Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B12804g85284042230.0
Sklu_2430.996681810991e-135
YMR102C83471910421e-128
Kwal_26.765574372910091e-125
ABL024W73470610061e-124
Scas_721.1288517189851e-120
CAGL0K03377g9787389321e-111
YKL121W8526948481e-100
Scas_717.689085197935e-92
CAGL0K11638g5922482953e-27
KLLA0D02530g7071281411e-08
AEL246C8152471357e-08
CAGL0H08932g902601293e-07
AGL234W6292141222e-06
KLLA0E23529g8262301222e-06
KLLA0E12287g3262491202e-06
Scas_719.526281261194e-06
Sklu_2318.17111241195e-06
KLLA0B01958g890781205e-06
Kwal_23.64297502531195e-06
AFL118W832811186e-06
YGL137W (SEC27)889811186e-06
Kwal_23.53514741331151e-05
AGR168W8252411161e-05
CAGL0L00781g673791142e-05
YBL008W (HIR1)8402121142e-05
CAGL0H03729g3032531122e-05
Scas_721.328222301133e-05
Kwal_0.2123031221103e-05
Scas_630.66212211123e-05
YLR429W (CRN1)6511261114e-05
Scas_704.406082191114e-05
YIL046W (MET30)640781115e-05
KLLA0D04840g3032521095e-05
CAGL0J04818g6541261105e-05
Kwal_27.125865092141106e-05
Sklu_2442.23032541078e-05
CAGL0E00561g8362291098e-05
Scas_571.46011381081e-04
ADL082C569761081e-04
CAGL0M05335g806841081e-04
Kwal_23.5769627781071e-04
Scas_718.6*5463211071e-04
YNL006W (LST8)3032541051e-04
CAGL0E02805g8403221062e-04
Sklu_2431.127492491052e-04
Kwal_27.12053755841052e-04
AAL009C3031221024e-04
KLLA0F27511g623761034e-04
KLLA0F10263g682981035e-04
Scas_624.111205801026e-04
Sklu_2382.21261911017e-04
KLLA0E04741g459781008e-04
AER114W6331261008e-04
Sklu_2160.376051990.001
Scas_713.50983245990.001
YDL145C (COP1)120180980.002
YBR198C (TAF5)798223980.002
Kwal_56.24478129694980.002
CAGL0D02090g277118950.002
Scas_695.15327123950.002
YCR084C (TUP1)713223960.003
Kwal_47.17465800108960.003
Sklu_1926.5509328950.003
ACR097W467171940.004
Scas_629.12671125950.004
YMR116C (ASC1)31986930.004
CAGL0C03608g643232940.004
CAGL0K12188g535205940.005
AER263C51397930.006
Scas_581.362650920.008
AEL269C455175910.008
Scas_605.18424140910.009
Scas_721.115*31886880.016
Scas_702.16816206890.017
Scas_592.4*31886870.021
Kwal_23.503574465880.027
ACR166W38884860.031
KLLA0A04928g86148860.042
YOR212W (STE4)423135850.048
Kwal_56.2389536764850.049
Kwal_56.23920937216850.058
CAGL0J03476g51786840.068
CAGL0G03399g36997830.073
AGR207C320153820.080
KLLA0D16390g93682840.081
AAR057W922121840.082
YLR129W (DIP2)943125830.092
AFR199C334202820.094
AGL190W37062820.11
CAGL0B01529g36949820.11
CAGL0M04279g94094820.11
AGL024W75671820.13
Kwal_27.1158582370820.13
KLLA0A08866g42388810.13
AGL196C93594820.14
ACR137W42568810.16
Scas_675.1887634810.17
KLLA0C08547g515267800.20
AER280C51073800.21
Scas_720.83d915239800.23
YBR103W (SIF2)535254790.25
KLLA0E07942g39084790.27
Kwal_55.21450503147790.27
Kwal_27.1038553673790.29
Scas_707.2273069790.30
YPR178W (PRP4)465173780.31
YGL004C (RPN14)41749780.34
CAGL0L02761g419163770.39
KLLA0E24508g32763770.40
Sklu_2406.11426138770.45
CAGL0F06853g38884760.48
AGR180W806160770.48
Sklu_2173.251559770.49
YKL021C (MAK11)468111760.52
CAGL0C00737g81680770.53
Scas_712.3439940760.54
CAGL0L02629g79563760.61
Scas_685.11384105750.64
Kwal_34.1581834971750.68
KLLA0E03982g37252750.68
YCR057C (PWP2)923117760.69
Sklu_2435.1357568750.81
Kwal_23.624091366750.81
KLLA0C08976g911121750.85
Sklu_675.130871740.89
CAGL0K09284g911123750.89
YGR200C (ELP2)78846750.89
YCR072C51559741.0
Scas_700.27*43396741.1
CAGL0M02277g42764741.1
CAGL0A00561g412100731.1
YLR222C (UTP13)81769741.2
Scas_356.3d57999741.2
YPL151C (PRP46)45164731.2
Sklu_2420.244164731.3
Kwal_56.2416372926731.5
Kwal_56.2433241894721.5
ADR090W123366731.6
CAGL0B03575g41992721.8
Kwal_23.632451456721.9
Scas_631.1747433721.9
KLLA0F22000g79339722.2
YDR030C (RAD28)506215712.2
YER107C (GLE2)36546712.3
KLLA0E21879g33324702.4
KLLA0F11231g43464712.4
KLLA0F13244g81471712.5
Scas_720.9551596712.5
YBR175W (SWD3)31569702.6
Kwal_33.1351539890702.7
Scas_558.372579712.9
CAGL0G01628g37643703.0
Sklu_2416.5459114703.1
Kwal_23.5962552107703.2
Kwal_27.1266772182703.3
Sklu_1963.2314121693.5
CAGL0J08778g298182693.5
Scas_603.558970693.8
Scas_720.4575525693.8
Kwal_26.757021878683.8
CAGL0M06193g316145684.4
KLLA0D07546g64763694.5
KLLA0B11077g56774694.5
ADL135C621103694.8
Scas_660.851038685.0
YDR142C (PEX7)37553685.0
Scas_465.4100263695.0
Kwal_56.24596294185675.1
Kwal_26.877643363685.1
Kwal_33.15591714102685.1
Kwal_27.1223931672675.2
CAGL0K00957g79330685.3
YBR281C87839685.5
YJL112W (MDV1)714174685.5
YFL009W (CDC4)77966685.7
ADL322C50146685.8
YPR137W (RRP9)57368676.3
ADL218C40347677.0
YNL317W (PFS2)46578677.2
Kwal_56.2303542456677.4
ADR264C346135667.5
AEL098W48759669.2
ACR091W32864659.3
Kwal_14.88439597669.4
Scas_719.7*133347669.5
Scas_679.2881571669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B12804g
         (840 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...  1631   0.0  
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                         427   e-135
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...   405   e-128
Kwal_26.7655                                                          393   e-125
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...   392   e-124
Scas_721.128                                                          384   e-120
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...   363   e-111
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...   331   e-100
Scas_717.68                                                           310   5e-92
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...   118   3e-27
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    59   1e-08
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    57   7e-08
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    54   3e-07
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    52   2e-06
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    52   2e-06
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    51   2e-06
Scas_719.52                                                            50   4e-06
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          50   5e-06
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    51   5e-06
Kwal_23.6429                                                           50   5e-06
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    50   6e-06
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    50   6e-06
Kwal_23.5351                                                           49   1e-05
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    49   1e-05
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    49   2e-05
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    49   2e-05
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    48   2e-05
Scas_721.32                                                            48   3e-05
Kwal_0.212                                                             47   3e-05
Scas_630.6                                                             48   3e-05
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    47   4e-05
Scas_704.40                                                            47   4e-05
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    47   5e-05
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    47   5e-05
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    47   5e-05
Kwal_27.12586                                                          47   6e-05
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            46   8e-05
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    47   8e-05
Scas_571.4                                                             46   1e-04
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    46   1e-04
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    46   1e-04
Kwal_23.5769                                                           46   1e-04
Scas_718.6*                                                            46   1e-04
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    45   1e-04
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    45   2e-04
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      45   2e-04
Kwal_27.12053                                                          45   2e-04
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    44   4e-04
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    44   4e-04
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    44   5e-04
Scas_624.11                                                            44   6e-04
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         44   7e-04
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    43   8e-04
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    43   8e-04
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         43   0.001
Scas_713.50                                                            43   0.001
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    42   0.002
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    42   0.002
Kwal_56.24478                                                          42   0.002
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    41   0.002
Scas_695.15                                                            41   0.002
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    42   0.003
Kwal_47.17465                                                          42   0.003
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         41   0.003
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    41   0.004
Scas_629.12                                                            41   0.004
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    40   0.004
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    41   0.004
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    41   0.005
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    40   0.006
Scas_581.3                                                             40   0.008
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    40   0.008
Scas_605.18                                                            40   0.009
Scas_721.115*                                                          39   0.016
Scas_702.16                                                            39   0.017
Scas_592.4*                                                            38   0.021
Kwal_23.5035                                                           39   0.027
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    38   0.031
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    38   0.042
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    37   0.048
Kwal_56.23895                                                          37   0.049
Kwal_56.23920                                                          37   0.058
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    37   0.068
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    37   0.073
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    36   0.080
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    37   0.081
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    37   0.082
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    37   0.092
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    36   0.094
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    36   0.11 
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    36   0.11 
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    36   0.11 
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    36   0.13 
Kwal_27.11585                                                          36   0.13 
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    36   0.13 
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    36   0.14 
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    36   0.16 
Scas_675.18                                                            36   0.17 
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    35   0.20 
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    35   0.21 
Scas_720.83d                                                           35   0.23 
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    35   0.25 
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    35   0.27 
Kwal_55.21450                                                          35   0.27 
Kwal_27.10385                                                          35   0.29 
Scas_707.22                                                            35   0.30 
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    35   0.31 
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    35   0.34 
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    34   0.39 
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    34   0.40 
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      34   0.45 
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    34   0.48 
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    34   0.48 
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            34   0.49 
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    34   0.52 
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    34   0.53 
Scas_712.34                                                            34   0.54 
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    34   0.61 
Scas_685.11                                                            33   0.64 
Kwal_34.15818                                                          33   0.68 
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    33   0.68 
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    34   0.69 
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         33   0.81 
Kwal_23.6240                                                           33   0.81 
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    33   0.85 
Sklu_675.1 YMR146C, Contig c675 761-1687                               33   0.89 
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    33   0.89 
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    33   0.89 
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    33   1.0  
Scas_700.27*                                                           33   1.1  
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    33   1.1  
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    33   1.1  
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    33   1.2  
Scas_356.3d                                                            33   1.2  
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    33   1.2  
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            33   1.3  
Kwal_56.24163                                                          33   1.5  
Kwal_56.24332                                                          32   1.5  
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    33   1.6  
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    32   1.8  
Kwal_23.6324                                                           32   1.9  
Scas_631.17                                                            32   1.9  
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    32   2.2  
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    32   2.2  
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    32   2.3  
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    32   2.4  
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    32   2.4  
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    32   2.5  
Scas_720.95                                                            32   2.5  
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    32   2.6  
Kwal_33.13515                                                          32   2.7  
Scas_558.3                                                             32   2.9  
CAGL0G01628g complement(151262..152392) similar to sp|P53962 Sac...    32   3.0  
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           32   3.1  
Kwal_23.5962                                                           32   3.2  
Kwal_27.12667                                                          32   3.3  
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         31   3.5  
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    31   3.5  
Scas_603.5                                                             31   3.8  
Scas_720.45                                                            31   3.8  
Kwal_26.7570                                                           31   3.8  
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    31   4.4  
KLLA0D07546g complement(647984..649927) some similarities with s...    31   4.5  
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    31   4.5  
ADL135C [1606] [Homologous to ScYGR225W (AMA1) - SH] (454165..45...    31   4.8  
Scas_660.8                                                             31   5.0  
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    31   5.0  
Scas_465.4                                                             31   5.0  
Kwal_56.24596                                                          30   5.1  
Kwal_26.8776                                                           31   5.1  
Kwal_33.15591                                                          31   5.1  
Kwal_27.12239                                                          30   5.2  
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    31   5.3  
YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member o...    31   5.5  
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    31   5.5  
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    31   5.7  
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    31   5.8  
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    30   6.3  
ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887) [...    30   7.0  
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    30   7.2  
Kwal_56.23035                                                          30   7.4  
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    30   7.5  
AEL098W [2408] [Homologous to ScYNL277W (MET2) - NSH] complement...    30   9.2  
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    30   9.3  
Kwal_14.884                                                            30   9.4  
Scas_719.7*                                                            30   9.5  
Scas_679.28                                                            30   9.7  

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 1631 bits (4223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 787/840 (93%), Positives = 787/840 (93%)

Query: 1   MSNIATSHRPPGLNEKNGTNMINNGGENVDLFGTENIRDVYPGVETGGWVQGESADKIDW 60
           MSNIATSHRPPGLNEKNGTNMINNGGENVDLFGTENIRDVYPGVETGGWVQGESADKIDW
Sbjct: 1   MSNIATSHRPPGLNEKNGTNMINNGGENVDLFGTENIRDVYPGVETGGWVQGESADKIDW 60

Query: 61  LELVGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTAT 120
           LELVGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTAT
Sbjct: 61  LELVGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTAT 120

Query: 121 EPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAI 180
           EPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAI
Sbjct: 121 EPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAI 180

Query: 181 SQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHP 240
           SQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHP
Sbjct: 181 SQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHP 240

Query: 241 YGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTF 300
           YGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTF
Sbjct: 241 YGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTF 300

Query: 301 VHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYDGNYT 360
           VHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYDGNYT
Sbjct: 301 VHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYDGNYT 360

Query: 361 ILGTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLE 420
           ILGTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLE
Sbjct: 361 ILGTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLE 420

Query: 421 FIQKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQEFVSVMKGHSNEHSQITAHSTVTR 480
           FIQKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQEFVSVMKGHSNEHSQITAHSTVTR
Sbjct: 421 FIQKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQEFVSVMKGHSNEHSQITAHSTVTR 480

Query: 481 SGKAYVVSGSEDHWIYCWKLSDEVVXXXXXXXXXXXXXXXXXXXXXXFCRRRNNDSVASE 540
           SGKAYVVSGSEDHWIYCWKLSDEVV                      FCRRRNNDSVASE
Sbjct: 481 SGKAYVVSGSEDHWIYCWKLSDEVVKSTETSSKDSKSTRSRSGSLRSFCRRRNNDSVASE 540

Query: 541 TLDAVLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQVTKVLSLSNDLICELTMQF 600
           TLDAVLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQVTKVLSLSNDLICELTMQF
Sbjct: 541 TLDAVLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQVTKVLSLSNDLICELTMQF 600

Query: 601 WETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKTIPNVKGKSGVSGAQSN 660
           WETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKTIPNVKGKSGVSGAQSN
Sbjct: 601 WETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKTIPNVKGKSGVSGAQSN 660

Query: 661 NVPNIQISDGDXXXXXXXXXXXXXXPPSLIEFIGGIVVSADTTGVIRVFRSDISSNVRKK 720
           NVPNIQISDGD              PPSLIEFIGGIVVSADTTGVIRVFRSDISSNVRKK
Sbjct: 661 NVPNIQISDGDNRTTNAVNGTTAANPPSLIEFIGGIVVSADTTGVIRVFRSDISSNVRKK 720

Query: 721 VLNRLNAIEKQLKENGEGSVKPRTSGVSSVAAATNGSLSTATTFVGNGSNGHNVHSIERP 780
           VLNRLNAIEKQLKENGEGSVKPRTSGVSSVAAATNGSLSTATTFVGNGSNGHNVHSIERP
Sbjct: 721 VLNRLNAIEKQLKENGEGSVKPRTSGVSSVAAATNGSLSTATTFVGNGSNGHNVHSIERP 780

Query: 781 TPFPMQDSLPLVDEXXXXXXXXXXXXXXXXXRVCNVCGGTRFATDQTLSFNQAPQNVKYY 840
           TPFPMQDSLPLVDE                 RVCNVCGGTRFATDQTLSFNQAPQNVKYY
Sbjct: 781 TPFPMQDSLPLVDESSSSLTTLQQQQPHSQSRVCNVCGGTRFATDQTLSFNQAPQNVKYY 840

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score =  427 bits (1099), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 289/818 (35%), Positives = 406/818 (49%), Gaps = 141/818 (17%)

Query: 64  VGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNE-------- 115
           +  + F+++LK  E++KV++K+KG KQFRR  LAQEL+   +    +  +N         
Sbjct: 202 INRKQFEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKIGTSPVNSNVGTNNVDGIPHVA 261

Query: 116 -----------KGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLE 164
                        T +     G +VW ++FS DG+F+AT GKD ILRIWKVI+SP ERLE
Sbjct: 262 SSASIATLSSSSPTGSSSSSAGKSVWSMKFSKDGRFLATGGKDRILRIWKVIASPTERLE 321

Query: 165 LNQHSISFLKSTANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTK 224
           L+  ++   K+    +  LNG+L  Y  D       SG + T          N D     
Sbjct: 322 LDSSTMKPSKT----VCMLNGKLISYSRDVP----QSGFARTE---------NGDN---- 360

Query: 225 AVPQEQQGQTQGHRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDK 284
             P++    T G   P    + Y  VFHP P  +F  H  DILDIDWSKN+F+LTGSMDK
Sbjct: 361 --PEDDSLDTNG-MFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDK 417

Query: 285 SCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDC 344
           + KLWHC R   LK F H DFVT V+FHP DDRFF+S CLD K RLWSIL+ +V FE+DC
Sbjct: 418 TVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDC 477

Query: 345 GDLITAMDISY-DGNYTILGTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLK 403
           GDLIT++++S  D  YTILGTFNGY+ VL+T+ LE ++SF++ DK    KK    + R  
Sbjct: 478 GDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQD--KKGKDVTTRDL 535

Query: 404 KQSSDKAKNGPKITGLEFIQKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQEFV-SVM 462
             S     +GPK+TG+E  +        +  D++   LV+SNDS+IR++ L    +  V+
Sbjct: 536 PTSRTNTHHGPKVTGIECFR--------AVNDMTLKLLVTSNDSKIRVFNLKDNILQEVL 587

Query: 463 KGHSNEHSQITAHS-TVTRSGKAYVVSGSEDHWIYCWKLSDEVVXXXXXXXXXXXXXXXX 521
           KG  NE SQI+AH  T +++ + +V++ SEDHWIYCWKL   ++                
Sbjct: 588 KGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYCWKLQSSLMTKDKDKEHAAGKNSLP 647

Query: 522 XXXXXXFCRRRNNDSVASETLDAVLSRGYTKNH------------------QVSSNSNYI 563
                     R   S+ S   D+  +R ++K+                   Q   N+ YI
Sbjct: 648 RSGSLRGLLHRKL-SIGSNHSDS--NRSFSKSQKSHYHHLHLPHPHHSRENQHLKNNEYI 704

Query: 564 GFHAHHHPITCATAVPMQVTKVLSLSNDLICELTMQFWETTDDFTM---ESASKNARAKK 620
            FHAHHHP+T A A P +  + LSLSND ICELTM+F E  DD  +    +  +  + KK
Sbjct: 705 AFHAHHHPLTTAIAAPPETARTLSLSNDFICELTMEFCEDYDDVRIVNTYNKKQKQKKKK 764

Query: 621 NGNAISSNDGQKTDCRRKISIDKTIPNVKGKSGVSGAQSNNVPNIQISDGDXXXXXXXXX 680
           + +    +D    D                  G  G     +P +               
Sbjct: 765 DADIAQEDDACDND------------------GDVGTNPRRIPTVD-------------- 792

Query: 681 XXXXXPPSLIEFIGGIVVSADTTGVIRVFRSDISSNVRKKVLNRLNA--IEKQLKENGEG 738
                     EFIG I+V++D  GVIRVFRSDIS+N+RK+VL +L    ++    +    
Sbjct: 793 ----------EFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDKKNRN 842

Query: 739 SVKPR------TSGVSSVAAATNGSLSTATT------FVGNGSNGHNVHSIE--RPTPFP 784
           SV          S V ++   T  ++  AT        +GN S+ ++V S+   R +   
Sbjct: 843 SVSISEVNDEIASAVHALGNLTTNTVKAATAGFNKSCPMGNYSHSNSVLSLSTMRSSKSS 902

Query: 785 MQDSLPLVDEXXXXXXXXXXXXXXXXXRVCNVCGGTRF 822
              S+P   E                   C+VCGG  F
Sbjct: 903 TAQSIPSSQETTTEHVLPAASDSQMR---CDVCGGVNF 937

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score =  405 bits (1042), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 248/719 (34%), Positives = 375/719 (52%), Gaps = 108/719 (15%)

Query: 64  VGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTATEPM 123
           +  E F+ +L+  +++K+ +++K  KQFRRL LAQEL  +  E   S+S + + T+    
Sbjct: 118 IDTEQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEGETVTSTSKSSEPTSK--- 174

Query: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQL 183
               A+W  +FS DGKFMAT  KD  +RIWKVI SP ER EL+  + S  ++ A ++ ++
Sbjct: 175 ----AIWSTKFSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSM-RI 229

Query: 184 NGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGL 243
             Q+         +SLN+      +DS                       T+ +     L
Sbjct: 230 KQQV---------SSLNNPKEKQFLDS----------------------ATEKYEEKEKL 258

Query: 244 GDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHS 303
            + Y  VFHP PL  + EH  D+LDI+WSKN+FIL+ SMDK+ KLWH  R  SLKTF+H 
Sbjct: 259 LNLYAPVFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHP 318

Query: 304 DFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDIS-YDGNYTIL 362
           DFVT V FHP DDRFF+S CLD KCRLWSIL+ +V FEYDC DLIT++ +S  +G YTI+
Sbjct: 319 DFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTLSPEEGKYTII 378

Query: 363 GTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFI 422
           GTFNGY+H+L+T+ L  + SF+V D+ ++ +  H     +  ++  K ++GP++TGL+  
Sbjct: 379 GTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAH----VMVTETDSKIRHGPRVTGLQAF 434

Query: 423 QKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRS 481
           +        S  D S   +V+SNDSRIRI+ L Q + + V+KG  +  SQ  A  ++   
Sbjct: 435 R--------SQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWH- 485

Query: 482 GKAYVVSGSEDHWIYCWKL--------SDEVVXXXXXXXXXXXXXXXXXXXXXXFCRRRN 533
           G+  VV+ S+DHW+Y W+L         DE                           + N
Sbjct: 486 GQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSGSLRSIFSKSMSRSSSQNN 545

Query: 534 NDSVASE-TLDAVLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQVTKVLSLSNDL 592
            +       L  +L   +  N     N++YI FHAH+ P+TC +  P + +K LSLSND+
Sbjct: 546 EEKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLSLSNDV 605

Query: 593 ICELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKTIPNVKGKS 652
           ICEL+++F++T+D F + S              S++DG  +D    +  +    ++   S
Sbjct: 606 ICELSLEFFQTSDSFDVLSR-------------SNDDGIMSDVESSLGYNSKPGSISNAS 652

Query: 653 GVSGAQSNNVPNIQISDGDXXXXXXXXXXXXXXPPSLIEFIGGIVVSADTTGVIRVFRSD 712
             S                               P +++ IG I++S D  G IRVFR+D
Sbjct: 653 ATSAI-----------------------------PDVVDAIGTILISTDNVGTIRVFRAD 683

Query: 713 ISSNVRKKVLNRLNAIEKQLKE--NGEGSVKPRTSGVSSVAAAT-NGSLSTATTFVGNG 768
           + S +RK+VL +L    ++++   N   S+   +   +S A +   G  + A T  G G
Sbjct: 684 MPSVIRKRVLLKLEEYNREVRRRFNSSDSLHSLSRSFNSRAKSNLAGQPAAAYTNTGKG 742

>Kwal_26.7655
          Length = 743

 Score =  393 bits (1009), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 264/729 (36%), Positives = 354/729 (48%), Gaps = 162/729 (22%)

Query: 64  VGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTATEPM 123
           +  E F ++LK  +++KV+ ++   KQFRRL LAQELR   +   D +SS+    +T   
Sbjct: 116 INREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHAS---DLTSSSSTTLSTLSE 172

Query: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQL 183
            +  AVW  +FS DGK+MAT GKD  LR+WKVI+SP ER +L         S+A A  Q 
Sbjct: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDL---------SSATAKPQ- 222

Query: 184 NGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGL 243
                         S+    S T             G S K  P++  G       P  +
Sbjct: 223 ----------AKRISMRVPPSPT------------VGRSVKEEPEQPIG-------PASM 253

Query: 244 GDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHS 303
            D Y  VFHP P   + EHT DILD+DWSKN FILT SMDK+ +LWHC RP +LK F H 
Sbjct: 254 -DLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHP 312

