------SFNSVNS--------------------KVYGRSFLYLN-PHKM-----R 361

Query: 1058 ESGLEKSLVLPLDTQGRIHVRVCLEVERAEPDCIVGKTRRIVARILTQSLKQVTNRFEPC 1117
            + G  + + L LDT G++ ++V +E E+ +    +G+  R + R L +S++ + ++F+  
Sbjct: 362  DDGYPQDISLNLDTTGQVLLQVSVETEKVDALFSMGRAYRSLNRALDRSIELIVSKFQVF 421

Query: 1118 INDXXXXXXXXXXXXXXVPGQ-RPTDDDIYDSLVPLFDHLNENLTVLAQALPTALLHQIM 1176
            ++                 GQ R     +YDS++PLFD+LN NL +LA  LP  LL++IM
Sbjct: 422  VH--FAFSKATLRAVCGPNGQIRADKTAVYDSILPLFDYLNANLDILATRLPRELLYKIM 479

Query: 1177 LQVWNKILVXXXXXXXXXXXXXXXXXXXNSEYNFGSRGNRMXXXXXXXXXXXVWDTAVSG 1236
            L+ W++IL+                   N                       +W+ AV  
Sbjct: 480  LEAWDEILIQADDLLLPLSSDAPKLRNRN------------------IKNKSLWENAVGA 521

Query: 1237 FQKVLQKPGFTGWXXXXXXXXXXXXTVGTSLEVEIVFMWIDILCRDFFHNNGEGPPLDKL 1296
                  K G +                 T +E++ +F W+  LC DFFHNNGEGP L  L
Sbjct: 522  -----AKLGISSNSSSERPL--------TQIEIDTIFDWLRALCIDFFHNNGEGPSLSDL 568

Query: 1297 KNDQYQQLMLIASLFDNETCELKQTIE 1323
            KN  YQ+L+L+   +D    EL   ++
Sbjct: 569  KNAHYQKLLLVPVFYDRTVHELMSEVD 595

>CAGL0C05357g 510471..512000 similar to sp|P06700 Saccharomyces
           cerevisiae YDL042c SIR2, hypothetical start
          Length = 509

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 684 LLSFCENTGDVVKQGCERIIIHETWE 709
           LL FC++   VV Q CE  I H+ WE
Sbjct: 458 LLGFCDDVATVVAQKCEWDIPHKDWE 483

>CAGL0M05885g complement(620069..621535) similar to sp|P36146
           Saccharomyces cerevisiae YKR063c LAS1 involved in cell
           morphogenesis, hypothetical start
          Length = 488

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 112 GSSYNKESMKQVLQALEQKLTRIAMNQDIISD-SMLRRSLLKFYNDVFLDSQFKQTLGTM 170
           G   N     Q+++ +++ +T +     +I D ++  R+ LKFY+D+FL    ++  G  
Sbjct: 226 GGKTNSSKADQLVKFIDETITEVKYLWKVIRDKNLFMRTFLKFYDDLFLSLLVRKLPGF- 284

Query: 171 TKPEDL-IILFVKSANKELTKLETKDPKSDLFVQMSRF 207
               DL +I ++ SA   L +    + K DL+   SRF
Sbjct: 285 ----DLELIKWMFSAYTVLYQDGNLELKQDLYAIRSRF 318

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 40,430,411
Number of extensions: 1688236
Number of successful extensions: 5056
Number of sequences better than 10.0: 25
Number of HSP's gapped: 5168
Number of HSP's successfully gapped: 38
Length of query: 1356
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1242
Effective length of database: 12,649,657
Effective search space: 15710873994
Effective search space used: 15710873994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)