Query: 304 DFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDIS-YDGNYTIL 362
           DFVT  +FHP DDRFF+S CLD   RLWSIL+  V F+Y CGD+ITA+D S  DG YT  
Sbjct: 313 DFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAA 372

Query: 363 GTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFI 422
           GTFNG+I +L T+ LE++ +F+VL+K +       T++++        ++GPKITG+EF 
Sbjct: 373 GTFNGHIIILYTRGLEMVSTFHVLEKPNG------TTKKV-------PESGPKITGIEFF 419

Query: 423 QKDARNYKISSKDVSDWFLVSSNDSRIRIYTLN-QEFVSVMKGHSNEHSQITAHSTVTRS 481
           +        S+ D     +V+SNDSRIRI+ +  Q  + V+KG  N HSQI+AH  +  S
Sbjct: 420 K--------SAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPS 471

Query: 482 GKAYVVSGSEDHWIYCWKLSDEVVXXXXXXXXX-----------XXXXXXXXXXXXXFCR 530
            K +V++ SE+ W+YCW++                                        R
Sbjct: 472 KKIFVLAPSENQWVYCWRVESSAGVSNSDDSQNNGTHRRGSIRGLLQRSLSIGSSQSPER 531

Query: 531 RRNNDSVASETLDAVLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQVTKVLSLSN 590
           +   +   S +L        +K  Q   N +YI FHAH   +T     P+   K L+LS+
Sbjct: 532 QEYKNGSHSHSLHLPSPTAKSKGDQYIKNQHYIAFHAHRCTVTTTAVAPVNTNKTLALSD 591

Query: 591 DLICELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKTD---CRRKISIDKTIPN 647
           D ICELTM   ET +D          + ++  + I S  G + D     R+         
Sbjct: 592 DFICELTMALSETDEDVAF------LKQQRRKSLIHSKKGSQKDRDLMERRF-------- 637

Query: 648 VKGKSGVSGAQSNNVPNIQISDGDXXXXXXXXXXXXXXPPSLIEFIGGIVVSADTTGVIR 707
                                                  PS+I+ IG IVVS D +G+IR
Sbjct: 638 ---------------------------------------PSMIDAIGTIVVSTDNSGIIR 658

Query: 708 VFRSDISSNVRKKVLNRLNAIEKQLKENGEGSVKPRTSGVSSVAAATNGSLSTATTFVGN 767
           VFRSDIS+NVRKKVL       K LKE    S  P  SG SS                  
Sbjct: 659 VFRSDISTNVRKKVL-------KCLKE----SSTPPMSGSSS------------------ 689

Query: 768 GSNGHNVHS 776
            SNG NVH+
Sbjct: 690 DSNGPNVHA 698

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score =  392 bits (1006), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 253/706 (35%), Positives = 346/706 (49%), Gaps = 131/706 (18%)

Query: 69  FKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRP-FGNEFQDSSSSNEKGTATEPMKNGG 127
            +R     E++KV  +KKG + FRRL +AQEL+P   +    + SS   G A        
Sbjct: 51  LRRFAAEPEYIKVLARKKGARCFRRLFVAQELQPPVDSPLHANHSSQSLGQAAPAGDKAR 110

Query: 128 AVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQL 187
           +VW +RFS DGK++A+ GK   L +WKVI+SP ER  L        K  +N +S LN QL
Sbjct: 111 SVWLLRFSKDGKYLASGGKGRQLCVWKVIASPMERWNLLP-VYGGDKHHSNTLSLLNQQL 169

Query: 188 AQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSY 247
            +Y G                              T+AVP     + +    P+ L   Y
Sbjct: 170 LKYSGK----------------------------RTEAVPAPGPERKEI---PFDLEQQY 198

Query: 248 CGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVT 307
             VFHP+P   F EH  DILD DWSKNSF+LT SMDK+ KLWH  R TSLKTFVH DFVT
Sbjct: 199 APVFHPDPHRVFGEHLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFVT 258

Query: 308 AVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYDGNYTILGTFNG 367
            VRFHP DDRFF S CLD   R WSILE +V   ++CGDLI A+D+S DGN+ ++GTFNG
Sbjct: 259 CVRFHPHDDRFFFSGCLDHTVRTWSILEGEVAEAFNCGDLIMALDVSPDGNWLLIGTFNG 318

Query: 368 YIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDAR 427
           Y+HVL T  L+LL SF++L K +E              + ++ ++GPKITG+EFI+  A 
Sbjct: 319 YVHVLHTNGLKLLHSFHLLQKPNE--------------TENRPRHGPKITGVEFIRHKAY 364

Query: 428 NYKISSKDVSDWFLVSSNDSRIRIYTLN-QEFVSVMKGHSNEHSQITAHSTVTRSGKAYV 486
            +           L++SNDSR+R++ ++    + + +G SNE S+I+AH      G++ V
Sbjct: 365 PWL--------GLLITSNDSRVRLFDMSTTRLLEIFRGFSNESSRISAHHLEMEDGESVV 416

Query: 487 VSGSEDHWIYCWKLSDEV-------VXXXXXXXXXXXXXXXXXXXXXXFCRR--RNNDSV 537
           +S SE+HW+Y W L  E        +                        RR    N  +
Sbjct: 417 LSASENHWLYTWMLHHEEYMYSHSDLDNARTVPSPIDGKDPKKHSIRNIFRRSISFNSDI 476

Query: 538 ASETLDAVLSRGYTKNHQVSS-------NSNYIGFHAHHHPITCATAVPMQVTKVLSLSN 590
            SE+ + V    +   H  +        NS YI FHAHH+P+T AT  P + T VLSLS+
Sbjct: 477 LSES-NPVARHHFPLFHHKAQHKGGCVKNSEYITFHAHHNPVTAATIAPKETTHVLSLSD 535

Query: 591 DLICELTMQF-WETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKTIPNVK 649
           D+ICEL M+F  E  +    +S  +             +   ++D +R  S +K      
Sbjct: 536 DIICELNMKFGGEALEHLRTKSIRE-----------PGSPAGRSDHKRNHSAEKNYSQST 584

Query: 650 GKSGVSGAQSNNVPNIQISDGDXXXXXXXXXXXXXXPPSLIEFIGGIVVSADTTGVIRVF 709
            K  V                                       G I+VSA  TG IRVF
Sbjct: 585 AKQNV---------------------------------------GTIIVSAAATGQIRVF 605

Query: 710 RSDISSNVRKKVLNRLNAI-------EKQLKENGEGSVKPRTSGVS 748
           R+D+SS+VR K L  + A        E+ LK        P ++GV+
Sbjct: 606 RTDVSSSVRAKALEAIRAAHGLPGSPERPLKPVLSALAHPLSAGVA 651

>Scas_721.128
          Length = 851

 Score =  384 bits (985), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 250/718 (34%), Positives = 370/718 (51%), Gaps = 128/718 (17%)

Query: 64  VGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTATEPM 123
           +  E F+ +LK  E++KV++K +  ++F+RL LAQEL     +  D ++ N   +     
Sbjct: 111 IDQEQFEIYLKEPEYIKVFKKHEDLEEFKRLFLAQELNVTTTKENDPTAQNTDAS----- 165

Query: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQL 183
               A+W ++FSHDGK+MAT  KD  + +WKVISSP ER EL++   S L + A +I   
Sbjct: 166 --NKAIWTLKFSHDGKYMATGSKDGCVMLWKVISSPVERWELDRAEESNLVAMAKSIR-- 221

Query: 184 NGQLAQYGGDTDSASLNSGS---SNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHP 240
                +   +T+ A LN+ S   ++T+++SL                             
Sbjct: 222 ----IKQNLETNEAHLNAPSRPPTDTNLESL----------------------------- 248

Query: 241 YGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTF 300
               + Y  +FHPNP+  + EH+ DILD+DWSKN+F+LT SMDK   LWH  R TSLK+F
Sbjct: 249 ----NLYAPIFHPNPVRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSF 304

Query: 301 VHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYD-GNY 359
            H DFVT+VRFHP+DDRFF+S CLD KCR+WSILE +V++E+DC DLITA+ IS   G +
Sbjct: 305 PHPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILENKVVYEFDCQDLITAISISPGVGEF 364

Query: 360 TILGTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGL 419
           TI+GTFNGYI +L T  L+ L++F+VLDK  +    + +S +     + K  +GP++TGL
Sbjct: 365 TIIGTFNGYITILSTFELKPLYTFHVLDKHMQGNSGNDSSFKNLLGQNLKNHHGPRVTGL 424

Query: 420 E-FIQKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHST 477
           + F++K+  + K+         LVSS DSRIRI+ L + + + V KG  +  SQ  A  +
Sbjct: 425 QLFLEKETDDLKL---------LVSSTDSRIRIFDLEKNKLIEVFKGFRSGLSQHNAQLS 475

Query: 478 VTRSGKAYVVSGSEDHWIYCWKLS--------------DEVVXXXXXXXXXXXXXXXXXX 523
                +  V++ S+DHW Y WK++               E +                  
Sbjct: 476 -NWGDQPIVINSSKDHWFYAWKINTSNPKTTQNFSSIRQERLSTGGGLNDLLNKSSEKKE 534

Query: 524 XXXXFCRRRN-NDSVASETLDAVLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQV 582
                 R     DS         LSR    +  V  NS+Y+ FHAHH P++ AT  P + 
Sbjct: 535 TTHELSRTSTAGDSSTRHHFLPSLSRLLPHSSHVVKNSHYVAFHAHHAPVSTATIAPQET 594

Query: 583 TKVLSLSNDLICELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISID 642
            K LSLSND ICELT+Q  E            + R    G++ SSN     D ++K + +
Sbjct: 595 AKTLSLSNDFICELTLQVME------------DIRKTTTGSSDSSNGRSSVD-KKKNASE 641

Query: 643 KTIPNVKGKSGVSGAQSNNVPNIQISDGDXXXXXXXXXXXXXXPPSLIEFIGGIVVSADT 702
           K++P V   SG+                                P  +  IG I+V+ DT
Sbjct: 642 KSLPTV--TSGI--------------------------------PDAVNAIGPILVTTDT 667

Query: 703 TGVIRVFRSDISSNVRKKVLNRLNAIEKQLKENGEGSVKPRTSGVSSVAAATNGSLST 760
            G IRVFR D+S+  R +VL +L    +  K+N +  +   T+     A+ + G+++T
Sbjct: 668 RGTIRVFRVDMSNATRSRVLKKL----QDYKQNSQDIIDSATTLNPLNASDSEGAINT 721

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score =  363 bits (932), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 242/738 (32%), Positives = 361/738 (48%), Gaps = 161/738 (21%)

Query: 61  LELVGNEDFKRHLKTGEHMKVYRKK-KGFKQFRRLILAQELRPF---------------- 103
              +  E F+ +LK   ++++++K+ +  KQFRRL LAQEL+                  
Sbjct: 188 FAFIDREQFETYLKEPRYIRIFKKRSRSSKQFRRLFLAQELKTTDEFDDIEAMSASLLSQ 247

Query: 104 ----------------GNEFQDS---------SSSNEKGTAT---------EPMKNGGAV 129
                           GN F D+         S     GTA          EP KN  A+
Sbjct: 248 PDGLKPNTSITNATLNGNNFHDNINDPNHDMHSDKTFSGTACPVLPTSGHLEPAKNTKAI 307

Query: 130 WCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLAQ 189
           W  +FS DGK+MAT  +D +LR+WKV+S+P ER  L+    S   ++A +   L  Q  Q
Sbjct: 308 WSTKFSIDGKYMATGSRDGVLRLWKVLSTPVERWGLDSSIDSAHLTSAKS---LRLQQNQ 364

Query: 190 YGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSYCG 249
           +G             ++H   LGS    RD F      +                + Y  
Sbjct: 365 HG-------------SSHGGPLGSPAMRRDTFDNIDAKENS-------------SNLYAP 398

Query: 250 VFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAV 309
           VF P P+ T+ EH  D+LD+DWSKN+F+++ SMDK+ KLWH ++  SLK+F H DFVT V
Sbjct: 399 VFQPTPVRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCV 458

Query: 310 RFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISY-DGNYTILGTFNGY 368
           +FHP DDRFF+S CLDQKCRLWSIL+ +V FE++C DL+T++ ++  DG YTI+GTFNGY
Sbjct: 459 KFHPTDDRFFISGCLDQKCRLWSILDDEVSFEFNCRDLVTSLTLTPGDGTYTIVGTFNGY 518

Query: 369 IHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSD-KAKNGPKITGLEFIQKDAR 427
           IHVL TK LE + SF+V       KK H  +  +   S+D K ++GP++TGL+       
Sbjct: 519 IHVLQTKGLEHITSFHV-----TAKKTHENTHEVLCPSNDSKVRHGPRVTGLQCFN---- 569

Query: 428 NYKISSKDVSDWFLVSSNDSRIRIYTLN-QEFVSVMKGHSNEHSQITAHSTVTRSGKAYV 486
               S  D S   +V+S+DSRIR++ L  ++ + +++G     SQ  A  +V R+ +  V
Sbjct: 570 ----SLIDNSLRLVVTSSDSRIRVFDLTRRKLIEILRGFQCGSSQHKAQISVYRN-QPIV 624

Query: 487 VSGSEDHWIYCWKL--SDEVVXXXXXXXXXXXXXXXXXXXXXXFC----------RRRNN 534
           ++ S+DHW+Y W+L  SD V                                   R+   
Sbjct: 625 INSSDDHWVYGWRLKSSDPVEINKKAKKHGMSRSGSIRGLFSKSISRSSSQGSEDRQSLR 684

Query: 535 DSVASETLDAVLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQVTKVLSLSNDLIC 594
           +++   +L  +    ++    V  NS+Y  FHAH+ P+T  T  P + +K LSLSND IC
Sbjct: 685 NTLKLSSLLPIPHSSHSDG--VMKNSDYFSFHAHNAPVTTVTMAPEETSKTLSLSNDPIC 742

Query: 595 ELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKTIPNVKGKSGV 654
           EL+++F+E +D+  +               I   D QK            IP  K     
Sbjct: 743 ELSLEFFEPSDEVDI---------------IKLKDTQKGG-------HDNIPATKTPVTT 780

Query: 655 SGAQSNNVPNIQISDGDXXXXXXXXXXXXXXPPSLIEFIGGIVVSADTTGVIRVFRSDIS 714
           S A+                            P+ +E IG I++S D+ G+IRVFR+D+S
Sbjct: 781 SLAK----------------------------PTPVEVIGSILISTDSNGLIRVFRADMS 812

Query: 715 SNVRKKVLNRLNAIEKQL 732
            ++R +VL +L    +++
Sbjct: 813 KSIRARVLQKLQKYNREM 830

>YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has moderate similarity to
           uncharacterized S. cerevisiae Ymr102p [2559 bp, 852 aa]
          Length = 852

 Score =  331 bits (848), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 228/694 (32%), Positives = 335/694 (48%), Gaps = 135/694 (19%)

Query: 60  WLELVGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTA 119
           + +L   + F+ +L+   ++K+++KK+G +QF R+ LAQEL+   + ++ ++   E   A
Sbjct: 109 YFDLFDRKYFENYLEEPTYIKIFKKKEGLEQFDRMFLAQELK-IPDVYKSTTYQGEPAVA 167

Query: 120 -TEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTAN 178
            +E  KN  ++ C  FSHDGK+M    KD  L +WKVI+SP +R E+ +   S   S AN
Sbjct: 168 NSELFKN--SICCCTFSHDGKYMVIGCKDGSLHLWKVINSPVKRSEMGRSEKSVSASRAN 225

Query: 179 AISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHR 238
           ++                          H+ S+ S N +      K   Q +    Q H 
Sbjct: 226 SLKI----------------------QRHLASISSHNGSISSNDLKPSDQFEGPSKQLHL 263

Query: 239 HPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLK 298
                   Y  VF+ +    F EH  DILD +WSKN F++T SMDK+ KLWH  R  SLK
Sbjct: 264 --------YAPVFYSDVFRVFMEHALDILDANWSKNGFLITASMDKTAKLWHPERKYSLK 315

Query: 299 TFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYD-G 357
           TFVH DFVT+  F P DDRF ++ CLD +CRLWSIL+ +V + +DC DLIT++ +S   G
Sbjct: 316 TFVHPDFVTSAIFFPNDDRFIITGCLDHRCRLWSILDNEVSYAFDCKDLITSLTLSPPGG 375

Query: 358 NYTILGTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSD--KAKNGPK 415
            YTI+GTFNGYI+VL+T  L+ + SF+V DK ++      T++     SS+  K ++GP+
Sbjct: 376 EYTIIGTFNGYIYVLLTHGLKFVSSFHVSDKSTQ-----GTTKNSFHPSSEYGKVQHGPR 430

Query: 416 ITGLE-FIQKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQE-----FVSVMKGHSNEH 469
           ITGL+ F  K  +N ++         +V++NDS+I+I+ LN++     F     G S   
Sbjct: 431 ITGLQCFFSKVDKNLRL---------IVTTNDSKIQIFDLNEKKPLELFKGFQSGSSRHR 481

Query: 470 SQITAHSTVTRSGKAYVVSGSEDHWIYCWK-----LSDEVVXXXXXXXXXXXXXXXXXXX 524
            Q      +    +  V +GS+DHW Y WK     LS E+                    
Sbjct: 482 GQF-----LMMKNEPVVFTGSDDHWFYTWKMQSFNLSAEMNCTAPHRKKRLSGSMSLKGL 536

Query: 525 XXXFCRRRNNDSVASETLDAVLSRGYTKN-----------HQVSSNSNYIGFHAHHHPIT 573
                 +  ND   +ET +   S  +T +            Q   N++YI FHAH+ P+T
Sbjct: 537 LRIVSNKSTNDECLTETSNQSSSHTFTNSSKNVLQTQTVGSQAIKNNHYISFHAHNSPVT 596

Query: 574 CATAVPMQVTKVLSLSNDLICELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKT 633
           CA+  P    K LSLSNDLI ELT Q+++       ES                    K 
Sbjct: 597 CASIAPDVAIKNLSLSNDLIFELTSQYFKEMGQNYSES--------------------KE 636

Query: 634 DCRRKISIDKTIPN--VKGKSGVSGAQSNNVPNIQISDGDXXXXXXXXXXXXXXPPSLIE 691
            C  K       PN  V    G S   SN V N                           
Sbjct: 637 TCDNK-------PNHPVTETGGFSSNLSNVVNN--------------------------- 662

Query: 692 FIGGIVVSADTTGVIRVFRSDISSNVRKKVLNRL 725
            +G I+++ D+ G+IRVFR+DI   +RKK++ + 
Sbjct: 663 -VGTILITTDSQGLIRVFRTDILPEIRKKIIEKF 695

>Scas_717.68
          Length = 908

 Score =  310 bits (793), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 192/519 (36%), Positives = 272/519 (52%), Gaps = 94/519 (18%)

Query: 247 YCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFV 306
           Y  VF+P+    F EHT D+LD+DWSKN+F++T SMD++ KLWH  R TSLKTF H DFV
Sbjct: 312 YAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFV 371

Query: 307 TAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISY-DGNYTILGTF 365
           T VRFHP DDRFF+S CLD K RLWSILE ++ FE+DC DLIT++ +S  DG YTI+GTF
Sbjct: 372 TCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIVGTF 431

Query: 366 NGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKD 425
           NGY+HVL+TK LE + SF+V+DK+++ +            +S K  +GP++TGLE  + +
Sbjct: 432 NGYVHVLLTKGLEQVSSFHVVDKNTQERNT----------ASTKIHHGPRVTGLECFKYE 481

Query: 426 ARNYKISSKDVSDWFLVSSNDSRIRIYTL-NQEFVSVMKGHSNEHSQITAHSTVTRSGKA 484
             N        S   +V+S+DSRIRI+ L  ++ +  +KG  +  SQ  A    T  G+ 
Sbjct: 482 PDN--------SLRIVVTSSDSRIRIFDLEKKKLLEYLKGFQSGASQHKA-CLATVKGQQ 532

Query: 485 YVVSGSEDHWIYCWKLSDEVVXXXXXXXXXXXXXXXXXXXXXXFCRRRNNDSVA-SETLD 543
            V+S S+DHW++ WKL                             ++ N+ S++ S +  
Sbjct: 533 VVLSSSDDHWVHGWKLKSST----SLTESEKNNNIDQTAATTTTTKKSNSHSISRSGSFR 588

Query: 544 AVLSRGYTKNH-----------------------QVSSNSNYIGFHAHHHPITCATAVPM 580
           ++ S+   K++                        V  NS+ I FHAHH P+T A   P 
Sbjct: 589 SLFSKSSKKDNIDENGKHSHLKLTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPS 648

Query: 581 QVTKVLSLSNDLICELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKIS 640
              K LSLSND I EL+ +F   + DF M + S       +G++       K+  R   S
Sbjct: 649 GTAKTLSLSNDFIYELSSEFAMESRDFEMNTNSDTHSVTTSGSS------DKSKIRSHSS 702

Query: 641 IDKTIPNVKGKSGVSGAQSNNVPNIQISDGDXXXXXXXXXXXXXXPPSLIEFIGGIVVSA 700
               +P                P+I                      S ++ IG I+V+ 
Sbjct: 703 SATLVP----------------PSI----------------------SAVDLIGSIIVTT 724

Query: 701 DTTGVIRVFRSDISSNVRKKVLNRLNAIEKQ-LKENGEG 738
           D TG+IRVFR+DISS +RKKVL  L   +K+ ++ N  G
Sbjct: 725 DNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSG 763

>CAGL0K11638g complement(1123343..1125121) weakly similar to
           sp|Q03177 Saccharomyces cerevisiae YMR102c, hypothetical
           start
          Length = 592

 Score =  118 bits (295), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 127/248 (51%), Gaps = 31/248 (12%)

Query: 265 DILDIDWSKNSFILTGSMDKSCKLW---HCARPTSLKTFVHSDFVTAVRFHPEDDRFFLS 321
           ++LD+ WS N F+L  S+D    LW      RP  +  F H D VT+ +F   DDRFF+S
Sbjct: 154 EVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRP--IMRFDHPDLVTSAKFIEADDRFFIS 211

Query: 322 ACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYD-GNYTILGTFNGYIHVLITKSLELL 380
            CLD   R WS+ + +V + ++C + I  + +S    ++T++GTF GYI+V  T  L+L+
Sbjct: 212 GCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLI 271

Query: 381 FSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDARNYKISSKD--VSD 438
             F++++         R+     +  +DK     KITG+E+I  D R  +I   +   + 
Sbjct: 272 DKFHIING--------RSIDGNLRNGADKI----KITGIEWIVTDNRLDEIQEDNEYSTA 319

Query: 439 WFLVSSNDSRIRIYTL------NQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSED 492
             +V+S D RIR++ L      N E    +KG   E  +  A   +    K ++   SED
Sbjct: 320 RIVVTSGDERIRVFKLTEGGYHNLE----LKGFHCEQFRHRAQLCI-WDDKPFIYCSSED 374

Query: 493 HWIYCWKL 500
            W Y W+L
Sbjct: 375 QWFYVWRL 382

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 27/37 (72%)

Query: 691 EFIGGIVVSADTTGVIRVFRSDISSNVRKKVLNRLNA 727
           + IG IVV+ D+ G +RVFR+D+S   R+ ++N L++
Sbjct: 547 DIIGPIVVTTDSVGKLRVFRTDLSDIARETLINVLHS 583

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 559 NSNYIGFHAHHHPITCATAVPMQVTKVLSLSNDLICELTMQFW 601
           +S+   FHAH HPIT     P+     ++ SND I E T + +
Sbjct: 490 HSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCY 532

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 27/169 (15%)

Query: 345 GDLITAMDISYDGNYTILGTFNG---YIHVLITKSLELLFSFNVLDKDSELKKCHRTSRR 401
           G  +T    S DG    +G  +G    + VL TKS +L  S      D+E   C  T +R
Sbjct: 79  GSSVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGIS------DAE---CEETGKR 129

Query: 402 LKKQSSDKAKNGPKITGLEFI-----QKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQ 456
                  K +  P    L+ +     +K  R     S  V+ + LVSS DS + ++T   
Sbjct: 130 -------KIQYAPIFNELDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTPFD 182

Query: 457 EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYCWKLSDEVV 505
               +M+    +H  +   +    +   + +SG  DH +  W ++D  V
Sbjct: 183 GNRPIMRF---DHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDNRV 228

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 19/128 (14%)

Query: 253 PNPLVTFHEHTDDILDIDWSK--NSFILTGSMDKSCKLWHCARPTSLKTFV--------- 301
           P+ +  F  HT  +LD D+S   +  + +GS D    +W       L  +V         
Sbjct: 83  PDQVPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDL 142

Query: 302 --------HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDI 353
                   HS  V  + FHP  +    S+ LD   ++W I +++V F     D++T+M  
Sbjct: 143 KPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFTLKHPDMVTSMSF 202

Query: 354 SYDGNYTI 361
           SYDG + +
Sbjct: 203 SYDGKHLV 210

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 276 FILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILE 335
            + + S+D + K+W  ++     T  H D VT++ F   D +  ++   D+K R+W +  
Sbjct: 167 ILASSSLDYTVKIWDISQEEVKFTLKHPDMVTSMSFS-YDGKHLVTVSRDKKLRVWDVRA 225

Query: 336 KQVIFE 341
           ++++ E
Sbjct: 226 EKIVSE 231

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 62  ELVGNEDFKRHLKTGEHMKVYRKKKGFKQFRRL---ILAQELRPFGNEFQDSSSSNEKGT 118
           E V  E   + LK    +  + +K G   F  L   ILA     +  +  D S    K T
Sbjct: 131 EYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFT 190

Query: 119 ATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
               +K+   V  + FS+DGK + T  +D+ LR+W V
Sbjct: 191 ----LKHPDMVTSMSFSYDGKHLVTVSRDKKLRVWDV 223

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 98/247 (39%), Gaps = 50/247 (20%)

Query: 131 CIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQL--NGQLA 188
           C+RFS D + +A   +D  +++W +  +P     L     S  K  +N ++ +  +G + 
Sbjct: 492 CLRFSDDSRLVAAGFQDSYIKLWSLDGTP-----LESQLPSKAKDASNTVTLIGHSGPVY 546

Query: 189 QYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSYC 248
                 D+  L S S +  V                                + L    C
Sbjct: 547 SVSFSPDNRYLVSASEDKTV------------------------------RLWSLDTYTC 576

Query: 249 GVFHPNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFV 306
                  LV++  H   + D+ +S    +  TGS D++ +LW C     L+ F  H + V
Sbjct: 577 -------LVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDV 629

Query: 307 TAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDL--ITAMDISYDGNYTILGT 364
             V FHP +  + L+   D+ CR+W I     +  +  G    + ++ +S DG +   G+
Sbjct: 630 DCVTFHP-NGTYVLTGSSDKTCRMWDIQTGDSVRLF-LGHTASVVSVAVSPDGRWLTTGS 687

Query: 365 FNGYIHV 371
            +G I V
Sbjct: 688 EDGVIIV 694

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 276 FILTGSMDKSCKLWHCARPTSL-KTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
           +ILTGS D + KLW+     SL +TF  H  FV  V F+P+D   F S CLD K ++WS+
Sbjct: 111 YILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL 170

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 438 DWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIY 496
           +W +V S+D+++R++  N  E V+    H +    I  H +     K Y+++GS+D  + 
Sbjct: 68  NWIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPS-----KPYILTGSDDLTVK 122

Query: 497 CW 498
            W
Sbjct: 123 LW 124

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 93/214 (43%), Gaps = 28/214 (13%)

Query: 123 MKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERL-ELNQHSISFLKSTANAIS 181
           + +   V C+RFS+DG+++AT G ++  +++KV  S  E L  L+  S++ + + A+   
Sbjct: 273 LDHSSVVCCVRFSNDGEYLAT-GCNKTTQVYKV--STGELLARLSDDSVAGVNNEASTGP 329

Query: 182 QLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPY 241
             NG  A  GG+  +    + SS+ ++ S+  S                     G     
Sbjct: 330 ANNGT-ADNGGENSATIQPASSSDLYIRSVCFS-------------------PDGKYLAT 369

Query: 242 GLGDSYCGVFHPNP---LVTFHEHTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSL 297
           G  D    ++       L+T   H  DI  +D+      +++GS D++ ++W        
Sbjct: 370 GAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCS 429

Query: 298 KTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
            T    D VT V   P D ++  +  LD+  R+W
Sbjct: 430 LTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVW 463

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 92/223 (41%), Gaps = 46/223 (20%)

Query: 134 FSHDGKFMATAGKDEILRIW----KVISSPAERLELNQHSISFLKSTANAISQLNGQLAQ 189
           FS DGK++AT  +D+++RIW    K I    +  E + +S+ +  +    +S        
Sbjct: 360 FSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVS-------- 411

Query: 190 YGGDTDSASLNSGSSNTHVDSLGSSNAN-----RDGFSTKAV-PQEQQGQTQGHR-HPYG 242
                      SG     +  L +   +      DG +T AV P + +    G       
Sbjct: 412 ----------GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVR 461

Query: 243 LGDSYCGVF-----HPNPLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHC----- 291
           + DS  G         N L T H+  D +  + ++++   +++GS+D+S KLW       
Sbjct: 462 VWDSETGFLVERLDSENELSTGHK--DSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNG 519

Query: 292 --ARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
             +  T   T+  H DFV +V    +DD + LS   D+    W
Sbjct: 520 QKSHATCEVTYTGHKDFVLSVATT-QDDEYILSGSKDRGVLFW 561

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 89/230 (38%), Gaps = 43/230 (18%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQ 186
           G + C+ FS D +  A   +D  +++W +  SP +         S L S A   S  +  
Sbjct: 499 GNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQ---------SILPSKAKDQSN-SAT 548

Query: 187 LAQYGGDTDSASLNSGSSNTHVDSLGSSNANR----DGFSTKAVPQEQQGQTQGHRHPY- 241
           L  + G   S + +    N ++ S       R    D F+            +GH HP  
Sbjct: 549 LVGHSGPVYSVAFSP--DNRYLLSASEDKTVRLWSLDTFTCLVC-------YKGHNHPVW 599

Query: 242 -----GLGDSYCGVFHPN-----------PLVTFHEHTDDILDIDWSKNS-FILTGSMDK 284
                 LG  +    H             PL  F  H +D+    +  N  ++ TGS DK
Sbjct: 600 YVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDK 659

Query: 285 SCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
           +C++W      S++ F+ H+  VTA+   P D R+  +   D    +W I
Sbjct: 660 TCRMWDIQTGDSVRLFLGHTSPVTALEVSP-DGRWLTTGSEDGTIIVWDI 708

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 16/93 (17%)

Query: 256 LVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHC-------ARPTSLK------TFV 301
           + TFH    ++  +++S ++     G  D + K+W+          P+  K      T V
Sbjct: 491 MYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLV 550

Query: 302 -HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
            HS  V +V F P D+R+ LSA  D+  RLWS+
Sbjct: 551 GHSGPVYSVAFSP-DNRYLLSASEDKTVRLWSL 582

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 100/249 (40%), Gaps = 39/249 (15%)

Query: 175 STANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQ--- 231
           S++N +  L G L  + G   S S ++   N  V    S + ++   S +    EQQ   
Sbjct: 2   SSSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLV----SGSRDKTLISWRLTENEQQFGV 57

Query: 232 --GQTQGHRHP-----------YGLGDSYCGVFHPNPLVT------FHEHTDDILDIDWS 272
                +GH H            Y +  S+        L T      F  HT D+L +   
Sbjct: 58  PVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAID 117

Query: 273 KNSF-ILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHP--------EDDRF-FLSA 322
            NS  I++ S DK+ ++W+     +     H+D+VT VR  P        +D R  F+SA
Sbjct: 118 ANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSA 177

Query: 323 CLDQKCRLWSILEKQVIFEYDC---GDLITAMDISYDGNYTILGTFNGYIHVLITKSLEL 379
            +D+  R WS+ E     E D     + I  +  S DG+       +G I+V   K    
Sbjct: 178 GMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSA 237

Query: 380 LFSFNVLDK 388
             +F+  D+
Sbjct: 238 FMNFDAKDE 246

>Scas_719.52
          Length = 628

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 53/126 (42%), Gaps = 19/126 (15%)

Query: 253 PNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKS-CKLWHCARPTSLKTFV--------- 301
           P+ +  F  HT  +LD D+   N  I+  S D S   +W      S + ++         
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNI 130

Query: 302 --------HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDI 353
                   HS  V  V FHP  +    S+ LD   +LW+I   + +      D++T+M  
Sbjct: 131 KPVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSF 190

Query: 354 SYDGNY 359
           SY GN+
Sbjct: 191 SYGGNH 196

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 257 VTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDD 316
           V FH   +++L           + S+D + KLW+     ++ T  H D VT++ F     
Sbjct: 146 VLFHPVAENVL----------ASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSFS-YGG 194

Query: 317 RFFLSACLDQKCRLWSILEKQVIFE 341
               + C D+K R+W I E +++ E
Sbjct: 195 NHLATVCRDKKLRVWDIREGKIVSE 219

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 115 EKGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
           E G A   +K+   V  + FS+ G  +AT  +D+ LR+W +
Sbjct: 171 ETGEAVITLKHPDMVTSMSFSYGGNHLATVCRDKKLRVWDI 211

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 11/124 (8%)

Query: 241 YGLGDSYCGVFHP------NPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARP 294
           YG  D+  G   P      +P+     H  ++  +  SKN+F+++ S DK+ K+WH    
Sbjct: 71  YGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLS-SKNNFVISSSWDKTAKVWHNG-- 127

Query: 295 TSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDI 353
           +++   V HS  V   +F PE D FFL+A  D   +LW   +    F     D+I  +DI
Sbjct: 128 SAIYDLVGHSASVWDAKFLPEKD-FFLTASADCTIKLWHGNKLIKTFSGIHKDVIRHLDI 186

Query: 354 SYDG 357
           S DG
Sbjct: 187 SPDG 190

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 276 FILTGSMDKSCKLWHCARPTSLKTF--VHSDFVTAVRFHPEDDRF 318
           F LT S D + KLWH  +   +KTF  +H D +  +   P+ + F
Sbjct: 151 FFLTASADCTIKLWHGNK--LIKTFSGIHKDVIRHLDISPDGETF 193

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 259 FHEHTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSLK-TFV-HSDFVTAVRFHPED 315
           F  H D I  I       F+LTGS D + KLW+  +    + TF  H  FV +V F+P+D
Sbjct: 93  FEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKD 152

Query: 316 DRFFLSACLDQKCRLWSI 333
              F S CLD   ++WSI
Sbjct: 153 PNQFASGCLDHTIKVWSI 170

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 438 DWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIY 496
           +W +V S+D ++R+Y  N  E V+  + H +    I  H T     K +V++GS+D  I 
Sbjct: 68  NWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPT-----KPFVLTGSDDLTIK 122

Query: 497 CW 498
            W
Sbjct: 123 LW 124

>Kwal_23.6429
          Length = 750

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 102/253 (40%), Gaps = 46/253 (18%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQL--NGQ 186
           V C+RFSHDG+F+AT G ++  +++KV                   ST   I++L  +  
Sbjct: 403 VCCVRFSHDGEFLAT-GCNKTTQVYKV-------------------STGELIARLSEDAS 442

Query: 187 LAQYGGDTDSASLNSGSSNTHVDSLGSSNANRD-GFSTKAVPQEQQGQTQGHRHPYGLGD 245
            A  G D  + S N+ +S     S  S    R   FS             G     G  D
Sbjct: 443 SAPSGADASATSENAKASPAVATSASSDLYIRSVCFSP-----------DGKFLATGAED 491

Query: 246 SYCGVFHPNP---LVTFHEHTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSLKTFV 301
               ++       ++T   H  DI  +D+      +++GS D++ ++W         T  
Sbjct: 492 KLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLS 551

Query: 302 HSDFVTAVRFHPEDDRFFLSACLDQKCRLW----SILEKQVIFEYDCG----DLITAMDI 353
             D VT V   P D +   +  LD+  R+W      L +++  E + G    D + ++  
Sbjct: 552 IEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVF 611

Query: 354 SYDGNYTILGTFN 366
           + DG+  + G+ +
Sbjct: 612 TRDGHGVVSGSLD 624

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 104/253 (41%), Gaps = 47/253 (18%)

Query: 109 DSSSSNEKGTATEPMKNGGA----VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLE 164
           D+S+++E   A+  +    +    +  + FS DGKF+AT  +D+++RIW + +       
Sbjct: 449 DASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLAT------- 501

Query: 165 LNQHSISFLKSTANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNAN-----RD 219
             +  +  L+     I  L+     Y    D     SG     +  L +   +      D
Sbjct: 502 --RRIVMTLQGHEQDIYSLD-----YFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIED 554

Query: 220 GFSTKAV-PQEQQGQTQGHR-HPYGLGDSYCGVF-----HPNPLVTFHEHTDDILDIDWS 272
           G +T AV P + +    G       + DS  G         N L T H+  D +  + ++
Sbjct: 555 GVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHK--DSVYSVVFT 612

Query: 273 KNSF-ILTGSMDKSCKLWHCAR------------PTSLKTFV-HSDFVTAVRFHPEDDRF 318
           ++   +++GS+D+S KLW+                 S  T+  H DFV +V    ++D F
Sbjct: 613 RDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATT-QNDEF 671

Query: 319 FLSACLDQKCRLW 331
            LS   D+    W
Sbjct: 672 ILSGSKDRGVLFW 684

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 3/81 (3%)

Query: 256 LVTFHEHTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSL-KTFV-HSDFVTAVRFH 312
           +V F  H D I  +      S++L+ S D + KLW+  +  +L +TF  H  FV +V F+
Sbjct: 90  VVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFN 149

Query: 313 PEDDRFFLSACLDQKCRLWSI 333
           P+D   F +ACLD   ++WS+
Sbjct: 150 PKDPNTFATACLDHTVKIWSL 170

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 6/61 (9%)

Query: 439 WFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYC 497
           W +V S+D +IR++  N  E V   + H +    +  H T     ++YV+S S+D  +  
Sbjct: 69  WIIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPT-----RSYVLSASDDLTVKL 123

Query: 498 W 498
           W
Sbjct: 124 W 124

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (3%)

Query: 256 LVTFHEHTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSL-KTFV-HSDFVTAVRFH 312
           +V F  H D I  I       ++L+GS D + KLW+     +L +TF  H  FV  V F+
Sbjct: 90  VVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFN 149

Query: 313 PEDDRFFLSACLDQKCRLWSI 333
           P+D   F S CLD+  ++WS+
Sbjct: 150 PKDPSTFASGCLDRTVKVWSL 170

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 6/62 (9%)

Query: 438 DWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIY 496
           +W +V S+D RIR++  N  E V   + H +    I  H T     K YV+SGS+D  + 
Sbjct: 68  NWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPT-----KPYVLSGSDDLTVK 122

Query: 497 CW 498
            W
Sbjct: 123 LW 124

>Kwal_23.5351
          Length = 474

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 57/133 (42%), Gaps = 12/133 (9%)

Query: 250 VFHPNPLVTFHE----HTDDILDIDWSKNSFIL-TGSMDKSCKLWHC-ARPTSLKTFV-- 301
           + HP  L         H D I  + WS +S +L TG  D   K+W+  A+  S  + V  
Sbjct: 208 ILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVL 267

Query: 302 --HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI-LEKQVIFEYDCGDLITAMDISYDGN 358
             H   V+ V+FHP D RF  SA  D   RLW +  E ++  +      +  +D   DG+
Sbjct: 268 RGHEARVSKVKFHPSD-RFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGS 326

Query: 359 YTILGTFNGYIHV 371
                  +   HV
Sbjct: 327 LLCSAGLDSVGHV 339

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 65/166 (39%), Gaps = 19/166 (11%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLA 188
           V+C+ F  DG  + +AG D +  +W + +           S+  L+  A  I  ++    
Sbjct: 316 VYCLDFQCDGSLLCSAGLDSVGHVWDMRTG---------RSLMVLEGHAKPIYGVS---- 362

Query: 189 QYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQ-GHRHPYGLGDSY 247
            +  +    +  SG     V  +  +N      +  ++  E   + + G+       D  
Sbjct: 363 -WSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRT 421

Query: 248 CGVFHPN---PLVTFHEHTDDILDIDWSKNSFILTGS-MDKSCKLW 289
            GVF       L +   HTD IL +D S+    L  S  D+S K+W
Sbjct: 422 IGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIW 467

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 100/241 (41%), Gaps = 37/241 (15%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLA 188
           ++ +  S DG+ +AT G D  +RIW V    A+ L   +  +S+         QL   LA
Sbjct: 20  IYTVDVSSDGQRVATGGLDGKIRIWSV----ADILVFAKPKVSWPARE----EQLRKPLA 71

Query: 189 QYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSYC 248
                T S +    S +    + GS +          + ++++G  Q       L D   
Sbjct: 72  NMSRHTGSVTALKFSPDNKYLASGSDD------KILLIWEKEEGAVQ------PLFDMEN 119

Query: 249 GVFHPNPLVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTF-VHSDFV 306
            + H N       H +DI DI W+ +S IL T  +D+S  +W+ +    +K F VH   V
Sbjct: 120 DLEHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHV 179

Query: 307 TAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYDGNYTILGTFN 366
             V F P  +++F +A  D+  +         +F Y  G      D+S+   + I   F 
Sbjct: 180 KGVVFDPA-NKYFATASDDRTVK---------VFRYHKG-----TDLSFTIEHIITEPFQ 224

Query: 367 G 367
           G
Sbjct: 225 G 225

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWK 154
           ++ G+V  ++FS D K++A+   D+IL IW+
Sbjct: 75  RHTGSVTALKFSPDNKYLASGSDDKILLIWE 105

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 256 LVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPED 315
           + T+  HTD ++ +D S    I++GS DK+ K+WH    T      H+++V  V+ HP+ 
Sbjct: 407 ISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS 465

Query: 316 DRFFLSACLDQ-KCRLWSI 333
             F   +C D    R+W I
Sbjct: 466 --FSCYSCSDDTTIRMWDI 482

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDR 317
           F  H D +L + ++    + TGS D +  +W       ++    HSD V  + F   DD+
Sbjct: 330 FKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DDQ 385

Query: 318 FFLSACLDQKCRLWSILEKQVIFEY 342
             ++  LD+  R+W+ +  + I  Y
Sbjct: 386 KLITGSLDKTIRVWNYITGECISTY 410

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 91/212 (42%), Gaps = 34/212 (16%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISF-----LKSTANAISQL 183
           ++ +  SHDGK +AT G D  +RIW  I S    +EL   +        L+    ++S+ 
Sbjct: 20  IYTVDVSHDGKRLATGGLDGKIRIWS-IDSILRCMELESLTPEIPLPQDLQMPLCSMSRH 78

Query: 184 NGQLAQYGGDTDSASLNSGSSN--THVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPY 241
            G +       D   L SGS +    + +L    +++  F ++    E++  T   R   
Sbjct: 79  TGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSE---HEREHWTVRKR--- 132

Query: 242 GLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTF 300
                               H +DI DI W+ +S IL T  +D+S  +W+ +    LK F
Sbjct: 133 -----------------LVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRF 175

Query: 301 -VHSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
            VH   V  V F P  +++F +   D+  +++
Sbjct: 176 DVHQSLVKGVVFDPA-NKYFATTSDDRTMKIF 206

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 23/32 (71%)

Query: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
           ++ G++ C++FS DGK++A+   D IL IW +
Sbjct: 77  RHTGSITCVKFSPDGKYLASGSDDRILLIWAL 108

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/253 (20%), Positives = 97/253 (38%), Gaps = 43/253 (16%)

Query: 254 NPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFH 312
           NP+ +F  H  ++  + + + N +++T S D + K+W    P+  + + H+  V  V  H
Sbjct: 66  NPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIH 125

Query: 313 PEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGD--LITAMDISYDGNYTILGTFNGYIH 370
           P      +S   D   R+W + E Q   +    D   + ++ ++ DG+  +     G  +
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCY 184

Query: 371 VLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDARNYK 430
           V                   E+   H  +  LK  +  KA   P       +  D ++  
Sbjct: 185 VW------------------EMPN-HTDASNLKPATKFKAH--PSYITRVLLSSDVKHMA 223

Query: 431 ISSKDVSDWFLVSSNDSRIRIYTLNQEF--VSVMKGHSNEHSQITAHSTVTRSGKAYVVS 488
             S D +            RI+++   F   S + GH     Q         +  AY+V+
Sbjct: 224 TCSADHT-----------ARIWSVEDNFNLESTLDGH-----QRWVWDCAFSADSAYLVT 267

Query: 489 GSEDHWIYCWKLS 501
            S DH++  W LS
Sbjct: 268 ASSDHYVRLWDLS 280

>Scas_721.32
          Length = 822

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 93/230 (40%), Gaps = 36/230 (15%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERL-ELNQHSISFLKSTANAISQL-- 183
           G +  ++FS D + +A   +D  +++W +  S  +++ E +  SI+      N  + L  
Sbjct: 488 GGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIG 547

Query: 184 -NGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPY- 241
            +G +       D+  L SGS +  V  L S++      S K           GH HP  
Sbjct: 548 HSGAVYSTSFSPDNRYLLSGSEDKTV-RLWSTDTYTSLVSYK-----------GHNHPVW 595

Query: 242 -----GLGDSYCGVFHPN-----------PLVTFHEHTDDILDIDWSKNS-FILTGSMDK 284
                 LG  +    H             PL  F  H  D+  + +  N  ++ TGS DK
Sbjct: 596 DVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDK 655

Query: 285 SCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
           +C++W  +   S++ F+ H+  V      P D R+  +   D    LW I
Sbjct: 656 TCRMWDISTGDSVRLFLGHTAPVLCTAVSP-DGRWLATGSEDGIINLWDI 704

>Kwal_0.212
          Length = 303

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 4/122 (3%)

Query: 253 PNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF 311
           PNP+ +F  H  ++  I + + N ++++ S D + K+W    P+  + + H   V  V  
Sbjct: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVI 124

Query: 312 HPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGD--LITAMDISYDGNYTILGTFNGYI 369
           HP      +S   D   R+W + E Q + +    D   + ++ ++ DG+  + G   G  
Sbjct: 125 HPNQGE-LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNC 183

Query: 370 HV 371
           +V
Sbjct: 184 YV 185

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 86/229 (37%), Gaps = 29/229 (12%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQ 186
           G V  I F  + K+M ++ +D  +++W V +   +R   +Q +++ +    N      G+
Sbjct: 76  GNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPN-----QGE 130

Query: 187 LAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVP-QEQQGQTQGHRHPYGLGD 245
           L     D           N  +  LG +            P Q     + G     G   
Sbjct: 131 LISCDQD----------GNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180

Query: 246 SYCGVFH---------PNPLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPT 295
             C V+          P P+  F  H   I  +  S +   + T S D + ++W      
Sbjct: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240

Query: 296 SLKTFV--HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEY 342
            L+T +  H  +V    F   D  + ++AC D   RLW +  ++++ +Y
Sbjct: 241 QLETTLDNHQRWVWDCAF-SADSAYLVTACSDHYVRLWDLSTREIVRQY 288

>Scas_630.6
          Length = 621

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 94/221 (42%), Gaps = 34/221 (15%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLA 188
           +  I FS DG+F+AT  +D+++RIW +     ER       +  LK     I  L+    
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNI----KER-----KIVMVLKGHEQDIYSLD---- 390

Query: 189 QYGGDTDSASLNSGSSNTHVDSLGSSNAN-----RDGFSTKAV-PQEQQGQTQGHR-HPY 241
            Y  D       SG  +  +  L +   +      DG +T AV P E +    G      
Sbjct: 391 -YFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSV 449

Query: 242 GLGDSYCGVFHPNPLVTFHE----HTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTS 296
            + DS  G F    L + +E    H D +  + ++K+   +++GS+D++ KLW+     S
Sbjct: 450 RIWDSSTG-FLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQS 508

Query: 297 ------LKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
                 +    H DFV +V     DD++  S   D+   +W
Sbjct: 509 GTGKCEVTYIGHKDFVLSVATS-NDDKYIFSGSKDRGVIIW 548

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 64/152 (42%), Gaps = 20/152 (13%)

Query: 256 LVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPE 314
           ++    H  DI  +D+  +   +++GS D+S ++W         T    D VT V   P 
Sbjct: 376 VMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPN 435

Query: 315 DDRFFLSACLDQKCRLWS----ILEKQVIFEYDCG----DLITAMDISYDGNYTILGTFN 366
           + +   +  LD+  R+W      L +++  + + G    D + ++  + DG + + G+ +
Sbjct: 436 EGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLD 495

Query: 367 GYIHVLITKSLELLFSFNVLDKDSELKKCHRT 398
             + +           +N+ D  S   KC  T
Sbjct: 496 RTVKL-----------WNLGDTQSGTGKCEVT 516

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 54/126 (42%), Gaps = 6/126 (4%)

Query: 276 FILTGSMDKSCKLWHC-ARPTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSIL 334
           F+ TG+ DK  ++W+   R   +    H   + ++ + P D +  +S   D+  R+W + 
Sbjct: 355 FLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFP-DGQKLVSGSGDRSIRIWDLK 413

Query: 335 EKQVIFEYDCGDLITAMDISY-DGNYTILGTFNGYIHVLITKSLELLFSFNVLDKDSELK 393
             Q        D +T + +S  +G     G+ +  + +  + +    F    LD D+E  
Sbjct: 414 TGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSST---GFLVERLDSDNESG 470

Query: 394 KCHRTS 399
             H+ S
Sbjct: 471 NGHQDS 476

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 54/126 (42%), Gaps = 19/126 (15%)

Query: 253 PNPLVTFHEHTDDILDIDWSK--NSFILTGSMDKSCKLWHC-------------ARPTSL 297
           P+ +  F  HT  +LD D+    +  I +GS D    +W                 P  +
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDI 130

Query: 298 KT--FV--HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDI 353
           K   F+  H+  V  V +HP  +    S+  D   +LW++   + +      D++T+M  
Sbjct: 131 KPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSF 190

Query: 354 SYDGNY 359
           SYDGNY
Sbjct: 191 SYDGNY 196

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 22/126 (17%)

Query: 237 HRHPYGLGDSYCGVFHPNPLVTFHEHTDD---ILDIDWSK------------------NS 275
           HR   G  DS  G++       FH+H D+    +DI   K                   +
Sbjct: 95  HRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTGHARKVGHVLYHPVAEN 154

Query: 276 FILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILE 335
            + + S D + KLW+      + T  H D VT++ F   D  +  +   D+K R+W+I E
Sbjct: 155 VLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFS-YDGNYLATVARDKKLRVWNIRE 213

Query: 336 KQVIFE 341
           ++++ E
Sbjct: 214 EKIVSE 219

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 123 MKNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
           +K+   V  + FS+DG ++AT  +D+ LR+W +
Sbjct: 179 LKHPDMVTSMSFSYDGNYLATVARDKKLRVWNI 211

>Scas_704.40
          Length = 608

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 89/219 (40%), Gaps = 34/219 (15%)

Query: 133 RFSHDGKFMAT---AGKD---EILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQ 186
           RF  +    AT     KD   +++R WKVI     ++E N               + N Q
Sbjct: 199 RFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWR-------------KGNCQ 245

Query: 187 LAQYGGDTDSA-SLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPY---- 241
           + ++ G  D   +L          S  S+ A  D  S K + +   G T G +  Y    
Sbjct: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLI-RRLSGHTDGVKTLYFDEA 304

Query: 242 ----GLGDSYCGVFHPNP---LVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARP 294
               G  D    V++      + T+  HTD ++ +D  K   I++GS DK+ K+WH    
Sbjct: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESR 363

Query: 295 TSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
           T      H+++V  V+ HP+    F S   D   R+W I
Sbjct: 364 TCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRMWDI 401

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 256 LVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPED 315
           + T+  H+D +L +D S    I++GS DK+ K+WH    T      H+++V  V+ HP+ 
Sbjct: 375 ISTYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKS 433

Query: 316 DRFFLSACLDQKCRLWSI 333
              F S   D   R+W I
Sbjct: 434 FSCF-SCSDDTTIRMWDI 450

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDR 317
           F  H D +L + ++    + TGS D +  +W       ++    HSD V  + F   DDR
Sbjct: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353

Query: 318 FFLSACLDQKCRLWSILEKQVIFEY 342
             ++  LD+  R+W+ +  + I  Y
Sbjct: 354 KLITGSLDKTIRVWNYITGECISTY 378

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/252 (20%), Positives = 96/252 (38%), Gaps = 39/252 (15%)

Query: 253 PNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF 311
           PNP+ +F  H  ++  I + + N ++++ S D + K+W    P+  + + H+  V  V  
Sbjct: 65  PNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAI 124

Query: 312 HPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGD--LITAMDISYDGNYTILGTFNGYI 369
           HP      +S   D   R+W + E Q   +    D   + ++ ++ DG+  + G   G  
Sbjct: 125 HPNQGE-LISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNC 183

Query: 370 HVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDARNY 429
           +V                     K  H T     +  + K K+  K      +  D ++ 
Sbjct: 184 YV--------------------WKMPHHTDASTLEPVT-KFKSHTKYITRVLLSADVKHL 222

Query: 430 KISSKDVSDWFLVSSNDSRIRIYTLNQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSG 489
              S D         + +R+     N E  + + GH     Q         +  AY+V+ 
Sbjct: 223 ATCSAD---------HTARVWNIEDNFELETTLDGH-----QRWVWDCAFSADSAYLVTA 268

Query: 490 SEDHWIYCWKLS 501
             DH++  W LS
Sbjct: 269 CSDHYVRLWDLS 280

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 95/225 (42%), Gaps = 21/225 (9%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAER-----LELNQHSISFLKSTANAIS 181
           G V  I F  + ++M ++ +D  +++W V S   +R       +N+ +I   +    +  
Sbjct: 76  GNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAIHPNQGELISCD 135

Query: 182 QLNGQLAQYG-GDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHP 240
           Q +G +  +  G+    +  +   NT + SL  ++   DG  +  V    +G     + P
Sbjct: 136 Q-DGNIRIWDLGENQCTNQLTPEDNTPLQSLSVAS---DG--SMLVAGNNKGNCYVWKMP 189

Query: 241 YGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKT 299
           +    S        P+  F  HT  I  +  S +   + T S D + ++W+      L+T
Sbjct: 190 HHTDASTL-----EPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELET 244

Query: 300 FV--HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEY 342
            +  H  +V    F   D  + ++AC D   RLW +   +++ +Y
Sbjct: 245 TLDGHQRWVWDCAF-SADSAYLVTACSDHYVRLWDLSTSEIVRQY 288

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 54/126 (42%), Gaps = 20/126 (15%)

Query: 253 PNPLVTFHEHTDDILDIDWSK--NSFILTGSMDKSCKLWHCAR----------------- 293
           P+ +  F  HT  +LD D+    ++ + + S D    +W   +                 
Sbjct: 71  PDQVPLFRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIE 130

Query: 294 PTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDI 353
           PT   T  HS  V  + +HP       S+ LD   R+W++   + I++    D++T+M  
Sbjct: 131 PTKFLTG-HSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETGEDIYKLKHPDMVTSMSF 189

Query: 354 SYDGNY 359
           SYDG +
Sbjct: 190 SYDGTH 195

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 257 VTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDD 316
           + +H    D+L           + S+D + ++W+      +    H D VT++ F   D 
Sbjct: 145 ILYHPTAKDVL----------ASSSLDYTVRIWNVETGEDIYKLKHPDMVTSMSFS-YDG 193

Query: 317 RFFLSACLDQKCRLWSILEKQVIFE 341
               +   D+K R+W++ E++V+ E
Sbjct: 194 THLATVARDKKLRVWNVREEKVVSE 218

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 115 EKGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
           E G     +K+   V  + FS+DG  +AT  +D+ LR+W V
Sbjct: 170 ETGEDIYKLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNV 210

>Kwal_27.12586
          Length = 509

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 88/214 (41%), Gaps = 28/214 (13%)

Query: 131 CIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQL--- 187
           C+ +S  G    T  +   +R+W   +      + ++ SI  +K  ++A   L   +   
Sbjct: 211 CLEWSPKGDSFLTGVESGEIRLWTHDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNV 270

Query: 188 -----AQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYG 242
                AQ G      S      N  VDSLG  +A+  G     +P  Q            
Sbjct: 271 AIVWNAQTGTALQQFSFRE---NGTVDSLGV-DASWIGPDKFVIPGPQ------------ 314

Query: 243 LGDSY-CGVFHPNPLVTFHEHTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSLKTF 300
            G  Y CG+    PL   + H+  I   D+ S+N+ +L+GS DK+ ++W     +S   F
Sbjct: 315 -GSIYICGMGESRPLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCF 373

Query: 301 VHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSIL 334
           + +       F  +DD+  ++  LD   RLWS L
Sbjct: 374 MGNTLGITSAFWIDDDK-VIATSLDGSVRLWSHL 406

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/254 (20%), Positives = 96/254 (37%), Gaps = 43/254 (16%)

Query: 253 PNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF 311
           PNP+ +F  H  ++  I + + N ++++ S D + K+W    P+  + + H   V  V  
Sbjct: 65  PNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVI 124

Query: 312 HPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGD--LITAMDISYDGNYTILGTFNGYI 369
           HP      +S   D   R+W + E Q   +    D   + ++ I+ DG+  + G   G  
Sbjct: 125 HPNQGE-LISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNC 183

Query: 370 HVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDARNY 429
           +V    +                   H  +  LK  +  K ++  K      +  D ++ 
Sbjct: 184 YVWQMPN-------------------HTDAANLKPVT--KFRSHTKYITRVLLSSDVKH- 221

Query: 430 KISSKDVSDWFLVSSNDSRIRIYTLNQEFV--SVMKGHSNEHSQITAHSTVTRSGKAYVV 487
                         S D   R++++   F   + + GH     Q         +  AY+V
Sbjct: 222 ----------LATCSADHTARVWSIEDNFKLETTLDGH-----QRWVWDCAFSADSAYLV 266

Query: 488 SGSEDHWIYCWKLS 501
           +   DH++  W LS
Sbjct: 267 TACSDHYVRLWDLS 280

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 86/229 (37%), Gaps = 29/229 (12%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQ 186
           G V  I F  D K+M ++ +D  +++W V +   +R   +   ++ +      I    G+
Sbjct: 76  GNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEV-----VIHPNQGE 130

Query: 187 LAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVP-QEQQGQTQGHRHPYGLGD 245
           L     D           N  +  LG +            P Q     + G     G   
Sbjct: 131 LISCDQD----------GNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNK 180

Query: 246 SYCGVFH-PN--------PLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPT 295
             C V+  PN        P+  F  HT  I  +  S +   + T S D + ++W      
Sbjct: 181 GNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNF 240

Query: 296 SLKTFV--HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEY 342
            L+T +  H  +V    F   D  + ++AC D   RLW +  ++++ +Y
Sbjct: 241 KLETTLDGHQRWVWDCAF-SADSAYLVTACSDHYVRLWDLSTREIVRQY 288

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 97/229 (42%), Gaps = 43/229 (18%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLA 188
           +  + FS DGKF+AT  +D+++RIW +     E+ ++    +  LK     I  L+    
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDI-----EQKKI----VMVLKGHEQDIYSLD---- 604

Query: 189 QYGGDTDSASLNSGSSNTHVDSLGSSNAN-----RDGFSTKAV-PQEQQGQTQGH-RHPY 241
            Y    D     SG     +  L +          DG +T AV P + +    G      
Sbjct: 605 -YFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAV 663

Query: 242 GLGDSYCGVF-----HPNPLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHC---- 291
            + DS  G         N L T H+  D +  + ++++ + +++GS+D+S KLW+     
Sbjct: 664 RVWDSDTGFLVERLDSENELGTGHK--DSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVN 721

Query: 292 -----ARPTSLKTFV----HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
                 +PTS    V    H DFV +V    EDD + LS   D+    W
Sbjct: 722 HNNADGKPTSGTCEVTYTGHKDFVLSVATT-EDDEYILSGSKDRGVLFW 769

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 54/120 (45%), Gaps = 9/120 (7%)

Query: 256 LVTFHEHTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPE 314
           ++    H  DI  +D+      +++GS D++ ++W         T    D VT V   P 
Sbjct: 590 VMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPG 649

Query: 315 DDRFFLSACLDQKCRLWS----ILEKQVIFEYDCG----DLITAMDISYDGNYTILGTFN 366
           D +F  +  LD+  R+W      L +++  E + G    D + ++  + DGN  + G+ +
Sbjct: 650 DGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLD 709

>Scas_571.4
          Length = 601

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 57/138 (41%), Gaps = 19/138 (13%)

Query: 253 PNPLVTFHEHTDDILDIDWSK-NSF-ILTGSMDKSCKLWHCARPTSLKTFV--------- 301
           P+ +  F  H   +LD D+   N F I + S D    +W+     S++T+          
Sbjct: 79  PDHVSLFRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDI 138

Query: 302 --------HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDI 353
                   H+  V  V FHP       S+ LD   ++W+I + +VI      D++TAM  
Sbjct: 139 RPSKILSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAF 198

Query: 354 SYDGNYTILGTFNGYIHV 371
             DG Y    T N  + +
Sbjct: 199 DPDGAYLATITRNKKLTI 216

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 258 TFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDR 317
           T+  H D +L +D S    I++GS DK+ K+WH    T      H+ +V  V+ HP+   
Sbjct: 334 TYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT 392

Query: 318 FFLSACLDQKCRLWSI 333
            F S   D   R+W I
Sbjct: 393 CF-SGSDDMTIRMWDI 407

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDR 317
           F  H D +L +  + N  +LTGS D +  +W  A    ++    H+D V A+RF   DD+
Sbjct: 255 FKGHMDGVLSLQLT-NKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---DDQ 310

Query: 318 FFLSACLDQKCRLWSILEKQVIFEY 342
             ++  LD+  R+W+ +    +  Y
Sbjct: 311 KLITGSLDKTIRVWNYVTGACVSTY 335

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 262 HTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV 301
           H + + DI  + N  I++GS D+SCK+W       + TFV
Sbjct: 498 HVEGVWDIA-ADNFRIVSGSHDRSCKVWDLQTGKCMHTFV 536

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 252 HPNPLVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAV 309
           H  PL  F  HT+D+  + +  N  ++ TGS DK+C++W  +   S++ F+ H+  V + 
Sbjct: 606 HIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLST 665

Query: 310 RFHPEDDRFFLSACLDQKCRLWSI 333
           +  P D R+  +   D    LW I
Sbjct: 666 QVSP-DGRWLATGSEDGVICLWDI 688

>Kwal_23.5769
          Length = 627

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 256 LVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPED 315
           +  +  H+D +L +D S    I++GS DK+ K+WH    T      H+++V  V+ HP+ 
Sbjct: 390 VAAYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKS 448

Query: 316 DRFFLSACLDQKCRLWSI 333
              F S   D   R+W I
Sbjct: 449 FTCF-SGSDDTTIRMWDI 465

>Scas_718.6*
          Length = 546

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/321 (22%), Positives = 133/321 (41%), Gaps = 54/321 (16%)

Query: 70  KRHLKTGEHMKVYRKKKGFKQFRRLILAQELR-PFGNEFQDSSSSNEKGTATEPMKNGGA 128
           +R L  G+   + +  +  K+ +++I + ELR PF       + S+  G  T  +     
Sbjct: 194 ERLLAYGQEDSMAKMIEYNKEDKKIISSLELRHPF-------ALSSITGRKTNQIT---- 242

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWK----------VISSPAERLELNQHSISFLKSTAN 178
              + +S DG+ + T+ ++  LR+W              SP   ++ N+ S  F+    +
Sbjct: 243 --ALSWSPDGELIITSVENGELRLWNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLD 300

Query: 179 AISQL----NGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQT 234
            I+ L    NG + Q+         N+ S    ++ +     ++D      V        
Sbjct: 301 NITILWNAINGIILQHFEPEQKLENNTESLGVDIEWV-----DKDKLVVPGV-------- 347

Query: 235 QGHRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDK--SCKLWHCA 292
            G    Y + D+        P+     H   I  I+++ NS +L  S D   S ++WH  
Sbjct: 348 NGSILVYSIDDN-------KPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQ 400

Query: 293 RPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVI-FEYDCGDLITA 350
           +      F  HS  + ++ +   +D   +SA +D   R+WS++E  ++      G+ I  
Sbjct: 401 KENCCNCFYGHSQSIISLSWI--NDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIIC 458

Query: 351 MDISYDGNYTILGTFNGYIHV 371
             IS+D N   +G+ NG I+V
Sbjct: 459 GKISHDKNKFAIGSMNGQINV 479

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/254 (20%), Positives = 101/254 (39%), Gaps = 43/254 (16%)

Query: 253 PNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF 311
           PNP+ +F  H  ++  + + + N +++T S D + K+W    P+  + + H+  V  V  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124

Query: 312 HPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGD--LITAMDISYDGNYTILGTFNGYI 369
           HP      +S   D   R+W + E Q   +    D   + ++ ++ DG+        G  
Sbjct: 125 HPNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNC 183

Query: 370 HVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDARNY 429
           +V                   E+   H  +  LK  +  +A +   IT +  +  D ++ 
Sbjct: 184 YVW------------------EMPN-HTDASHLKPVTKFRA-HSTYITRI-LLSSDVKH- 221

Query: 430 KISSKDVSDWFLVSSNDSRIRIYTLNQEFV--SVMKGHSNEHSQITAHSTVTRSGKAYVV 487
                         S D   R+++++ +F   + + GH     Q         +  AY+V
Sbjct: 222 ----------LATCSADHTARVWSIDDDFKLETTLDGH-----QRWVWDCAFSADSAYLV 266

Query: 488 SGSEDHWIYCWKLS 501
           + S DH++  W LS
Sbjct: 267 TASSDHYVRLWDLS 280

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 130/322 (40%), Gaps = 53/322 (16%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKV---ISSPAERLELNQHSISFLKSTANAISQLNG 185
           ++ +  S DGK +AT G D  +RIW V   +S+ A    +++ +   L S    +S+  G
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLAS----MSRHTG 75

Query: 186 QLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDG-FSTKAVPQEQQGQTQGHRHPYGLG 244
            +       D   L SGS +  +        N  G F ++    E++  T   R      
Sbjct: 76  SVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEG---EKEHWTVRKR------ 126

Query: 245 DSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTF-VH 302
                      LV    H +DI DI W+ +S IL T  +D+S  +W+      LK F VH
Sbjct: 127 -----------LVA---HDNDIQDICWAPDSSILVTVGLDRSVIVWNGLNFERLKRFDVH 172

Query: 303 SDFVTAVRFHPEDDRFFLSACLDQKCRLW--------SILEKQVIFEYDCGDLITA---- 350
              V  V F P  +++F +A  D+  R++        S   +QVI E      +T     
Sbjct: 173 QSLVKGVIFDPA-NKYFATASDDRTMRVFRYHKTGEVSFTIEQVIVEPFIASPLTTYFRR 231

Query: 351 MDISYDGNY-TILGTFNGYI-HVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSD 408
           +  S DG +  +    NG +  V I        S +++  D+  +      R  K     
Sbjct: 232 LSWSPDGQHIAVPNATNGPVSSVAIINRGTWDSSISLIGHDAPTEVARFNPRLFKSDVEK 291

Query: 409 KAKNGPKITGLEFIQKDARNYK 430
           KAKN       + + KD +N K
Sbjct: 292 KAKNAK-----DELSKDTKNNK 308

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
           ++ G+V C++FS DG ++A+   D IL IW +
Sbjct: 72  RHTGSVTCVKFSPDGNYLASGSDDRILLIWAM 103

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 67/166 (40%), Gaps = 35/166 (21%)

Query: 275 SFILTGSMDKSCKLWHCARPTSLKTFVHSDF----VTAVRFHPEDDRFFLSACLDQKCRL 330
           S I T   DKS  LW  +RP  +  FV  D     +T + ++P  +  F+++ LD     
Sbjct: 312 SIIATAGQDKSLALWITSRPRPI--FVAYDIAQKSITDMAWNPNGNILFVTS-LDSSI-- 366

Query: 331 WSILEKQVIFEYDCGDLITAMDISYDGNYTILGTFNGYIHVLITKSLELLFSFNVL---D 387
                  V+  +D  +L   M I  +GN   L  +      +   S +L  S N L   D
Sbjct: 367 -------VMLMFDANEL--GMPIPIEGNMEQLHRYG-----VDKDSFDLPESVNQLLLED 412

Query: 388 KDSELKKCHRTS---------RRLKKQSSDKAKNGPKITGLEFIQK 424
           K    KK H  S         RRL+     K  N  +I+ L+  +K
Sbjct: 413 KYGTKKKQHELSSSTQSTALERRLEPNQFQKKINSREISPLKSTEK 458

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 94/249 (37%), Gaps = 54/249 (21%)

Query: 131 CIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLAQY 190
           C+ FS D    A   +D  +++W +  +P     L+    S  +   N     N  L  +
Sbjct: 426 CLEFSDDATLAAAGFQDSYIKLWSLDGTP-----LDSKLPSKQREKIN-----NTTLIGH 475

Query: 191 GGDTDSASLNSGSSNTHVDSLGSSNANR----DGFSTKAVPQEQQGQTQGHRHPYGLGDS 246
            G   S S +    N ++ S       R    D +S+           +GH HP      
Sbjct: 476 SGTVYSTSFS--PDNKYLLSASEDKTVRLWSMDTYSSLV-------SYKGHNHP------ 520

Query: 247 YCGVFHPNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFV-HSD 304
                              + D+ +S    +  T S D++ +LW C     L+ F  H +
Sbjct: 521 -------------------VWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLN 561

Query: 305 FVTAVRFHPEDDRFFLSACLDQKCRLWSI--LEKQVIFEYDCGDLITAMDISYDGNYTIL 362
            V  V FHP +  +  +   D+ CR+W I   +   +F      +I+   +S DG +   
Sbjct: 562 DVDCVSFHP-NGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTA-VSPDGRWLST 619

Query: 363 GTFNGYIHV 371
           G+ +G I+V
Sbjct: 620 GSEDGIINV 628

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 83/229 (36%), Gaps = 64/229 (27%)

Query: 111 SSSNEKGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSI 170
           S   EK   T  + + G V+   FS D K++ +A +D+ +R+W           ++ +S 
Sbjct: 461 SKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLW----------SMDTYS- 509

Query: 171 SFLKSTANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQ 230
                           L  Y G       N    +     LG        F+T +  Q  
Sbjct: 510 ---------------SLVSYKGH------NHPVWDVSFSPLGHY------FATASHDQTA 542

Query: 231 QGQTQGHRHPYG-----LGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKS 285
           +  +  H +P       L D  C  FHPN                    +++ TGS DK+
Sbjct: 543 RLWSCDHIYPLRIFAGHLNDVDCVSFHPN-------------------GTYVFTGSTDKT 583

Query: 286 CKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
           C++W      S++ F+ H+  V +    P D R+  +   D    +W I
Sbjct: 584 CRMWDIGTGDSVRLFLGHTAPVISTAVSP-DGRWLSTGSEDGIINVWDI 631

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 128 AVWCIRFSHDGKFMATAGKDEILRIWKVISSPAE-RLELNQHSISFLKSTANAISQLNGQ 186
           AV+ + +S +G  + + G D  +R+W +  S AE   E  Q   S+     +A + +N  
Sbjct: 647 AVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTAEPNTEPEQPFTSYF---GDATTSVNND 703

Query: 187 LAQYG 191
           +  YG
Sbjct: 704 IKDYG 708

>Kwal_27.12053
          Length = 755

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 252 HPNPLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAV 309
           H  PL  F  H +D+  + +  N +++ TGS DK+C++W      S++ F+ H+  VT+ 
Sbjct: 555 HIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTST 614

Query: 310 RFHPEDDRFFLSACLDQKCRLWSI 333
              P D R+  +   D    +W I
Sbjct: 615 AVSP-DGRWLSTGSEDGVINVWDI 637

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 16/92 (17%)

Query: 256 LVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHC-------------ARPTSLKTFV 301
           + TFH    ++  +++S +      G  D   K+W                  T+ +T V
Sbjct: 420 MYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLV 479

Query: 302 -HSDFVTAVRFHPEDDRFFLSACLDQKCRLWS 332
            HS  V +  F P D+R+ LSA  D+  RLWS
Sbjct: 480 GHSGTVYSTSFSP-DNRYLLSASEDKTVRLWS 510

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 128 AVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQL 187
           AV+ + +S +G  + + G D  +R+W V  S AE    ++    F   + +  S +N  +
Sbjct: 653 AVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAE--PGSEPEQPFTGYSGDVTSSVNQDI 710

Query: 188 AQYG 191
            +YG
Sbjct: 711 KEYG 714

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 4/122 (3%)

Query: 253 PNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF 311
           PNP+ +F  H  ++  I + + N ++++ S D + K+W    P+  + + H   V  V  
Sbjct: 65  PNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVVI 124

Query: 312 HPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGD--LITAMDISYDGNYTILGTFNGYI 369
           HP      +S   D   ++W + E Q   +    D   + ++ I+ DG+  + G   G  
Sbjct: 125 HPNQGE-LISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNC 183

Query: 370 HV 371
           +V
Sbjct: 184 YV 185

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 88/229 (38%), Gaps = 29/229 (12%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQ 186
           G V  I F  D K+M ++ +D  +++W V S   +R   +   ++ +      I    G+
Sbjct: 76  GNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEV-----VIHPNQGE 130

Query: 187 LAQYGGDTDSASLNSGSSNTHVDSLGSSNA-NRDGFSTKAVPQEQQGQTQGHRHPYGLGD 245
           L     D           N  +  LG +   N+         Q     + G     G   
Sbjct: 131 LISCDQD----------GNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNK 180

Query: 246 SYCGVFH-PN--------PLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPT 295
             C V+  PN        P+  F  H+  I  +  S +   + T S D + ++W      
Sbjct: 181 GNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNF 240

Query: 296 SLKTFV--HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEY 342
            L+T +  HS +V    F   D  + ++AC D   RLW +  ++++ +Y
Sbjct: 241 QLETTLDAHSRWVWDCAF-SADSAYLVTACSDHYVRLWDLSTREIVRQY 288

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 258 TFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDR 317
           T+  H D +L +D S    I++ S DK+ K+WH    T      H+++V  V+ HP+   
Sbjct: 387 TYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFT 445

Query: 318 FFLSACLDQKCRLWSI 333
            + S+  D+  R+W I
Sbjct: 446 CY-SSSDDKTLRMWDI 460

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDR 317
           F  H D +L + ++ +  + TGS D +  +W       ++    H+D V  + F   DD+
Sbjct: 308 FKGHMDGVLSLKFN-HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF---DDQ 363

Query: 318 FFLSACLDQKCRLWSILEKQVIFEY 342
             ++A LD+  R+W+ +    I  Y
Sbjct: 364 KMITASLDKTIRVWNYITGSCISTY 388

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 10/98 (10%)

Query: 256 LVTFHEHTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPE 314
           ++T   H  DI  +D+    + +++GS D++ ++W     T   T    D VT V   P 
Sbjct: 441 VMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPG 500

Query: 315 DDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMD 352
           + +F  +  LD+  R+W         + D G L+  +D
Sbjct: 501 EGKFIAAGSLDRTVRVW---------DSDTGFLVERLD 529

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 93/228 (40%), Gaps = 46/228 (20%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIW----KVISSPAERLELNQHSISFLKSTANAISQLN 184
           +  + FS DGKF+AT  +D+++RIW    K I    +  E + +S+ +  S    +S   
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVS--- 465

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNAN-----RDGFSTKAV-PQEQQGQTQGHR 238
                           SG     +  L +   +      DG +T AV P E +    G  
Sbjct: 466 ---------------GSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSL 510

Query: 239 -HPYGLGDSYCGVF-----HPNPLVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHC 291
                + DS  G         N L T H   D +  + ++++   +++GS+D+S KLW+ 
Sbjct: 511 DRTVRVWDSDTGFLVERLDSENELGTGHR--DSVYSVVFTRDGKGVVSGSLDRSVKLWNL 568

Query: 292 ARPTSLKTFV--------HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
              +  K+          H DFV +V    ++D + LS   D+    W
Sbjct: 569 NGLSGQKSHAECEVTYTGHKDFVLSVAT-TQNDEYILSGSKDRGVLFW 615

>Scas_624.11
          Length = 1205

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 256 LVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHP 313
           L T + H D I  + + K   +I++ S D++ ++W+      +     H+ FV   +FHP
Sbjct: 88  LYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHP 147

Query: 314 EDDRFFLSACLDQKCRLWSI 333
            DD   +SA LD+  R+W I
Sbjct: 148 TDD-LVVSASLDETIRVWDI 166

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 262 HTDDILDIDWSKN--SFILTGSMDKSCKLWHCARPTSLKTF-VHSDFVTAVRFHPEDDRF 318
           H+  IL +DW K   + +L+   D +C LW+      L  F    ++    +F PE    
Sbjct: 250 HSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFPTRGNWCFKTKFAPEAPDL 309

Query: 319 FLSACLDQKCRLWSILEKQVIFEYDCGDLIT 349
           F SA LD K ++ ++  + +  + D  D+++
Sbjct: 310 FASASLDNKIQVQTL--QNLTNKLDLEDIVS 338

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 47/78 (60%), Gaps = 2/78 (2%)

Query: 256 LVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHP 313
           +++   H+  I  +DWS+N + L +GS D + K+W   +  +++T + H+  V+ V+F+ 
Sbjct: 340 IMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNK 399

Query: 314 EDDRFFLSACLDQKCRLW 331
           ++  + +S+  D+K  ++
Sbjct: 400 QNGGYLVSSGYDKKVNIF 417

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 48/126 (38%), Gaps = 19/126 (15%)

Query: 253 PNPLVTFHEHTDDILDIDWSK--NSFILTGSMDKSCKLWHCARPTSLKTFVHSD------ 304
           P+ +  F  HT  +LD D+       +++GS D    +W      S       D      
Sbjct: 71  PDQIPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHV 130

Query: 305 ----FVTA-------VRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDI 353
               F+T        V +HP       S+ LD   RLW++ +          D++T+M  
Sbjct: 131 APVKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLTHPDMVTSMSF 190

Query: 354 SYDGNY 359
           SY G Y
Sbjct: 191 SYGGTY 196

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 277 ILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEK 336
           + + S+D + +LW+  + T+     H D VT++ F      +  + C D+  R+W I + 
Sbjct: 156 LASSSLDHTVRLWNVEQGTNPIVLTHPDMVTSMSFS-YGGTYLATVCRDKMLRVWDIRKG 214

Query: 337 QVIFE 341
           +V+ E
Sbjct: 215 EVVSE 219

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 25/41 (60%)

Query: 115 EKGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
           E+GT    + +   V  + FS+ G ++AT  +D++LR+W +
Sbjct: 171 EQGTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDI 211

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 285 SCKLWHCARPTSL-KTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
           + KLW+  +  +L +TF  H  FV  V F+P+D   F SACLD   ++WS+
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL 52

>Scas_713.50
          Length = 983

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 93/245 (37%), Gaps = 63/245 (25%)

Query: 97  AQELRPFGNEFQDSSSSNEKGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVI 156
           A EL+ F     D +SS +     E   +  A+W +  + DGK + T   D+ ++ W   
Sbjct: 489 AGELQLF-----DLASSTQIANIEEA--HDAAIWSLDLTSDGKRLITGSADKSVKFW--- 538

Query: 157 SSPAERLELNQHSISFLKSTANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLG---- 212
                                      N QL Q         L  G+S+  V  LG    
Sbjct: 539 ---------------------------NFQLEQ--------ELVPGTSDKFVPKLGLHHD 563

Query: 213 -SSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSYCGVFHPNPL---VTFHEHTDDILD 268
            +   + D  S +  P+++            L D+   VF  + +   ++ + H   +L 
Sbjct: 564 TTLELSDDILSVRVSPEDK-------FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 616

Query: 269 IDWSKNS-FILTGSMDKSCKLWHCARPTSLKT-FVHSDFVTAVRFHPEDDRFFLSACLDQ 326
           ID S +S  I+T S DK+ K+W        K+ F H D +  V+F PE   FF S   D 
Sbjct: 617 IDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFF-SCSKDG 675

Query: 327 KCRLW 331
             + W
Sbjct: 676 IIKYW 680

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 256 LVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHP 313
           L T   H D +  + + +   +I++ S D++ ++W+      +     H+ FV   +FHP
Sbjct: 88  LYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHP 147

Query: 314 EDDRFFLSACLDQKCRLWSI 333
            DD   +SA LD+  R+W I
Sbjct: 148 TDD-LIVSASLDETIRIWDI 166

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 87/223 (39%), Gaps = 33/223 (14%)

Query: 131 CIRFSHDGKFMATAGKDEILRIWKVI-SSPAERLELNQHSISFLKSTANAISQLNGQLAQ 189
           C+ FS D +  A   +D  ++IW +  SS         ++      T   +   +G +  
Sbjct: 471 CLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYS 530

Query: 190 YGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPY------GL 243
                D+  L SGS +  V  L S + +    S K           GH HP        L
Sbjct: 531 TSFSPDNKYLLSGSEDKTV-RLWSMDTHTALVSYK-----------GHNHPVWDVSFSPL 578

Query: 244 GDSYCGVFHPN-----------PLVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHC 291
           G  +    H             PL  F  H +D+  + +  N  ++ TGS DK+C++W  
Sbjct: 579 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 638

Query: 292 ARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
           +   S++ F+ H+  V ++   P D R+  +   D    +W I
Sbjct: 639 STGDSVRLFLGHTAPVISIAVCP-DGRWLSTGSEDGIINVWDI 680

>Kwal_56.24478
          Length = 1296

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 4/94 (4%)

Query: 255 PLVTFHE-HTDDILDIDWSKN--SFILTGSMDKSCKLWHCARPTSLKTF-VHSDFVTAVR 310
           PL T  + HT  +L +DW K   + +L+   D SC LW+     +L  F    ++    +
Sbjct: 242 PLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSCVLWNPESGQNLTQFPTRGNWCFKTK 301

Query: 311 FHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDC 344
           F P+    F SA  D K  + ++       + D 
Sbjct: 302 FAPQAPDLFASASFDNKIEVQTLQNITCTLDVDA 335

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

Query: 258 TFHEHTDDILD--IDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRF--- 311
           TF  H  D++   ID  K S I++GS DKS K+W   +   L T + H+D+V+ VR    
Sbjct: 102 TFVGHKGDVMSVAID-KKASMIISGSRDKSIKVWSI-KGDCLATLIGHNDWVSQVRIANS 159

Query: 312 HPEDDRF-FLSACLDQKCR-LWSILEKQVIFEYDCGDLITAMDISYDGNYTILGTFNG 367
             +DD+   +SA  D+  + LW+   K  ++    GD + A+  S +  +    T +G
Sbjct: 160 SDDDDKVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSFSPNRYWLCAATASG 217

>Scas_695.15
          Length = 327

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 55/123 (44%), Gaps = 5/123 (4%)

Query: 253 PNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF 311
           PN + TF  H  ++  + + + N +++T S D + K+W    P+  + + H+  V  V  
Sbjct: 85  PNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 144

Query: 312 HPEDDRFFLSACLDQKCRLWSILEKQVIFEY---DCGDLITAMDISYDGNYTILGTFNGY 368
           HP      +S   D   ++W + E Q   +    D    + ++ ++ DG+  +     G 
Sbjct: 145 HPNQGE-LISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGD 203

Query: 369 IHV 371
            +V
Sbjct: 204 CYV 206

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 92/223 (41%), Gaps = 41/223 (18%)

Query: 134 FSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLAQYGGD 193
           FS DGKF+AT  +D ++RIW +          N+  +  L+     I  L+     Y   
Sbjct: 451 FSPDGKFLATGAEDRLIRIWDI---------ENRKIVMILQGHEQDIYSLD-----YFPS 496

Query: 194 TDSASLNSGSSNTHVDSLGSSNAN-----RDGFSTKAV-PQEQQGQTQGH-RHPYGLGDS 246
            D     SG     +  L +   +      DG +T AV P + +    G       + DS
Sbjct: 497 GDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 556

Query: 247 YCGVFHPNPLVTFHE----HTDDILDIDWSKN-SFILTGSMDKSCKLWHCARP------- 294
             G F    L + +E    H D +  + ++++   +++GS+D+S KLW+           
Sbjct: 557 ETG-FLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSK 615

Query: 295 -----TSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
                T   T++ H DFV +V    ++D + LS   D+    W
Sbjct: 616 TPNSGTCEVTYIGHKDFVLSVATT-QNDEYILSGSKDRGVLFW 657

>Kwal_47.17465
          Length = 800

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 51/108 (47%), Gaps = 17/108 (15%)

Query: 262 HTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTF-VHSDFVTAVRFHPEDDRFF 319
           H +DI DI W+ +S IL T  +D+S  +W+ +    +K F VH   V  V F P  +++F
Sbjct: 78  HDNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRFDVHQSLVKGVIFDPA-NKYF 136

Query: 320 LSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYDGNYTILGTFNG 367
            +A  D+  R         IF Y       A D+S+   + +   F G
Sbjct: 137 ATASDDRTVR---------IFRYH-----KAGDMSFSIEHVVSEPFKG 170

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWK 154
           ++ G+V  +RFS DG F+A+   D IL IW+
Sbjct: 20  RHTGSVTVVRFSPDGNFLASGSDDRILLIWE 50

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 126/328 (38%), Gaps = 44/328 (13%)

Query: 119 ATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVIS----------SPAERLELNQH 168
           A+E  K    V C+ +S  G+ + T  ++  LR+W              SP   +E N  
Sbjct: 200 ASENSKTTNEVTCLSWSPSGESLITGVENGELRMWSFRGILQNVFNFHRSPVVSIEWNAD 259

Query: 169 SISFLKSTANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQ 228
           S   L S  + I+ +   L             +G++  H D   ++     G   + +  
Sbjct: 260 STHVLTSDVDNITIVWNAL-------------TGTALQHFDLKDTTGNESLGIDVEWIET 306

Query: 229 EQ--QGQTQGHRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSC 286
           ++      QG    + +G+S      P   +  H  T  +L  + S N  +L+ S DK+ 
Sbjct: 307 DKFVIPGLQGSILVFSIGES-----KPIGKLVGHTKTLTVLCYN-SDNKLLLSASDDKTL 360

Query: 287 KLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVI-FEYDC 344
           + W      S   F  H+  +T   +  +DDR  +S  +D   R+WS+ +  ++      
Sbjct: 361 RTWRGGNANSSNCFYGHTQSITYADWL-DDDR-LISTSMDGSVRVWSVKQNALVGLSVVD 418

Query: 345 GDLITAMDISYDGNYTILGTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKK 404
           G  I    +S D      GT +G + V   K L       VLD D +     R       
Sbjct: 419 GVPIFCGTLSSDKQKFATGTLDGEVSVYNVKKL-----LEVLDADEKPIGPVRIPTIGDY 473

Query: 405 QSSDKAKNGPKITGLEFIQKDARNYKIS 432
           QS+   K G  ++ L +  KD  N  +S
Sbjct: 474 QST---KEGSYVSDLSW-DKDGTNIAVS 497

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 74/171 (43%), Gaps = 22/171 (12%)

Query: 276 FILTGSMDKSCKLWHCARPTSLKTFV------HSDFVTAVRFHPEDDRFFLSACLDQKCR 329
            + +  +D +C ++  +R   ++  +      H+ +++ + F   DD   L+A  D  C 
Sbjct: 183 LVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFL--DDNSILTASGDMTCA 240

Query: 330 LWSILEKQVIFEY--DCGDL--ITAMDISYDGNYTIL--GTFNGYIHVLITKSLELLFSF 383
           LW I + + I E+    GD+  ++A     +GN  +   G  +GY+++   +    + SF
Sbjct: 241 LWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDKRVPTSVQSF 300

Query: 384 NVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDAR--NYKIS 432
            V D D    K  R    +   S D   N      L  ++ D R  NY +S
Sbjct: 301 FVSDSDVSKVKFFRNGNTIATGSDDGCTN------LYDLRSDCRIANYSLS 345

>Scas_629.12
          Length = 671

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 9/125 (7%)

Query: 256 LVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPE 314
           ++    H  D+  +D+  N   +++GS D++ ++W         T      VT V   P 
Sbjct: 422 VMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPN 481

Query: 315 DDRFFLSACLDQKCRLWS----ILEKQVIFEYDCG----DLITAMDISYDGNYTILGTFN 366
           D +F  +  LD+  R+W      L +++  E + G    D + ++  + DGN  + G+ +
Sbjct: 482 DGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLD 541

Query: 367 GYIHV 371
             + +
Sbjct: 542 KTVKL 546

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 98/242 (40%), Gaps = 66/242 (27%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKV----ISSPAERLELNQHSISFLKSTANAIS--- 181
           +  + FS DG+F+AT  +D+++RIW +    I    +  E + +S+ +  +    +S   
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 182 --------QLNGQLA-----QYGGDTDSASLNSGS--SNTHVDSLGSSNANRDGFSTKAV 226
                      GQ +     +YG  T + S N G   +   +D       +  GF  + +
Sbjct: 450 DRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERL 509

Query: 227 PQEQQGQTQGHRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKN-SFILTGSMDKS 285
             E +  T GHR                         D +  + ++++ + +++GS+DK+
Sbjct: 510 DSENELGT-GHR-------------------------DSVYSVVFTRDGNEVVSGSLDKT 543

Query: 286 CKLWHC---------------ARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCR 329
            KLW+                A  T   T+V H DFV +V    +DD++ LS   D+   
Sbjct: 544 VKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTS-QDDKYILSGSKDRGIL 602

Query: 330 LW 331
            W
Sbjct: 603 FW 604

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 89/232 (38%), Gaps = 37/232 (15%)

Query: 276 FILTGSMDKSCKLWHC-ARPTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSIL 334
           F+ TG+ DK  ++W    R   +    H   V ++ + P  ++  +S   D+  R+W + 
Sbjct: 401 FLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL-VSGSGDRTVRIWDLR 459

Query: 335 EKQVIFEYDCGDLITAMDISY-DGNYTILGTFNGYIHVLITKSLELLFSFNVLDKDSELK 393
             Q          +T + +S  DG +   G+ +  + V  + +    F    LD ++EL 
Sbjct: 460 TGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG---FLVERLDSENELG 516

Query: 394 KCHRTSRRLKKQSSDKAKNGPKITGLEFIQKDARNYKISSKDVSDWFLVSSNDSRIRIYT 453
             HR S      S    ++G ++                 K V  W +  S +S      
Sbjct: 517 TGHRDSVY----SVVFTRDGNEVVSGSL-----------DKTVKLWNMRHSGNS------ 555

Query: 454 LNQEFVSVMKGHSNEHSQIT-------AHSTVTRSGKAYVVSGSEDHWIYCW 498
            N E  S  KG ++   ++T         S  T     Y++SGS+D  I  W
Sbjct: 556 -NNE--SNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFW 604

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 259 FHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHP---- 313
           F  H  D++ +D  K  S I++GS DK+ K+W            H+D+V+ VR  P    
Sbjct: 103 FVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKA 162

Query: 314 -EDDRFFLSACLDQKCRLWSILEKQV 338
            +D    +SA  D+  + W++ + Q+
Sbjct: 163 DDDSVTIISAGNDKMVKAWNLNQFQI 188

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 92/232 (39%), Gaps = 58/232 (25%)

Query: 134 FSHDGKFMATAGKDEILRIWKVISSPAERL----ELNQHSISFLKSTANAISQLNGQLAQ 189
           FS DGKF+AT  +D+++RIW +       +    E + +S+ + +S    +S        
Sbjct: 381 FSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVS-------- 432

Query: 190 YGGDTDSASLNSGSSNTHVDSLGSSNAN-----RDGFSTKAVPQEQQGQTQGHRHPYGLG 244
                      SG     +  L +   +      DG +T AV         G+    G  
Sbjct: 433 ----------GSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAV-----SPGNGNYVAAGSL 477

Query: 245 DSYCGVFHPNP--LV--------TFHEHTDDILDIDWSKNSF-ILTGSMDKSCKLWHC-- 291
           D    V+  N   LV        T   H D +  + ++++   I++GS+D+S KLW+   
Sbjct: 478 DRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRN 537

Query: 292 -------ARPTS-----LKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
                   +P +     +    H DFV +V    E+D++ LS   D+    W
Sbjct: 538 INGASTSPQPKTEGNCEMTYIGHKDFVLSVT-TTENDQYILSGSKDRGVIFW 588

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 54/134 (40%), Gaps = 22/134 (16%)

Query: 276 FILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPED----DRF-----FLSACLDQ 326
           F+ TG+ DK  ++W  A+            V  +R H +D    D F      +S   D+
Sbjct: 387 FLATGAEDKLIRIWDIAQ---------RKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDR 437

Query: 327 KCRLWSILEKQVIFEYDCGDLITAMDISY-DGNYTILGTFNGYIHVLITKSLELLFSFNV 385
             R+W +   Q        D +T + +S  +GNY   G+ +  + V  + S    F    
Sbjct: 438 TIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNS---GFLVER 494

Query: 386 LDKDSELKKCHRTS 399
           LD + E    H+ S
Sbjct: 495 LDSEGETGVGHKDS 508

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 76/205 (37%), Gaps = 42/205 (20%)

Query: 131 CIRFSHDGKFMATAGKDEILRIWK----------VISSPAERLELNQHSISFLKSTANAI 180
           C+ ++HDG  +AT  ++  LR+W              SP   +  N  +  F+ + A+ I
Sbjct: 227 CLSWAHDGDSIATGVENGELRLWNKEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNI 286

Query: 181 SQL----NGQLAQY-------------------------GGDTDSASLNSGSSNTHVDSL 211
           + L    +G + Q+                           DTD   +     N  V ++
Sbjct: 287 TILWDVNSGVVLQHFESKANQINGNNNNNSNQMFGVDTVWVDTDKFVIPGPGGNLLVYTM 346

Query: 212 GSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSYCGVFHP---NPLVTFHEHTDDILD 268
             S         +    + +  ++         D+   V+H    N +  F+ HT  I+ 
Sbjct: 347 SDSRPIGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVS 406

Query: 269 IDWSKNSFILTGSMDKSCKLWHCAR 293
           + W  N  +++ SMD S KLW C +
Sbjct: 407 LKWVNNDMLISASMDGSVKLWDCGK 431

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 11/97 (11%)

Query: 254 NPLVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLKTFV--HSDFVTAVR 310
            PL T   H++ +L + WS +   I TGSMD + +LW   +  SL   +  H+ ++T++ 
Sbjct: 175 TPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLS 234

Query: 311 FHP-------EDDRFFLSACLDQKCRLWSILEKQVIF 340
           + P       E  R   SA  D   ++W    +  I+
Sbjct: 235 WEPIHLVKPGEKPR-LASASKDGTIKIWDTTRRVCIY 270

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 274 NSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           +S ++TG+ D + ++W C   T L T   HS++V  V +   D     +  +D   RLW
Sbjct: 154 SSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWS-ADGEVIATGSMDATIRLW 211

>Scas_581.3
          Length = 626

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 302 HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAM 351
           HS  VT++RFHP++D    S  +D  C LW      +I   D  + + A+
Sbjct: 490 HSSDVTSLRFHPQNDDLLCSGSMDWNCHLWDTFNNDLIDSIDLKEDVIAV 539

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 74/175 (42%), Gaps = 28/175 (16%)

Query: 128 AVWCIRFSHDGKFMATAGKDEILRIWKVIS-SPAERLELNQHSISFLKSTANAISQLNGQ 186
           AV+ I F  DG  +A+AG D +  IW + S  P  +LE +  +IS +  + N       Q
Sbjct: 300 AVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGY-----Q 354

Query: 187 LAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQT----QGHRHPYG 242
           LA  G D      +  +  T    L    A  D      V  ++   T     GH     
Sbjct: 355 LATAGADGTVRVWDIRNVGTESALLAHQVAALD------VKFKKNNGTFLVSCGH----- 403

Query: 243 LGDSYCGVFHPN---PLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCAR 293
             D    +F+ +    L +   HTD +  +D +++ S I +G  D+S K W CA+
Sbjct: 404 --DRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW-CAK 455

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 3/104 (2%)

Query: 262 HTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDRFFL 320
           H   I  +DW  + + +L+G  D   KLW     +  +   H+  V+ V+ HP   R   
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPS-GRLAA 272

Query: 321 SACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYDGNYTILGT 364
           SA  D    LW  LE++V  +   G       I++  +  +L +
Sbjct: 273 SASFDLTWILWD-LERKVELQLQEGHSKAVYTIAFQSDGALLAS 315

>Scas_605.18
          Length = 424

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 59/140 (42%), Gaps = 8/140 (5%)

Query: 254 NPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFH 312
           N +  F  HT  I DI++  NS I+T S D +C LW   +   ++ +  H   V A+   
Sbjct: 171 NVVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALP 230

Query: 313 PED------DRFFLSACLDQKCRLWSILEKQVIFEYDCGDL-ITAMDISYDGNYTILGTF 365
           P           F S   D    +W       + ++   D  + A+    DGN  + G  
Sbjct: 231 PPSADENTGANIFASCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGD 290

Query: 366 NGYIHVLITKSLELLFSFNV 385
           +G I++   +S   + S+++
Sbjct: 291 DGVINMFDLRSDCAIASYSL 310

>Scas_721.115*
          Length = 318

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 259 FHEHTDDILD--IDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHP--- 313
           F  H  D++   ID  K S I++GS DK+ K+W            H+D+V+ VR  P   
Sbjct: 103 FVGHKSDVMSVAID-RKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQ 161

Query: 314 -EDDRFFLSACLDQKCRLWSILEKQV 338
            +D    +SA  D+  + W++ + Q+
Sbjct: 162 NDDSVTVISAGNDKMVKAWNLNQFQI 187

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 27/57 (47%)

Query: 444 SNDSRIRIYTLNQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYCWKL 500
           S D  I+++T+  + ++ + GH++  SQ+    T        V+S   D  +  W L
Sbjct: 126 SRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNL 182

>Scas_702.16
          Length = 816

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 87/206 (42%), Gaps = 22/206 (10%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQH-SISFLKSTANAISQLNGQL 187
           ++ +  S DGK +AT G D  +RIW V S       + Q   I  LK       +L   L
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSVDS-------IKQIVKILSLKDEVPIDKELKKPL 72

Query: 188 AQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSY 247
           A     T S +    S N    + GS +          + +E+  Q      P   G+S 
Sbjct: 73  ASMSRHTGSVTCLKFSPNGKYLASGSDDRI---LLIWTLDEERPIQ------PIFGGESE 123

Query: 248 CGVFHPNPLVTFHEHTDDILDIDWSKNSFILTG-SMDKSCKLWHCARPTSLKTF-VHSDF 305
              +     +  H+  +DI DI W+ +S +L    +D++  +W+      LK F VH   
Sbjct: 124 KERWAVRKRLVAHD--NDIQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFDVHQSH 181

Query: 306 VTAVRFHPEDDRFFLSACLDQKCRLW 331
           V  V F P  +++F +A  D+  +++
Sbjct: 182 VKGVIFDPA-NKYFATASDDRTMKIF 206

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 88  FKQFRRLILAQELRPFGNEFQDSSSSNEKGTATEPMKNGGAVWCIRFSHDGKFMATAGKD 147
            KQ  +++  ++  P   E +   +S  + T        G+V C++FS +GK++A+   D
Sbjct: 49  IKQIVKILSLKDEVPIDKELKKPLASMSRHT--------GSVTCLKFSPNGKYLASGSDD 100

Query: 148 EILRIWKV 155
            IL IW +
Sbjct: 101 RILLIWTL 108

>Scas_592.4*
          Length = 318

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 259 FHEHTDDILD--IDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHP--- 313
           F  H  D++   ID  K S I++GS DK+ K+W            H+D+V+ VR  P   
Sbjct: 103 FVGHKSDVMSVAID-RKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQ 161

Query: 314 -EDDRFFLSACLDQKCRLWSILEKQV 338
            +D    +SA  D+  + W++ + Q+
Sbjct: 162 NDDAVTVISAGNDKMVKAWNLNQFQI 187

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 27/57 (47%)

Query: 444 SNDSRIRIYTLNQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYCWKL 500
           S D  I+++T+  + ++ + GH++  SQ+    T        V+S   D  +  W L
Sbjct: 126 SRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNL 182

>Kwal_23.5035
          Length = 744

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 438 DWFLVS-SNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWI 495
           D  LVS S D  +R++ +   +   V KGH+   S +     V  +GK ++V+GS DH +
Sbjct: 421 DGILVSGSTDRSVRVWNIKSGKCTHVFKGHT---STVRCLDIVEHNGKKFIVTGSRDHTL 477

Query: 496 YCWKL 500
           + WKL
Sbjct: 478 HVWKL 482

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVIS 157
           G VW +++ HDG  + +   D  +R+W + S
Sbjct: 411 GGVWALKYGHDG-ILVSGSTDRSVRVWNIKS 440

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 7/84 (8%)

Query: 426 ARNYKISSKDVSDWFLVS-SNDSRIRIYTLNQ--EFVSVMKGHSNEHSQITAHSTVTRSG 482
           A    + + D+S  +LVS SND  IRIY L +  E  +++  + +  S   + +T  + G
Sbjct: 39  AHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRATTDKDG 98

Query: 483 KA----YVVSGSEDHWIYCWKLSD 502
           K     +++S SEDH I  W++ D
Sbjct: 99  KQQGNKWLLSASEDHTIIIWRVKD 122

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 302 HSDFVTAVRFHPED-DRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDI 353
           H++ V   RF+      + +SA  D K  +W I++++ +  YDCG+ +  + +
Sbjct: 271 HTNRVKDFRFYKNSMGHYLVSAGSDGKIVVWDIVKQEQLAVYDCGERLNCLAV 323

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 4/48 (8%)

Query: 112 SSNEKGTATEPM----KNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
           +S +K    +P+    ++ G+V  ++FS DGK++A+   D IL IW++
Sbjct: 58  ASTDKDILMKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWEL 105

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 84/211 (39%), Gaps = 35/211 (16%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIW------KVISSPAERLELNQHSISFLKSTANAISQ 182
           V+    S D + +AT G D  +RIW      K  S+P    + +      L    + +S+
Sbjct: 20  VYTCDVSPDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKD-----ILMKPLSTMSR 74

Query: 183 LNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYG 242
             G +       D   L SGS +  +                 + + + G TQ       
Sbjct: 75  HAGSVTTVKFSPDGKYLASGSDDRIL----------------LIWELEGGTTQPM----- 113

Query: 243 LGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTG-SMDKSCKLWHCARPTSLKTF- 300
            G     + H N       H +DI DI W+ +S I+    +D++  +W+ +    +K F 
Sbjct: 114 FGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFD 173

Query: 301 VHSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           VH   V  V F P  +++F +A  D+  +++
Sbjct: 174 VHQSHVKGVVFDPA-NKYFATASDDRTIKMF 203

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 7/135 (5%)

Query: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDD- 316
           F  HT  I DI+++ N+ ILT S D +C LW   +   ++ +  H   V A+    E + 
Sbjct: 177 FKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNS 236

Query: 317 ----RFFLSACLDQKCRLWSILEKQVIFEYDCGDL-ITAMDISYDGNYTILGTFNGYIHV 371
                 F S   D    +W       +  +   D  I A+    DG   + G+ NG I++
Sbjct: 237 ENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINM 296

Query: 372 LITKSLELLFSFNVL 386
              +S   + +F++ 
Sbjct: 297 YDLRSDCSIATFSLF 311

>Kwal_56.23895
          Length = 367

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 26/64 (40%), Gaps = 2/64 (3%)

Query: 255 PLVTFHEHTDDILDIDWS--KNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFH 312
           P+  FHEH  ++   +W+       ++ S D + K+W   RP SL T             
Sbjct: 96  PIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPMAAQNPLM 155

Query: 313 PEDD 316
           P  D
Sbjct: 156 PSKD 159

>Kwal_56.23920
          Length = 937

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 77/216 (35%), Gaps = 54/216 (25%)

Query: 125 NGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLN 184
           + GA+W +  + DGK + T   D+ +  W          ++ Q  +           + N
Sbjct: 466 HSGAIWSLDMTTDGKRLVTGSADKTVCFWD--------FQVEQEPV------PGTTDKFN 511

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLG 244
            +L  +   T                      N D  + K  P  +            L 
Sbjct: 512 PKLKMFHDTT-------------------LELNDDVLAVKISPDNR-------LLAVSLL 545

Query: 245 DSYCGVFHPNPL---VTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLW-----HCARPT 295
           D+   VF  + +   ++ + H   +L ID S +S  ++T S DK+ K+W      C R  
Sbjct: 546 DNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSL 605

Query: 296 SLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
               F H+D +  V F PE   FF S   D   + W
Sbjct: 606 ----FAHNDSIMKVVFVPESHNFF-SCSKDALVKYW 636

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIW 153
           VW +  S DG+F+ +A  D+ +R+W
Sbjct: 654 VWTLAISSDGRFVVSASHDQSIRVW 678

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 9/86 (10%)

Query: 255 PLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLW--HCARPTSLKTFVHSDFVTAVRF 311
           P VT + H + +L + WS +   I TGSMD + +LW     +P       HS ++T++ +
Sbjct: 180 PKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTW 239

Query: 312 ------HPEDDRFFLSACLDQKCRLW 331
                  P       SA  D   R+W
Sbjct: 240 EPIHLVEPGSKPRLASASKDGTIRIW 265

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 98/244 (40%), Gaps = 33/244 (13%)

Query: 131 CIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLAQY 190
           C+++  +G  + +   D+ +R W         ++ N   I+ LKS A+ ++ L+      
Sbjct: 285 CVKWGGEG-ILYSGSHDKTVRAWD--------MKQNGKCINILKSHAHWVNHLSLS---- 331

Query: 191 GGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGL----GDS 246
              TD A L  G+     D  G   AN      KA+   ++   +  +H   +     D 
Sbjct: 332 ---TDYA-LRVGA----FDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDF 383

Query: 247 YCGVFHP----NPLVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLKTFV 301
              +++P     P+     H   +  + +S +  +I++ S D S KLW     T L TF 
Sbjct: 384 TMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFR 443

Query: 302 -HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDC-GDLITAMDISYDGNY 359
            H   V  V +   D R  +S   D   ++W +  +++  +     D +  +D S DG  
Sbjct: 444 GHVASVYQVAWS-SDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKR 502

Query: 360 TILG 363
              G
Sbjct: 503 VCSG 506

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%), Gaps = 4/97 (4%)

Query: 260 HEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF---HPED 315
           +EH   +L   WS + + I +G  D + KL+  A   S +   H+D V ++RF    P +
Sbjct: 76  YEHNGPVLCTRWSLDGARIASGGCDNTVKLYDVASGQSQQIGSHNDAVKSLRFVQCGPTN 135

Query: 316 DRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMD 352
               ++   D+  + W   + Q I      + +  MD
Sbjct: 136 TECLVTGSWDKTIKFWDTRQPQPITTIAMPERVYTMD 172

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 28/48 (58%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLK 174
           G V C R+S DG  +A+ G D  ++++ V S  ++++  +  ++  L+
Sbjct: 80  GPVLCTRWSLDGARIASGGCDNTVKLYDVASGQSQQIGSHNDAVKSLR 127

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 72/153 (47%), Gaps = 14/153 (9%)

Query: 241 YGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLKT 299
           Y +GD  C  +          HT+ I DI WS +S  + +GS D + ++ H       K 
Sbjct: 40  YSVGDGGCARYETT-------HTEPINDICWSPDSACVASGSEDFTVEITHLEYGRLHKL 92

Query: 300 FVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDC-GDLITAMDISYDGN 358
             HS  V +V F+ + +    +A +D+  + W +L   ++       D + ++D + D +
Sbjct: 93  RGHSAPVLSVVFNCKGN-LLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSID-TPDCD 150

Query: 359 YTIL--GTFNGYIHVLITKSLELLFSFNVLDKD 389
            TIL  G+++G I +  T+S   L +    DKD
Sbjct: 151 ATILSSGSYDGLIRIFDTESGHCLKTLT-YDKD 182

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 243 LGDSYCGVFHPNPL---VTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLK 298
           L D+   VF  + L   ++ + H   +L ID+S +S  ++T S DK+ K+W        K
Sbjct: 541 LLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHK 600

Query: 299 T-FVHSDFVTAVRFHPEDDRFF 319
           + F H D + +VRF  +   FF
Sbjct: 601 SIFAHQDSIMSVRFEADTHNFF 622

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 104/289 (35%), Gaps = 61/289 (21%)

Query: 232 GQTQGHRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWH 290
           G  QG    + L  S         L T   HT  I  +D + N   ++TGS DKSCK W 
Sbjct: 440 GTRQGELQLFDLASSTL-------LSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFW- 491

Query: 291 CARPTSLKTFVHSDFVTAVRFHP-EDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLIT 349
                        DF    +  P   D++     L     L            +  D I 
Sbjct: 492 -------------DFEVVEQLVPGTKDKYIPQLKLVHDTTL------------ELTDDIL 526

Query: 350 AMDISYDGNYTILGTFNGYIHVLITKSLELLFSFN-----VLDKDSELKKCHRTSRRLKK 404
           A+ IS +  Y  +   +  + V    SL+   S       VL  D  +      S+ L  
Sbjct: 527 AVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVD-----SKMLIT 581

Query: 405 QSSDKAKNGPKITGLE--------FIQKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQ 456
            S+DK     KI G++        F  +D+        D  ++F    + +  R      
Sbjct: 582 SSADK---NIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKF 638

Query: 457 EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYCWKLSDEVV 505
           + +  + GH +E   I     V+  G+  VVS S DH I  W+ +D+ V
Sbjct: 639 DCIQKLNGHQSEVWCI----AVSPDGRT-VVSTSHDHSIRVWQETDDQV 682

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 17/121 (14%)

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLG 244
           GQL  Y   ++S  L       H D+L +   + DG   + V   + G+ +     + + 
Sbjct: 336 GQLLVYEWQSESYILKQ---QGHFDALNALAYSPDG--ARIVTAAEDGKIK----IWDIV 386

Query: 245 DSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTFVHS 303
             +C       L TF EHT  +  + ++KN  I+ + S+D + K W   R  + +TF  +
Sbjct: 387 SGFC-------LATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTAT 439

Query: 304 D 304
           +
Sbjct: 440 E 440

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 7/125 (5%)

Query: 243 LGDSYCGVFHPNPL---VTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLK 298
           L D+   VF  + +   ++ + H   +L ID S +S  I+T S DK+ K+W        K
Sbjct: 550 LLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609

Query: 299 T-FVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFE-YDCGDLITAMDISYD 356
           + F H D +  V+F P+   FF S   D   + W   + + I + Y     + A+ ++ D
Sbjct: 610 SLFAHQDSIMNVKFLPQSHNFF-SCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATD 668

Query: 357 GNYTI 361
           G + +
Sbjct: 669 GGFVV 673

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 97/241 (40%), Gaps = 49/241 (20%)

Query: 277 ILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEK 336
           ++TGS DK+ K W      SL     + F+  ++ H +                 + LE 
Sbjct: 488 LVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHD-----------------TTLE- 529

Query: 337 QVIFEYDCGDLITAMDISYDGNYTILGTFNGYIHVLITKSLELLFSFN-----VLDKDSE 391
                    D I  + +S D  Y  +   +  + V    S++   S       VL  D  
Sbjct: 530 -------LTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS 582

Query: 392 LKKCHRTSRRLKKQSSDKAKNGPKITGLEF--IQKDARNYKISSKDV-----SDWFLVSS 444
                  S+ +   S+DK     KI GL+F    K    ++ S  +V     S  F   S
Sbjct: 583 FD-----SKMIITSSADK---NIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCS 634

Query: 445 NDSRIRIYTLNQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYCWKLSDEV 504
            D+ ++ Y   ++F  + K ++++ S++ A +  T  G  +VVS S DH I  W+ +++ 
Sbjct: 635 KDAVVK-YWDGEKFECIQKLYAHQ-SEVWALAVATDGG--FVVSSSHDHSIRIWEETEDQ 690

Query: 505 V 505
           V
Sbjct: 691 V 691

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 36.2 bits (82), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 82/202 (40%), Gaps = 36/202 (17%)

Query: 163 LELNQH----SISFLKSTANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANR 218
           LEL  H    +I  + ST + I  L G L  + G   S S +    N     L S + ++
Sbjct: 2   LELTIHVKERTIELIMST-DEILVLRGTLEGHNGWVTSLSTSPAQPNM----LLSGSRDK 56

Query: 219 DGFSTKAVPQEQQGQT-----QGHRH-----------PYGLGDSYCGVFHPNPLVT---- 258
              + K   ++QQ        +GH H            Y L  S+        L +    
Sbjct: 57  TLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCI 116

Query: 259 --FHEHTDDILDIDWS-KNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHP-- 313
             F  H  D++ +    + + I++ S DK+ K+W+      +    H+D+V+ VR  P  
Sbjct: 117 KRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSE 176

Query: 314 --EDDRFFLSACLDQKCRLWSI 333
             +D    +SA +D+  ++W +
Sbjct: 177 KSDDAVTVISAGMDKVVKVWDL 198

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 255 PLVTFHEHTDDILDIDWS---KNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF 311
           P+  F EH  ++   +W+   K++F+ + S D + K+W  ARP S+ T + +    +V  
Sbjct: 96  PIALFQEHQREVFSCNWNLLHKDTFV-SSSWDGTVKVWTPARPQSMLTLLPAPANRSVMV 154

Query: 312 HP 313
            P
Sbjct: 155 EP 156

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 255 PLVTFHEHTDDILDIDW---SKNSFILTGSMDKSCKLWHCARPTSLKTF 300
           P+  FHEH+ ++   +W   SK++F+ + S D   K+W   R  SL TF
Sbjct: 96  PIAMFHEHSKEVYSCNWNLVSKSNFV-SSSWDGQVKIWSPNRKASLITF 143

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 243 LGDSYCGVFHPNPL---VTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLK 298
           L D+   VF  + +   ++ + H   +L +D S +S  I+T S DK+ K+W        K
Sbjct: 547 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHK 606

Query: 299 T-FVHSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           + F H D +  V+F PE   FF S   D   + W
Sbjct: 607 SLFAHQDSIMNVKFLPESYNFF-SCSKDATVKYW 639

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWK 154
           VW I  S+DG F+ + G D  +R+W+
Sbjct: 657 VWSISVSNDGTFVISTGHDHSIRVWE 682

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 5/71 (7%)

Query: 434 KDVSDWFLVS-SNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSE 491
           K   D  LVS S D  +RI+ +   +   V +GH+   S +     V   G  YVV+GS 
Sbjct: 414 KYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHT---STVRCLDVVEHGGIKYVVTGSR 470

Query: 492 DHWIYCWKLSD 502
           D+ ++ WKL D
Sbjct: 471 DNTLHVWKLPD 481

>Kwal_27.11585
          Length = 823

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 13/70 (18%)

Query: 276 FILTGSMDKSCKLWHCARPTSLKTFVH----SDF--------VTAVRFHPEDDRFFLSAC 323
           FI+T S D + K W   +PTS    +H    SD+        + A+   P +D  F +A 
Sbjct: 465 FIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISP-NDSVFATAS 523

Query: 324 LDQKCRLWSI 333
            D+ C++W++
Sbjct: 524 YDKTCKIWNV 533

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 11/88 (12%)

Query: 277 ILTGSMDKSCKLWHCARPTSLKTFVH-----SDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
            L+ S+D   K+W  +  T L+TF+      +DF    R      R F+SA  D   +LW
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDR-----GRNFVSASSDGSLKLW 227

Query: 332 SILEKQVIFEYDCGDLITAMDIS-YDGN 358
                  +F  +  D I  + ++ Y GN
Sbjct: 228 ECSTSACVFTLNSNDGINCISLANYQGN 255

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 243 LGDSYCGVFHPNPL---VTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLK 298
           L D+   VF  + +   ++ + H   +L +D S +S  I+T S DK+ K+W        K
Sbjct: 544 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHK 603

Query: 299 T-FVHSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           + F H D +  V+F PE   FF S   D   + W
Sbjct: 604 SLFAHQDSIMNVKFLPESHNFF-SCSKDGTVKYW 636

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 6/68 (8%)

Query: 439 WFLVSSNDSRIRIYTLNQEFVSV-MKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYC 497
           WF   SNDS IR++ L    + V ++GH      +T       +   Y+ S S+D  + C
Sbjct: 128 WFATGSNDSTIRVWDLATGKLKVTLQGHI-----MTVRDICISARHPYMFSASQDKLVKC 182

Query: 498 WKLSDEVV 505
           W L    V
Sbjct: 183 WDLERNTV 190

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 257 VTFHEHTDDILDIDWS-KNSFILTGSMDKSCKLWHCARPTSLKTFVHSDF--VTAVRFHP 313
           VT   H   + DI  S ++ ++ + S DK  K W   R T ++ F H     V +V  HP
Sbjct: 150 VTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVRDF-HGTLSGVHSVDLHP 208

Query: 314 EDDRFFLSACLDQKCRLWSILEKQVIF 340
             D   +SA  D   R+W I  +  + 
Sbjct: 209 SLD-LIVSAGRDSVVRVWDIRSRSCVL 234

>Scas_675.18
          Length = 876

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 128 AVWCIRFSHDGKFMATAGKDEILRIWKVISSPAE 161
           +V C+  S D K++ +AG D ++RIW +  SP E
Sbjct: 68  SVLCLTRSDDEKYLFSAGADSLVRIWSINGSPLE 101

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 106/267 (39%), Gaps = 40/267 (14%)

Query: 256 LVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCA--RPTSLKTFVHSDFVTAVRFH 312
           + T   H + +L   WS +   I TGSMD + +LW  +  +P       HS ++T++ + 
Sbjct: 179 MCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWE 238

Query: 313 ------PEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYDG-NYTILGTF 365
                 P D     +A  D   ++W    +  +    CG   +   + + G N    G+ 
Sbjct: 239 PIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTL-CGHTSSVSCVKWGGKNVLYSGSH 297

Query: 366 NGYIHVLITKSLELLFSFNVLDKDSELKKCH---------RTSRRLKKQSSDKAKNGPKI 416
           +  I           +  N+  K   + K H          T   L+  + D     P  
Sbjct: 298 DKTIRC---------WDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPA- 347

Query: 417 TGLEFIQKDARNYKISSK---DVSDWFLVSSNDSRIRIYTL--NQEFVSVMKGHSNEHSQ 471
           +  E  QK  +NY+  +K   D  +  + +S+D  + ++    + + ++ M G    H +
Sbjct: 348 SPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTG----HQK 403

Query: 472 ITAHSTVTRSGKAYVVSGSEDHWIYCW 498
           +  H   +  G+ Y+VS S D+ I  W
Sbjct: 404 LVNHVAFSPDGR-YIVSASFDNSIKLW 429

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 263 TDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFL 320
           T +I D+ WS  + +I+TG MD   +++  A  T +   V H+ +V  V + P+++ + +
Sbjct: 136 TSEIYDLAWSPCAKYIVTGCMDNGVRIFDIAEKTCVAHVVEHNHYVQGVVWDPQNE-YII 194

Query: 321 SACLDQKCRLWSI 333
           S   D+   ++ I
Sbjct: 195 SQSADRSVHIYKI 207

>Scas_720.83d
          Length = 915

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 86/239 (35%), Gaps = 64/239 (26%)

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLG 244
           GQL  Y   ++S  L       H D+  S   + DG  ++ V   + G+ +     + + 
Sbjct: 323 GQLLVYEWQSESYILKQ---QGHFDATNSLTYSPDG--SRVVTAAEDGKIK----VWDVV 373

Query: 245 DSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTFV-- 301
             +C       L TF EHT  +  + ++K   +L + S+D + + W   R  + +TF   
Sbjct: 374 SGFC-------LATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAA 426

Query: 302 -------------------------------------------HSDFVTAVRFHPEDDRF 318
                                                      H   V+ + F  E+   
Sbjct: 427 ERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENS-V 485

Query: 319 FLSACLDQKCRLWSILEK-QVIFEYDCGDLITAMDISYDGNYTILGTFNGYIHVLITKS 376
             SA  D+  R+WSI  + Q +  +D    + A+ I  DG    + T  G I ++  +S
Sbjct: 486 LASASWDKTVRVWSIFGRSQQVEPFDVYSDVLALTIRPDGKQVAVSTLKGQILMIDIES 544

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 48/254 (18%), Positives = 94/254 (37%), Gaps = 58/254 (22%)

Query: 89  KQFRRLILAQELR-PFGNEFQDSSSSNEKGTATEPMKNGGAVWCIRFSHDGKFMATAGKD 147
           K++ +L +  ELR PF        ++N+             V C+ +SHDG  + T  ++
Sbjct: 195 KKYWKLTIIAELRHPFALSASSGKTTNQ-------------VTCLAWSHDGNSIVTGVEN 241

Query: 148 EILRIWK---------------VISSPAER-----LELNQHSISFLKSTANAISQLNGQL 187
             LR+W                ++S    +     + ++  +++ L +  +     + +L
Sbjct: 242 GELRLWNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFEL 301

Query: 188 AQYGGDTDSASLNSGSSNTHVD-------SLGSSNANRDGFSTKAVPQEQQGQTQGHRHP 240
            + GG + +A  +SG  +  VD                  F  +   +   G+  GH  P
Sbjct: 302 KETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHGP 361

Query: 241 YGL--------------GDSYCGVFHP---NPLVTFHEHTDDILDIDWSKNSFILTGSMD 283
             +               D    ++H    N    F+ H+  I+   W  +  +++ SMD
Sbjct: 362 ISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSMD 421

Query: 284 KSCKLWHCARPTSL 297
            S +LW   + T L
Sbjct: 422 GSVRLWSLKQNTLL 435

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 426 ARNYKISSKDVSDWFLVS-SNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGK 483
           A +  +   D+S  +LVS SND  IRIY L + + +  + GH    + +         G+
Sbjct: 39  AHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGKDADGQ 98

Query: 484 -----AYVVSGSEDHWIYCWKLSD 502
                 +++S SEDH I  W++ D
Sbjct: 99  DIQLNKWLLSASEDHKIIVWRVKD 122

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 10/87 (11%)

Query: 416 ITGLEFIQ-KDARNYKISSKDVSDWFLVSSNDSRIRIYTL-NQEFVSVMKGHSNEHSQIT 473
           IT L F + KDA    I    ++ W L +S D +I ++ + + E    +KGH+   +   
Sbjct: 84  ITNLRFSRGKDADGQDIQ---LNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFD 140

Query: 474 AHSTVTRSGKAYVVSGSEDHWIYCWKL 500
            H +         VS SEDH I  W L
Sbjct: 141 IHPS-----NRVAVSVSEDHSIRLWNL 162

>Kwal_55.21450
          Length = 503

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 61/147 (41%), Gaps = 11/147 (7%)

Query: 252 HPNPLVTFHEH-TDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTA- 308
           H N LV  ++H    I+ + +  + S  ++ S DKS ++W       +K    +   +  
Sbjct: 329 HKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPIKQISDTSQYSMP 388

Query: 309 -VRFHPEDDRFFLSACLDQKCRLWSILEK------QVIFEYDCGDLITAMDISYDGNYTI 361
            +  HPE + +F +  +D     +S+  K      +    + C         S DG Y  
Sbjct: 389 YIGIHPEQN-YFAAQSMDNAIYAFSMKPKYKRHPKKHFSGHKCAGFGIGFGFSPDGQYIA 447

Query: 362 LGTFNGYIHVLITKSLELLFSFNVLDK 388
            G   G +++   K+  LL  F+V DK
Sbjct: 448 SGDTRGRVYIWDWKTTHLLKHFDVPDK 474

>Kwal_27.10385
          Length = 536

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 263 TDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFL 320
           + +I D+ WS + ++I+TGSMD S +++     T +     H+ +V  V + P+++ F  
Sbjct: 136 SSEIYDLAWSPDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWDPQNE-FIF 194

Query: 321 SACLDQKCRLWSI 333
           S   D+   ++ I
Sbjct: 195 SQSADRSVHVYRI 207

>Scas_707.22
          Length = 730

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 437 SDWFLVS-SNDSRIRIYTLNQEFVS-VMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHW 494
           +D  +VS S D  +RI+ + +   + V KGH+   S +     VT     Y+V+GS D+ 
Sbjct: 406 ADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHT---STVRCLEIVTYKNMKYIVTGSRDNT 462

Query: 495 IYCWKLSDE 503
           ++ WKL  E
Sbjct: 463 LHVWKLIKE 471

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 28/173 (16%)

Query: 128 AVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNG-Q 186
            V+ + F  DG  + + G D +  +W  I S ++ + L  HS    K         NG Q
Sbjct: 309 GVFSLSFQCDGSLVCSGGMDSLSMLWD-IRSGSKVMTLAGHS----KPIYTVAWSPNGYQ 363

Query: 187 LAQYGGDT-----DSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPY 241
           +A  GGD      D    + G  N  +       A+R+      V Q +  +  G +   
Sbjct: 364 VATGGGDGIINVWDIRKRDEGQLNQIL-------AHRN-----IVTQVRFSKEDGGKKLV 411

Query: 242 GLG-DSYCGVFHPNPLV---TFHEHTDDILDIDWSKNS-FILTGSMDKSCKLW 289
             G D+   V+  +  +   +   HTD I+ +D S NS F+++G  D+S KLW
Sbjct: 412 SCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLW 464

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 252 HPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTF 300
           +P  L+       DI  ID  +N  +L+ S+D + +LW C   T++ TF
Sbjct: 170 NPRTLIGHRATVTDIAIIDRGRN--VLSASLDGTIRLWECGTGTTIHTF 216

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 65/163 (39%), Gaps = 11/163 (6%)

Query: 237 HRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTS 296
           +R P G           N    F  HT  I  +++   S ++T S D +C LW   +   
Sbjct: 154 YRMPRG------SAVQQNVTSIFKGHTGYISGVEFVSESRVVTSSGDMTCALWDIPKAKR 207

Query: 297 LKTFV-HSDFVTAVRF---HPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLIT-AM 351
           ++ +  H   V A+     +   +  F S   D    +W +     + ++  G   +  +
Sbjct: 208 VREYSDHLGDVLAISIPVTNLSKNNMFASCGSDGYTFIWDVRSPSAVQQFSIGSCDSNCL 267

Query: 352 DISYDGNYTILGTFNGYIHVLITKSLELLFSFNVLDKDSELKK 394
               DGN   +G  +G I +   ++   +  +++ D+ S L+K
Sbjct: 268 KFFPDGNSVAVGNDDGTISLFDLRADCTIALYSINDRGSPLQK 310

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 262 HTDDILDIDWS-KNSFILTGSMDKSCKLWHCARPTSLKTF-VHSDFVTAVRFHPEDDRFF 319
           HT  ++ I ++ K + + + SMD+S K WH    T+LKT   HSD V ++   P+ D   
Sbjct: 109 HTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDI-PKFDSSI 167

Query: 320 LSA 322
           LS+
Sbjct: 168 LSS 170

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 56/138 (40%), Gaps = 10/138 (7%)

Query: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDF---VTAVRFHPED 315
           F  HT  + D+++  N  ILT S D +C LW    P S +   +SD    V  +   P  
Sbjct: 173 FKGHTCYVSDLEFINNESILTASGDMTCALWDI--PKSKRVSEYSDHLGDVLTLSVPPAG 230

Query: 316 ----DRFFLSACLDQKCRLWSILEKQVIFEYDCGDL-ITAMDISYDGNYTILGTFNGYIH 370
               D  F S   D    LW       +  +   D  I+ +    DGN  I G+ +G   
Sbjct: 231 TTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGIAR 290

Query: 371 VLITKSLELLFSFNVLDK 388
           +   +S   L S+++  K
Sbjct: 291 LFDLRSDCELSSYSLSQK 308

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 8/84 (9%)

Query: 426 ARNYKISSKDVSDWFLVS-SNDSRIRIYTLNQ-EFVSVMKGHSN-----EHSQITAHSTV 478
           A +  +   D+S  +LVS SND  IRIY L + + +  +  H       + S+++     
Sbjct: 39  AHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPK 98

Query: 479 TRSGKAYVVSGSEDHWIYCWKLSD 502
           + SGK +++S SED+ I  W++ D
Sbjct: 99  STSGK-WLLSASEDNKIIVWRVKD 121

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 30/160 (18%), Positives = 57/160 (35%), Gaps = 20/160 (12%)

Query: 189 QYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSYC 248
           Q   D +   + +     H D L S +A  DG       ++       +       + + 
Sbjct: 363 QASEDKEVMEIETEMYEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFT 422

Query: 249 GVF-HPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTF------- 300
               H  P+        ++++ +W +  F+LT S D + K W    P   K         
Sbjct: 423 KFLGHAGPVTAIA--LPNVMNRNWPE--FLLTASNDLTIKRWKVPNPNDRKAIELPHIVK 478

Query: 301 -------VHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
                   H   + A+   P +D  F +A  D+ C++W++
Sbjct: 479 ASEYTRRAHEKDINAISMSP-NDSIFATASYDKTCKIWNV 517

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 274 NSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           +S ++TG+ D + ++W C   T + T   H ++V  V + P D     +  +D   RLW
Sbjct: 156 SSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSP-DGELIATGSMDNTIRLW 213

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 16/111 (14%)

Query: 405 QSSDKAKNGPKITGLEFIQKDARNYKISSKDVSDWFLVS-SNDSRIRIYTLNQE------ 457
           Q  + A   P    +   Q  A +  I    VS  +LVS SND  IRIY L +       
Sbjct: 85  QKENDAAKTPHFMPIFHFQ--AHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTL 142

Query: 458 ------FVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYCWKLSD 502
                   ++   H    S+  A S  +++ K +++S SEDH I  W++ D
Sbjct: 143 LSHQGSITALQFSHPASSSEDAAVSKGSKNSK-WLLSASEDHKIMVWRVKD 192

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 256 LVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHP 313
           + T H H  DI  I  + N S   T S DK+CKLW+      + T   H   +  V F  
Sbjct: 488 IYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSF-C 546

Query: 314 EDDRFFLSACLDQKCRLWSI 333
           E +++  +   D+  ++WS+
Sbjct: 547 ESEKWIATCSGDKTVKIWSL 566

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 4/110 (3%)

Query: 255 PLVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFH 312
           P+ T   H   + D+ + ++  +I T S DK+ K+W     T LKT   H++ V    F 
Sbjct: 529 PVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFM 588

Query: 313 PEDDRFFLSACLDQKCRLWSILEKQVIFEYDC-GDLITAMDISYDGNYTI 361
            +  +  +SA  D   ++W I     I   D   + I A+ +  DG+  I
Sbjct: 589 NKQKQ-LVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLII 637

>Scas_712.34
          Length = 399

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 118 TATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVIS 157
           ++ E   + G V+ + F+  G+F+AT+G D  +R+W V S
Sbjct: 285 SSVESFAHSGWVFALSFNSTGEFLATSGYDSKVRVWDVKS 324

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 440 FLVS-SNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYC 497
            LVS S D  +RI+ ++  +   V KGH+   S +     V   G  Y+V+GS D+ ++ 
Sbjct: 422 ILVSGSTDRSVRIWNIHLGKCTHVFKGHT---STVRCLDIVEHEGVKYIVTGSRDNTLHI 478

Query: 498 WKL 500
           WKL
Sbjct: 479 WKL 481

>Scas_685.11
          Length = 384

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 10/105 (9%)

Query: 406 SSDKAKNGPKITGLEFIQKDARNYKISSKDVSDWFLVS-SNDSRIRIYTLNQ-EFVSVMK 463
           S D +   P  T +   Q  A + K    DVS  +LVS SND  IRIY L + + +  + 
Sbjct: 21  SLDLSLKTPLFTPIFHFQAHALSVK--CLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLL 78

Query: 464 GHSNEHSQITAHSTVTRSGKA------YVVSGSEDHWIYCWKLSD 502
            H    + +    + T +G        +++S SED+ I  W++ D
Sbjct: 79  AHQGSITNLKFSKSKTENGDGEGSNNKWLLSASEDNKIIIWRVKD 123

>Kwal_34.15818
          Length = 349

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 256 LVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPE 314
           L TF  H   I  ID  +   + +TGS D S KLW     T++ T+     V  V+F P 
Sbjct: 45  LGTFEGHQGTIWSIDVDQFTQYAVTGSADFSIKLWKVQDGTNVFTWKTKTPVRRVQFSPS 104

Query: 315 DDRFFLSACLD 325
            D+    A LD
Sbjct: 105 GDKIL--AVLD 113

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 71/200 (35%), Gaps = 45/200 (22%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKV----------ISSPAERLELNQHSISFLKST 176
           G +W I      ++  T   D  +++WKV            +P  R++       F  S 
Sbjct: 53  GTIWSIDVDQFTQYAVTGSADFSIKLWKVQDGTNVFTWKTKTPVRRVQ-------FSPSG 105

Query: 177 ANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNAN---RDGFSTKAVPQEQQGQ 233
              ++ L+G +   G  T         +   VD       N   R+GF   AV       
Sbjct: 106 DKILAVLDGVMGYPGSVTVYTVRRDPETKDIVDISEEPTFNILTREGFEIAAVA------ 159

Query: 234 TQGHRHPYGLGDSYCGVFHPNPLVTFHE------------HTDDILDIDWSKN-SFILTG 280
                  +   D+Y    H +  V+ +E            HT ++ DI +S + ++ +T 
Sbjct: 160 ------AWSFNDTYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYFITS 213

Query: 281 SMDKSCKLWHCARPTSLKTF 300
           S D + KL        LKT+
Sbjct: 214 SRDSAAKLVDTETLEVLKTY 233

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 255 PLVTFHEHTDDILDIDWS--KNSFILTGSMDKSCKLWHCARPTSLKTFVHSD 304
           P+  + EH  ++   +W+  +    ++ S D   KLW   RP SL T   +D
Sbjct: 96  PIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTMSPND 147

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 17/117 (14%)

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLG 244
           GQL  Y   ++S  L       H DS  S   + DG  ++ V   + G+ +     + + 
Sbjct: 325 GQLLVYEWQSESYILKQ---QGHFDSTNSLAYSPDG--SRVVTASEDGKIK----VWDIT 375

Query: 245 DSYCGVFHPNPLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTF 300
             +C       L TF EHT  +  + ++K    + + S+D + + W   R  + +TF
Sbjct: 376 SGFC-------LATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTF 425

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 262 HTDDILDIDWSKNS-FILTGSMDKSCKLWHC---ARPTSLKTF-VHSDFVTAVRFHPEDD 316
           H  DI  + WS++S FILT S D S K+W      +  +  TF  H D+V    F  + +
Sbjct: 145 HFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQE 204

Query: 317 RFFLSACLDQKCRLWSILEK 336
           + + +   D    +W   ++
Sbjct: 205 KIY-TVSKDGAVFVWEFTKR 223

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVI--SSPAERLELNQHSISF-LKSTAN--AIS 181
           G V C+ FS +   +A+A  D+ +RIW +   S   E +E+    ++  ++      A+S
Sbjct: 474 GPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVS 533

Query: 182 QLNGQLAQY 190
            L GQ++ +
Sbjct: 534 TLKGQISIF 542

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 6/68 (8%)

Query: 437 SDWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWI 495
           SD    S  D ++R Y +NQ   + V+ GH +    I+A S      +  V  GS D   
Sbjct: 294 SDQLFASCADYKVRTYAINQFSQLEVLYGHQDLVVDISALSM-----ERCVTVGSRDRTA 348

Query: 496 YCWKLSDE 503
             WK++DE
Sbjct: 349 MLWKIADE 356

>Kwal_23.6240
          Length = 913

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVI--SSPAERLELNQHSISF-LKSTAN--AIS 181
           G V C+ FS +   +A+A  D+ +RIW +   S   E LE+    +S  ++   N  A +
Sbjct: 470 GPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVYADVLSLSVRPDGNEVAAA 529

Query: 182 QLNGQL 187
            L+GQ+
Sbjct: 530 TLDGQI 535

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 54/121 (44%), Gaps = 17/121 (14%)

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLG 244
           GQL  Y   ++S  L       H D+  +   + DG  ++ V   + G+ +     + + 
Sbjct: 321 GQLLVYEWQSESYILKQ---QGHFDATNAVTYSPDG--SRVVTASEDGKIK----IWDVV 371

Query: 245 DSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTFVHS 303
             +C       LVTF EHT  +  + ++K   +L + S+D + + W   R  + +TF  +
Sbjct: 372 SGFC-------LVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAA 424

Query: 304 D 304
           +
Sbjct: 425 E 425

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 17/121 (14%)

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLG 244
           GQL  Y   ++S  L       H D+L     + DG  +K V    +G+ +     + + 
Sbjct: 321 GQLIVYEWQSESYILKQ---QGHFDTLNGLCYSPDG--SKIVTASHEGKIK----IWDVA 371

Query: 245 DSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTFVHS 303
             +C       L TF EH   +  ++++K   +L + S+D + K W   R  + +TF  +
Sbjct: 372 SGFC-------LATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTAT 424

Query: 304 D 304
           +
Sbjct: 425 E 425

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 256 LVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPE 314
           L TF  H   I  ID  +   + +TGS D S KLW     +++ T+     V  V F P 
Sbjct: 45  LGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDGSNVYTWKTKTPVRRVEFSPA 104

Query: 315 DDRFFLSACLD 325
            D+    A LD
Sbjct: 105 GDKIL--AVLD 113

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 53/123 (43%), Gaps = 17/123 (13%)

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLG 244
           GQL  Y   ++S  L       H D+  S   + DG  ++ V   + G+ +     + + 
Sbjct: 321 GQLLVYEWQSESYILKQ---QGHFDATNSLTYSPDG--SRVVTAAEDGKIK----VWDVA 371

Query: 245 DSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFIL-TGSMDKSCKLWHCARPTSLKTFVHS 303
             +C       L TF EHT  +  + ++K   +L + S+D + + W   R  + + F  +
Sbjct: 372 SGFC-------LATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTAT 424

Query: 304 DFV 306
           + V
Sbjct: 425 ERV 427

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVI--SSPAERLELNQHSISFLKSTAN---AIS 181
           G V C+ FS +   +A+A  D+ +RIW +   S   E LE+    ++   +      A+S
Sbjct: 470 GPVSCLAFSMENAVLASASWDKTIRIWSIFGRSQQVEPLEVFADILAITITPDGKHVAVS 529

Query: 182 QLNGQLAQY 190
            L GQL  +
Sbjct: 530 TLKGQLTIF 538

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 109 DSSSSNEKGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWK 154
           D    N KG       +   V C+RF  D  FM +A +D  ++IWK
Sbjct: 42  DPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWK 87

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 274 NSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           +S ++TG+ D + ++W C   T + T   H ++V  V + P D     +  +D   RLW
Sbjct: 156 SSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSP-DGEVIATGSMDNTIRLW 213

>Scas_700.27*
          Length = 433

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 6/96 (6%)

Query: 277 ILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILE 335
           I++ S D + +LW      S+K    H   V  + FHP +  F +S+C     R W + E
Sbjct: 263 IVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTE--FSMSSCSANDIRSWKLPE 320

Query: 336 KQVI--FEYDCGDLITAMDISYDGNYTILGTFNGYI 369
             ++  F  D   +I  + I+ D +    G+ NG +
Sbjct: 321 GGLLTNFNSDGLGIINTLSINQD-DVLFAGSDNGML 355

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 6/64 (9%)

Query: 438 DWFLVSSNDSRIRIYTLNQEFVSV-MKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIY 496
           +WF   SND  I+I+ L    + V +K H      +T       +   Y+ S SED  + 
Sbjct: 129 EWFATGSNDKTIKIWNLASGKLKVTLKAHD-----MTVRDLAISNRHPYMFSVSEDKTVK 183

Query: 497 CWKL 500
           CW L
Sbjct: 184 CWDL 187

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 6/103 (5%)

Query: 277 ILTGSMDKSCKLWHCARPTSLKTFVHSD-FVTAVRFHPEDDRFFLSACLDQKCRLWSILE 335
           +++ S+D S +LW      S+K   H    V  +  HP +   F SAC +   R W + +
Sbjct: 257 VISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPSEFS-FASACTND-IRSWLLPK 314

Query: 336 KQVIFEYDCGDL--ITAMDISYDGNYTILGTFNGYIHVLITKS 376
            +++  +   DL  I  + I+ D +    G+ NG +     KS
Sbjct: 315 GELLTNFVSQDLDVINTVSINQD-DVLFAGSDNGSLTFFDYKS 356

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 11/100 (11%)

Query: 262 HTDDILDID-WSKNSFILTGSMDKSCKLWHC---ARPTSLKTFVHSDFVTAVRFHPEDDR 317
           H  D+  +  +  N+ +L+GS D   K+W     + P +LK   HS  +T      E  R
Sbjct: 140 HVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKG--HSAGITDTII-IERGR 196

Query: 318 FFLSACLDQKCRLWSILEKQVIFEY----DCGDLITAMDI 353
             LS+ LD   RLW +   + I ++    +  D +T+M +
Sbjct: 197 NVLSSSLDGSVRLWELGSGKTISKFCRKENTTDGVTSMSL 236

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 12/69 (17%)

Query: 276 FILTGSMDKSCKLWHCARPTS-----------LKTFVHSDFVTAVRFHPEDDRFFLSACL 324
           F+LT S D + K W   +PT+                H   + A+   P +D  F +A  
Sbjct: 453 FLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSP-NDSIFATASY 511

Query: 325 DQKCRLWSI 333
           D+ C++W++
Sbjct: 512 DKTCKIWNL 520

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 258 TFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPED 315
           T H H  DI  +  S N S   T S DK+CK+W+        T   H   +  V F  + 
Sbjct: 486 TRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSF-CQY 544

Query: 316 DRFFLSACLDQKCRLWSI 333
           D+   ++  D+  ++WS+
Sbjct: 545 DKLLATSSGDKTVKIWSL 562

>Scas_356.3d
          Length = 579

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 6/99 (6%)

Query: 132 IRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLAQYG 191
           IR S +  +  +  KD+I    K I    +RL+  +  +  +K T   +  LN  L    
Sbjct: 409 IRQSQEEAYQNSLRKDQIKEQEKTIIREEKRLQELEEKMKKIKETYGKLKWLNECLLILE 468

Query: 192 GDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQ 230
           GD +   LNS S +T V+ L S  A       K + QE+
Sbjct: 469 GDKNDL-LNSSSHSTEVEELISDTA-----EIKPIIQEE 501

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 438 DWFLVSSNDSRIRIYTL-NQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIY 496
           +WF+  SND+ ++++ L   +  + + GH      +T           Y+ S SED  + 
Sbjct: 153 EWFITGSNDTTMKVWDLATGKLKTTLAGHV-----MTVRDVAVSDRHPYLFSVSEDKTVK 207

Query: 497 CWKL 500
           CW L
Sbjct: 208 CWDL 211

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 269 IDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDR--FFLSACLDQ 326
           ID   N + +TGS D + K+W  A    LKT + +  V  VR     DR  +  S   D+
Sbjct: 147 IDPVDNEWFITGSNDTTMKVWDLA-TGKLKTTL-AGHVMTVRDVAVSDRHPYLFSVSEDK 204

Query: 327 KCRLWSILEKQVIFEY 342
             + W + + Q+I +Y
Sbjct: 205 TVKCWDLEKNQIIRDY 220

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 6/64 (9%)

Query: 438 DWFLVSSNDSRIRIYTL-NQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIY 496
           +WF   SND+ I+I+ L   +    + GH      +T           Y+ S SED  + 
Sbjct: 143 EWFATGSNDTTIKIWDLATGKLKLTLSGHI-----MTVKDICISKRHPYMFSASEDKLVK 197

Query: 497 CWKL 500
           CW L
Sbjct: 198 CWDL 201

>Kwal_56.24163
          Length = 729

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 308 AVRFHPEDDRFFLSACLDQKCRLWSI 333
            V F+P+D   F SACLD   ++WS+
Sbjct: 2   GVAFNPKDPSTFASACLDHTVKIWSL 27

>Kwal_56.24332
          Length = 418

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 17/94 (18%)

Query: 255 PLVTFHEHTDDILDIDWSK--NSFILTGSMDKSCKLWHCARPTSLKT--FVHSDFVTAVR 310
           P+ +FH          W+K   + I++ S+D +C +W    P  +KT    H   V  V+
Sbjct: 167 PVSSFH----------WNKIDPNLIISSSIDTTCTVWDLQSPNYVKTQLIAHDSEVYDVK 216

Query: 311 FHPEDDRFFLSACLDQKCRLW---SILEKQVIFE 341
           F  +  + F S   D   R++   S+    +I+E
Sbjct: 217 FLAQSTQLFASCGGDGSVRVFDLRSLAHSTIIYE 250

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
           complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 268 DIDWSKNSFILTGSMDKSCKLWHCARP--TSLKTFVHSDFVTAVRFHPEDDRFFLSACLD 325
           D+DWS++  +L G+++     + CAR   +  +   H+  V AVRF+ +     +S    
Sbjct: 66  DLDWSRDGAMLAGALENGVVEFFCARERRSVARVARHTTGVRAVRFNAKQANVAVSGGSQ 125

Query: 326 QKCRLW 331
            +  +W
Sbjct: 126 GEIFVW 131

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 8/92 (8%)

Query: 256 LVTFHEHTDDILDIDWSKNS--FILTGSMDKSCKLWHCA------RPTSLKTFVHSDFVT 307
           L T   HT++   + ++ N    +L+GS D +  LW  +      +PT      H+D + 
Sbjct: 172 LSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIIN 231

Query: 308 AVRFHPEDDRFFLSACLDQKCRLWSILEKQVI 339
            V++H  +   F S   D   +L+     Q+I
Sbjct: 232 DVKWHSSEAHIFGSVSEDSTMKLFDKRSSQII 263

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 302 HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILE 335
           H D VTA+ F P +D    S+  D++  +W + E
Sbjct: 312 HEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQE 345

>Kwal_23.6324
          Length = 514

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 277 ILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           ++TGS D + ++W C   T + T   H ++V  V + P D     +  +D   RLW
Sbjct: 158 MVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCP-DGELIATGSMDNTIRLW 212

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIW 153
           V+ + +S DGK + +AGKD+++RIW
Sbjct: 488 VYTVDWSVDGKRVCSAGKDKMVRIW 512

>Scas_631.17
          Length = 474

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 258 TFHEHTDDILDIDWSKNS-FILTGSMDKSCKLW 289
           T   HTD ILD+D S+++  I++   D+S KLW
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 116 KGTATEPMKNGGAVWCIRFSHDGK-FMATAGKDEILRIW 153
           KG +T    +GG   CI F+HDGK  + T GK    RIW
Sbjct: 327 KGASTATGSSGGFWSCIWFTHDGKDVILTNGKTGSWRIW 365

>YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein
           involved in the same pathway as Rad26p, has WD (WD-40)
           repeats [1521 bp, 506 aa]
          Length = 506

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 77/215 (35%), Gaps = 17/215 (7%)

Query: 91  FRRLILAQELR----PFGN--EFQDSSSSNEKGTATEPMKNGGAVWCIRFSHDGKFMATA 144
           +RR I ++  R    P  N   ++ S  SN       P+  G  V C+     G+ +   
Sbjct: 18  YRRTIQSEFERILEDPLSNMKNYRFSKQSNYSTKEKTPLSIG--VNCLDIDDTGQVLLGG 75

Query: 145 GKDEILRIWKVISSPAE----RLELNQHSISFLKSTANAISQLNGQLAQYGGDTDSASLN 200
           G D  L IW +  S         EL    ++++K   +       Q+  Y       + N
Sbjct: 76  GDDGSLSIWGLDESLHRNDEGEQELINKRLNYIKRQPHQSDDEPAQIMGYKNKRTRINDN 135

Query: 201 SGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDSYCGVFHPNPLVTFH 260
           +     H      +       S+ AVP ++   +     P G  ++   +   +   +  
Sbjct: 136 NTMRLVHSFQTQRNKYRMYRQSSAAVPVQRSHISNKTDSPIGFSET---LSETDSEASIS 192

Query: 261 EHTDDILDIDWSK--NSFILTGSMDKSCKLWHCAR 293
            H   I  + W K  N    TGS DK+ K+W   R
Sbjct: 193 HHKYGITTLKWYKADNGMFFTGSNDKTVKIWDTNR 227

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 27/46 (58%)

Query: 129 VWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLK 174
           V C R+S+DG  +A+ G D  L+++ + S   +++ ++   I  L+
Sbjct: 83  VLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLR 128

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 18/24 (75%)

Query: 131 CIRFSHDGKFMATAGKDEILRIWK 154
           C+ +SHDG+ +AT  +D+ + IW+
Sbjct: 114 CVAWSHDGELLATCSRDKSVWIWE 137

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 6/64 (9%)

Query: 438 DWFLVSSNDSRIRIYTLNQEFVSV-MKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIY 496
           +WF   SND+ I+I+ L    + + + GH      ++           Y+ S SED  + 
Sbjct: 136 EWFATGSNDTTIKIWDLAAGKLKITLIGHV-----MSVRDIAISKRHPYMFSASEDKLVK 190

Query: 497 CWKL 500
           CW L
Sbjct: 191 CWDL 194

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 14/71 (19%)

Query: 276 FILTGSMDKSCKLWHCARPTS--------LKTF-----VHSDFVTAVRFHPEDDRFFLSA 322
           FI+T S D + K W   + TS        +KT       H   + A+   P +D  F +A
Sbjct: 455 FIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISP-NDSLFATA 513

Query: 323 CLDQKCRLWSI 333
             D+ C++W++
Sbjct: 514 SYDKTCKIWNL 524

>Scas_720.95
          Length = 515

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 11/96 (11%)

Query: 255 PLVTFHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHC--ARPTSLKTFVHSDFVTAVRF 311
           P  T   H + +L + +  N   I TGSMD + +LW     +P       H  ++T++ +
Sbjct: 178 PKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAW 237

Query: 312 HP-------EDDRFFLSACLDQKCRLWSILEKQVIF 340
            P       E  R   SA  D   R+W I  +  ++
Sbjct: 238 EPIHLVKPGESPR-LASASKDGTIRIWDITRRVCLY 272

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 256 LVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLW 289
           L T   HT+ +  I WS    I +GS DK+ ++W
Sbjct: 271 LYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVW 304

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 274 NSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           +S ++TG+ D + ++W C   T   T   H ++V  V + P  +    +  +D   RLW
Sbjct: 156 SSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGE-VIATGSMDNTIRLW 213

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 256 LVTFHEHTDDILDIDWS-KNSFILTGSMDKSCKLWHCARPTSLKTF-VHSDFVTAVRFHP 313
           L TF  HT  ++ + ++ K + + T SMD+S K+W     + +KT   HS+ V +V   P
Sbjct: 89  LHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDV-P 147

Query: 314 EDDRFFLSA 322
            +D   LS+
Sbjct: 148 MNDSSILSS 156

>Kwal_33.13515
          Length = 398

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 302 HSDFVTAVRFHPEDDRFFLSACLDQKCRLW---SILEKQVIFEYDCGDLITAMDISYDGN 358
           H+  +T ++  P D+RF ++  LD  C  W   S+  ++VI  +D    I  +D+S DG 
Sbjct: 235 HTGAITCMKLDP-DNRFLVAGSLDTICSFWDLSSMCCERVINGFDTS--ILDLDLSRDGV 291

Query: 359 YTILGTFNGYIHVLITKSLELLFSFNVLDK 388
              L + N    + + +S   L+ F   +K
Sbjct: 292 AVGLCSDNQ-TRIYLIESGACLYEFESKNK 320

>Scas_558.3
          Length = 725

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 254 NPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLW-HCARPTSLKTFVHSDFVTAVRFH 312
           +PL T   H  ++  + +   S I++GS D + K+W + A   SL+   H   V   +  
Sbjct: 93  DPLYTLIGHHSNVCALSYKHMSAIISGSWDTTAKVWINGALQWSLEG--HQASVWDAKII 150

Query: 313 PEDDRFFLSACLDQKCRLW 331
             ++  F++A  D+  +LW
Sbjct: 151 SVEENTFITASADRTVKLW 169

>CAGL0G01628g complement(151262..152392) similar to sp|P53962
           Saccharomyces cerevisiae YNL035c, hypothetical start
          Length = 376

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 297 LKTFV--HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQ 337
           +++FV  H D +T++ FHP D    LS   D    ++ +LE +
Sbjct: 133 VRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPE 175

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 9/114 (7%)

Query: 272 SKNSFILTGSMDKSCKLWHCARPT-SLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRL 330
           +K + +   + DKSCK++   +    LK+F       ++ +HP ++  F   C D   + 
Sbjct: 260 TKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKH 319

Query: 331 WSILEKQVIFEYDCGDLITAMDISYDGNYTILG-TFNGYIHVLITKSLELLFSF 383
           + +L+       D G   +  DI Y  +  I   ++N   H+L + S +    F
Sbjct: 320 FDLLQ-------DTGSSNSFHDIPYAHDKCITSLSYNPVGHILASASKDRTIRF 366

>Kwal_23.5962
          Length = 552

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 46/107 (42%), Gaps = 26/107 (24%)

Query: 127 GAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTAN--AISQLN 184
           G +  I     G +MAT G D+ L+IW V      R     H+I  L +  +  AIS   
Sbjct: 274 GPITSIALDRQGYYMATTGADKSLKIWDV------RNFRELHTIENLPTPGSNLAIS--- 324

Query: 185 GQLAQYGGDTDSASLNSGSSNTHV----DSLGSSNANRDGFSTKAVP 227
                   DT   +L+ G    HV    D+L SS ++R  F +  +P
Sbjct: 325 --------DTGLLALSRGP---HVTIWKDALKSSKSSRPYFGSSGLP 360

>Kwal_27.12667
          Length = 721

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 5/82 (6%)

Query: 262 HTDDI--LDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDRF 318
           H D I  LD D    +    G +D S K+W+ ++ T +     H   V+ ++   ED   
Sbjct: 403 HDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQM--EDSHS 460

Query: 319 FLSACLDQKCRLWSILEKQVIF 340
            ++   D   +LW I + + ++
Sbjct: 461 LITGGRDALLKLWDIEKAEELY 482

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 11/121 (9%)

Query: 262 HTDDILDIDW-SKNSFILTGSMDKSCKLWHCARPTSLKTF-VHSDFVTAVRFHPEDDRFF 319
           HT  +L + + SK + + + SMD+S K+W     T LKT   HS+ V ++     D    
Sbjct: 96  HTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSIL 155

Query: 320 LSACLDQKCRLWSILE----KQVIFEYDCGD-----LITAMDISYDGNYTILGTFNGYIH 370
            S   D   R++        K + ++ D         I+ +  S +G Y ++ + +G + 
Sbjct: 156 SSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDGVLK 215

Query: 371 V 371
           +
Sbjct: 216 I 216

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 73/182 (40%), Gaps = 19/182 (10%)

Query: 127 GAVWCIRFSHD--GKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLN 184
           G VW + ++H   G  +A+   D  + IWK  +    ++ ++    + + S   A  +  
Sbjct: 54  GPVWRVDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNSVQWAPHEYG 113

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGH------R 238
             L     D   + +    + T    +  ++A     ++ A    + G   G       R
Sbjct: 114 ALLLAASSDGKVSVVEFKENGTATPLIFDAHAIGVNAASWAPATVEGGNNPGEAPKEVRR 173

Query: 239 HPYGLGDSYCGVFHPNP-----LV--TFHEHTDDILDIDWSKN----SFILTGSMDKSCK 287
              G  D+   ++  NP     LV  T   H+D + D+ WS +    S+I + S D++C 
Sbjct: 174 FVTGGADNLVKIWRYNPETQSYLVEDTLEGHSDWVRDVAWSPSVLLRSYIASVSQDRTCN 233

Query: 288 LW 289
           +W
Sbjct: 234 IW 235

>Scas_603.5
          Length = 589

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 16/70 (22%)

Query: 277 ILTGSMDKSCKLWH--CARPTSL----------KTF-VHSDFVTAVRFHPEDDRFFLSAC 323
           ++TGS D + KLW    A  TSL           TF  H+  +T+V +   D+ + LSA 
Sbjct: 352 LITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSY---DNEYLLSAS 408

Query: 324 LDQKCRLWSI 333
            D+  R W +
Sbjct: 409 RDKSIRQWDL 418

>Scas_720.45
          Length = 755

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 309 VRFHPEDDRFFLSACLDQKCRLWSI 333
           V F+P+D   F S CLD+  ++WS+
Sbjct: 3   VAFNPKDPNTFASGCLDRTVKVWSL 27

>Kwal_26.7570
          Length = 218

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 259 FHEHTDDILDIDWSKN-SFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRF----HP 313
           F  H  D+L +   +  S I++ S DK+ K+W+      +    H+D+V+ VR      P
Sbjct: 103 FVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNESP 162

Query: 314 EDDRF-FLSACLDQKCRL 330
           ED+    +SA +D+  ++
Sbjct: 163 EDETVTVISAGMDKVVKV 180

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/145 (20%), Positives = 65/145 (44%), Gaps = 11/145 (7%)

Query: 262 HTDDILDIDWS-KNSFILTGSMDKSCKLWHCARPTSLKTF-VHSDFVTAVRFHPEDDRFF 319
           HT  ++ + ++ K + + T SMD+S K+W     T +KT   HS+ V ++     D    
Sbjct: 95  HTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSIL 154

Query: 320 LSACLDQKCRLWSILEKQVI--------FEYDCGDL-ITAMDISYDGNYTILGTFNGYIH 370
            S   D   R++       +        ++ + G + I  +  S +  Y ++ +++G + 
Sbjct: 155 SSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYDGVVK 214

Query: 371 VLITKSLELLFSFNVLDKDSELKKC 395
           +  + S +++ +F   +K   L  C
Sbjct: 215 IWDSVSGDVVRTFKPSNKKYNLTHC 239

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 440 FLVS-SNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYC 497
            LVS S D  +RI+ +   +   V KGH+   S +     V      Y+V+GS D+ ++ 
Sbjct: 313 ILVSGSTDRSVRIWNIETGKCTHVFKGHT---STVRCLEVVEYGDSKYIVTGSRDNTLHV 369

Query: 498 WKL 500
           WKL
Sbjct: 370 WKL 372

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 431 ISSKDVSDWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSG 489
           ++ K  SD    +  D +IR Y +NQ   + ++ GH +    I+A +      +  V  G
Sbjct: 282 LAFKKNSDQLFAACADYKIRTYAINQFSQLEILYGHQDLVIDISALNM-----ERCVTVG 336

Query: 490 SEDHWIYCWKLSDE 503
           S D     WK++DE
Sbjct: 337 SRDRTAMLWKIADE 350

>ADL135C [1606] [Homologous to ScYGR225W (AMA1) - SH]
           (454165..454763,454821..456087) [1866 bp, 621 aa]
          Length = 621

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 40/103 (38%), Gaps = 7/103 (6%)

Query: 256 LVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCAR----PTSLKTFVHSDFVTAVR 310
           + TF   T  +  +D  +++ F+  G  D SC LW  ++    P  L    H   V AV 
Sbjct: 411 VYTFQSQTQQVCGLDICEDTGFVAVGGNDNSCSLWDISQASGPPKLLFQLPHFAAVKAVS 470

Query: 311 FHPEDDRFFLS--ACLDQKCRLWSILEKQVIFEYDCGDLITAM 351
           F P       +     D+  R W      ++ E      IT++
Sbjct: 471 FCPWSRSLLATGGGSKDRTIRFWHAPSGTLLKEIKTPGQITSL 513

>Scas_660.8
          Length = 510

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 296 SLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
           S+    H   VT  +FHP+D++  ++A  D+  RLW I
Sbjct: 119 SINASTHPTHVT--KFHPQDNKTLITASDDRVIRLWDI 154

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 251 FHPNPLVTFHEHTDDILDIDW---SKNSFILTGSMDKSCKLWHCARPTSLKTF 300
           F   P+  F EH  ++   +W   ++ +F L+ S D S K+W   R  SL T 
Sbjct: 92  FKEFPIAIFKEHEREVFSCNWNLVNRQNF-LSSSWDGSIKIWSPLRKQSLMTL 143

>Scas_465.4
          Length = 1002

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 276 FILTGSMDKSCKLWHCARPTSLKT-FVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSIL 334
           +I + S D+S KLW+      L T + H+  +  ++F   D +  +S   D  CR+W IL
Sbjct: 193 YITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQL-ISVSEDNTCRVWDIL 251

Query: 335 EKQ 337
           + +
Sbjct: 252 QDE 254

>Kwal_56.24596
          Length = 294

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 75/185 (40%), Gaps = 29/185 (15%)

Query: 127 GAVWCIRFSHD--GKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLN 184
           G VW + ++H   G  +A+   D  + IWK      E     Q ++  + S +  ++ + 
Sbjct: 54  GPVWQVDWAHPKFGVILASCSYDGKVLIWK-----EENGRWTQIAVHAVHSAS--VNSVQ 106

Query: 185 GQLAQYGGDTDSASLNSGSSNTHVDSLGSS-----NANRDGFSTK----AVPQEQQGQTQ 235
               +YG    +AS +   S       G++     +A+  G +T     A  Q      Q
Sbjct: 107 WAPHEYGPLLLAASSDGKVSVVEFKENGTTSPILVDAHSIGVNTASWASAALQGGAVSQQ 166

Query: 236 GHRHPYGLGDSYCGVFHPNPLV-------TFHEHTDDILDIDWSKN----SFILTGSMDK 284
             R   G  D+   V+  NP         T   HTD + D+ WS +    S++ + S D+
Sbjct: 167 MRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHTDWVRDVAWSPSVLLRSYLASVSQDR 226

Query: 285 SCKLW 289
           +C +W
Sbjct: 227 TCIIW 231

>Kwal_26.8776
          Length = 433

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 6/63 (9%)

Query: 439 WFLVSSNDSRIRIYTL-NQEFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYC 497
           WF   SND+ I+++ + + +    + GH      +T  S         + S SED  + C
Sbjct: 136 WFATGSNDTTIKVWDMASGKLKLTLTGHV-----MTVRSVAVSQRHPLMFSASEDKMVKC 190

Query: 498 WKL 500
           W L
Sbjct: 191 WDL 193

>Kwal_33.15591
          Length = 714

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 13/102 (12%)

Query: 260 HEHTDDILDIDWSKNSFILTGSMDKSCKLW-HCARPTSLKTFVHSDFVTAVRFHPEDDRF 318
           HE+   +L+   S   ++L+GS D + K+W   A    LK   H+  V  V+  PE   F
Sbjct: 104 HENNVCVLN---SSQGYVLSGSWDTTAKVWFQGALKHELKG--HTASVWDVKMLPEVG-F 157

Query: 319 FLSACLDQKCRLWSILEKQVIFEYDCG---DLITAMDISYDG 357
           +++A  D   +LW   E + + +   G   D+I  +DI   G
Sbjct: 158 YMTASADGTIKLW---EGEKVLKTFTGLHTDVIRHIDIDASG 196

>Kwal_27.12239
          Length = 316

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 262 HTDDILDIDWS-KNSFILTGSMDKSCKLWHCARPTSLKTF-VHSDFVTAVRFHPEDDRFF 319
           HT  +  + ++ K + + + SMD+S K+W     T L+T   HS+ V ++   P D    
Sbjct: 98  HTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFDPSIL 157

Query: 320 LSACLDQKCRLW 331
            S   D   R++
Sbjct: 158 SSGSYDGLIRIF 169

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 302 HSDFVTAVRFHPEDDRFFLSACLDQKCRLW 331
           HS  +T +RF P D ++ LS C D+K  +W
Sbjct: 610 HSLTITRLRFSP-DSKYLLSVCRDRKWAVW 638

>YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member of
           the M20, M25, or M40 peptidase family of zinc
           metalloproteases, contains five WD domains (WD-40
           repeat), which may mediate protein-protein
           interactionshas a region of moderate similarity to
           uncharacterized C. albicans Orf6.3557p [2637 bp, 878 aa]
          Length = 878

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 20/39 (51%)

Query: 117 GTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKV 155
           G + E      +V C+  S D  F+ + G D ++RIW +
Sbjct: 61  GESQEETHTRSSVLCLTGSEDENFLFSGGADSLVRIWSI 99

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 66/174 (37%), Gaps = 42/174 (24%)

Query: 131 CIRFSHDGKFMATAGK-DEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLAQ 189
           C+ F      + TAG  D  ++IW +                   S  N I +L G LA 
Sbjct: 403 CLDFDAPFGTLCTAGYLDHTVKIWDL-------------------SKQNKIGELAGHLAT 443

Query: 190 YGG---DTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGLGDS 246
                 + D  +L +G  +    +L   N N        + Q+   +TQ    P    DS
Sbjct: 444 INCMQINRDYGTLVTGGRDA---ALKLWNLN--------LAQQLYQETQNLTSPTNHIDS 492

Query: 247 YCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTF 300
            C       + TF  HTD++  +     SF+++GS D++ + W       L+T 
Sbjct: 493 PC-------VHTFEAHTDEVTALSLDP-SFLVSGSQDRTIRQWDLRSGKCLQTI 538

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 440 FLVS-SNDSRIRIYTLNQEFVS-VMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWIYC 497
            LVS S D  +R++ + +   + V KGH   +S +     V      Y+V+GS D+ ++ 
Sbjct: 435 ILVSGSTDRTVRVWDIKKGCCTHVFKGH---NSTVRCLDIVEYKNIKYIVTGSRDNTLHV 491

Query: 498 WKLSDE 503
           WKL  E
Sbjct: 492 WKLPKE 497

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%)

Query: 254 NPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKT 299
           NP   F+ H+  I    W  +  I++ SMD S ++W  A  +++ +
Sbjct: 356 NPSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVAS 401

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 88/219 (40%), Gaps = 40/219 (18%)

Query: 131 CIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQLAQY 190
           C+ ++  G+ + T  +   LR+W V       L  ++  I  +K  ++    L       
Sbjct: 199 CLEWAPAGQSLLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLT------ 252

Query: 191 GGDTDSASLN----SGSSNTHV--------DSLG--SSNANRDGFSTKAVPQEQQGQTQG 236
             D D+ ++     SG++  H         +SLG  ++  ++D F+   +        QG
Sbjct: 253 -CDADNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGI--------QG 303

Query: 237 HRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSK-NSFILTGSMDKSCKLWHCARPT 295
               + +G S        P+     H+  +  I +++ N  +L+ S D + ++W      
Sbjct: 304 SILVFNIGIS-------KPIGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLN 356

Query: 296 SLKTFV-HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333
               F  HS  +T+   H  DD   +S  +D   R+WS+
Sbjct: 357 PSHVFYGHSQSITSA--HWVDDDTIISTSMDGSIRVWSL 393

>YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component of
           U3 snoRNP (also called small subunit processome) which
           is required for 18S rRNA biogenesis, required for
           pre-rRNA processing [1722 bp, 573 aa]
          Length = 573

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 6/68 (8%)

Query: 437 SDWFLVSSNDSRIRIYTLNQ-EFVSVMKGHSNEHSQITAHSTVTRSGKAYVVSGSEDHWI 495
           SD    S  D +IR Y++NQ   + ++ GH +    I+A +      +  V  G+ D   
Sbjct: 292 SDQLYASCADFKIRTYSINQFSQLEILYGHHDIVEDISALAM-----ERCVTVGARDRTA 346

Query: 496 YCWKLSDE 503
             WK+ DE
Sbjct: 347 MLWKIPDE 354

>ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887)
           [1212 bp, 403 aa]
          Length = 403

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 293 RPTSLKTFV--HSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQ 337
           RP  L+ FV  H D VT V+FHP D    LS   D    ++ + + +
Sbjct: 137 RP--LRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 10/78 (12%)

Query: 262 HTDDILDIDW-SKNSFILTGSMDKSCKLW-----HCARPTSLKTFVHSDFVTAVRFHPED 315
           H  D+   DW  +   I + S D   KLW     +C   +S+  F H+  V   RF P  
Sbjct: 218 HHWDVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCI--SSILKFKHT--VLKTRFQPTK 273

Query: 316 DRFFLSACLDQKCRLWSI 333
               ++   D+ CR++ I
Sbjct: 274 GNLLMAISKDKSCRVFDI 291

>Kwal_56.23035
          Length = 424

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/56 (23%), Positives = 28/56 (50%)

Query: 301 VHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDISYD 356
           +H+  +T+V+++  D+  F +   D K ++W     +V    D G  +  +D+  D
Sbjct: 140 MHAFSITSVQWYGADNGLFFTGSNDHKVKVWDTNAFEVASTIDVGHRVVQLDVQGD 195

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 52/135 (38%), Gaps = 24/135 (17%)

Query: 256 LVTFHEHTDDILDIDWSKNS-FILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPE 314
           L T   H   I  ID  +++ + +TGS D S K+W     +   ++     V  V F P 
Sbjct: 45  LGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDGSIAHSWDTRTPVRRVEFSPT 104

Query: 315 DDRFFLSACLD--------------------QKCRLWSILEKQVIFEYDCGDLITAMDIS 354
            DR    A LD                    Q     S L  +++ +  C  ++ A   S
Sbjct: 105 GDRVL--AVLDNVMNYAGAIVVFSVTRDANNQITGFNSGLSCEILTQEGCAPVLVA-SWS 161

Query: 355 YDGNYTILGTFNGYI 369
           YDG Y + G  +G I
Sbjct: 162 YDGKYIVAGHQDGKI 176

>AEL098W [2408] [Homologous to ScYNL277W (MET2) - NSH]
           complement(441496..442959) [1464 bp, 487 aa]
          Length = 487

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 5/59 (8%)

Query: 722 LNRLNAIEKQLKENGEGSVKPRTSGVSSVAAATNGSLSTATTFVGNGSNGHNVHSIERP 780
           L++L+A+  +LKEN  GS+    +G S+V     G+L+      GN  +G+ ++S E P
Sbjct: 29  LDKLDALTAKLKENRIGSI----NGGSTV-GDFYGTLADNEPVYGNVKSGYQLYSCEEP 82

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 103 FGNEFQDSSSSNEKGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAER 162
           +G +  D S   E     E  +N   V  + +SHDG ++AT  +D+ + IW+     +E 
Sbjct: 83  WGRDDDDYSGETELLAVIEGHEN--EVKSVAWSHDGAYLATCSRDKSVWIWEA-DELSEE 139

Query: 163 LELN 166
            E N
Sbjct: 140 FECN 143

>Kwal_14.884
          Length = 395

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 24/97 (24%)

Query: 426 ARNYKISSKDVSDWFLVS-SNDSRIRIYTLNQ--EFVSVMKGHSNEHSQITAHS------ 476
           A +  +   D+S  +LVS SND  IRIY L +  E  +++    +    ITA        
Sbjct: 39  AHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLL----SHQGSITALKFSKGTK 94

Query: 477 -----------TVTRSGKAYVVSGSEDHWIYCWKLSD 502
                      T  R    +++S S+DH +  W++ D
Sbjct: 95  IEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKD 131

>Scas_719.7*
          Length = 1333

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 271 WSKNSFILTGSMDKSCKLWHCARPT-SLKTFVHSDFVTAVRFHPEDD 316
           W+ NS IL   ++ S +LW        LK  V+S  +  V++HPE D
Sbjct: 345 WNSNSEILAIVLNNSIQLWTVKNYHWYLKQEVYSQDIQFVKWHPEKD 391

>Scas_679.28
          Length = 815

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 14/71 (19%)

Query: 276 FILTGSMDKSCKLWHCARPTS-------------LKTFVHSDFVTAVRFHPEDDRFFLSA 322
           F+LT S D + K W   +P++                  H   + A+   P +D  F +A
Sbjct: 451 FLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISP-NDSIFATA 509

Query: 323 CLDQKCRLWSI 333
             D+ C++W +
Sbjct: 510 SYDKTCKIWDL 520

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,427,199
Number of extensions: 1200106
Number of successful extensions: 5905
Number of sequences better than 10.0: 233
Number of HSP's gapped: 5821
Number of HSP's successfully gapped: 372
Length of query: 840
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 730
Effective length of database: 12,788,129
Effective search space: 9335334170
Effective search space used: 9335334170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)