Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B12716g71670533720.0
ABL028W72255323790.0
Scas_721.12468456123510.0
Kwal_26.763569173022880.0
CAGL0K03399g70355422710.0
Scas_717.6967456422660.0
CAGL0K07458g70456519000.0
Kwal_47.167617443909311e-115
ADL389W7113919091e-112
Scas_703.57493679081e-111
CAGL0F09075g7464089071e-111
YHR205W (SCH9)8243699061e-110
KLLA0B03586g7343668971e-110
KLLA0B07205g4552927063e-85
YJL164C (TPK1)3972926989e-85
CAGL0M08404g4623046993e-84
Kwal_56.240593533016842e-83
Scas_651.183712956836e-83
Scas_689.25*4092956867e-83
CAGL0G09020g3612956819e-83
Kwal_33.138463752956801e-82
KLLA0E06413g11613287131e-80
CAGL0M09361g11443287121e-80
ACR191C11493357112e-80
AFL090W3462956605e-80
KLLA0D03190g3723016611e-79
Kwal_27.1058111543307032e-79
Scas_715.3411503337014e-79
Scas_690.133543016538e-79
YBL105C (PKC1)11513356901e-77
AEL115C3863016402e-76
Kwal_56.227885153905767e-66
YCR091W (KIN82)7203135827e-65
Kwal_23.64588683195871e-64
CAGL0J06072g7733945785e-64
Scas_629.169183025792e-63
CAGL0C03509g8953195783e-63
KLLA0F24618g5563525473e-61
ADR167W8733135562e-60
KLLA0C18568g7743025495e-60
YBR028C5253605303e-59
AEL083W5363465313e-59
Scas_720.1038043545373e-58
CAGL0B04301g5423645235e-58
Scas_593.14d4953035127e-57
CAGL0E05720g3582684501e-49
KLLA0B02332g3612744412e-48
AFL101C3672684395e-48
Kwal_56.240913812694221e-45
Scas_705.235533954312e-45
CAGL0B04147g5663534224e-44
KLLA0E03487g6472764212e-43
YGR092W (DBF2)5723424182e-43
CAGL0G03047g5393524127e-43
Kwal_23.39925713444121e-42
YDR490C (PKH1)7662814111e-41
Scas_627.73492673902e-41
KLLA0C12485g9252974075e-41
Kwal_56.226939842734023e-40
Scas_660.209572824004e-40
Scas_716.335733433925e-40
YDR466W (PKH3)8983023988e-40
KLLA0D14905g5673513872e-39
AFR377C7262773895e-39
KLLA0D07810g7181483895e-39
ADR033W5773513821e-38
Kwal_33.145547141483861e-38
AFR035W7191473852e-38
KLLA0F13552g12672713882e-38
AFR335C10332763854e-38
CAGL0G04609g9653073836e-38
ABL034W14252733847e-38
CAGL0I07513g10762773837e-38
Scas_654.127371483762e-37
Kwal_47.183076212713698e-37
Kwal_26.778812672763731e-36
KLLA0F11319g8432613658e-36
CAGL0J03872g6612973628e-36
Kwal_26.87098292783641e-35
Scas_616.1014613323623e-35
Scas_502.211162683596e-35
YDL101C (DUN1)5132903507e-35
CAGL0J11638g7462783569e-35
AAR009W4532513451e-34
ACL006W7082393532e-34
Scas_644.157262393504e-34
CAGL0M08910g6122773475e-34
Kwal_47.182335983183458e-34
CAGL0K06479g9913053462e-33
CAGL0M02519g7563143442e-33
KLLA0C06138g7082463433e-33
Scas_693.1710493393463e-33
Scas_700.348642693443e-33
YDR477W (SNF1)6332503413e-33
AEL230W6082503404e-33
CAGL0L07326g5062913356e-33
KLLA0A03806g6022773386e-33
CAGL0K08514g14892103436e-33
Scas_660.286232473389e-33
Kwal_0.964272523291e-32
AFR696C11422773401e-32
KLLA0F11143g8132713382e-32
KLLA0E01584g4152813272e-32
KLLA0F23155g4272743263e-32
ACR142W8372863355e-32
Kwal_56.224766973203326e-32
Kwal_26.87967962703337e-32
Kwal_33.131125052673269e-32
AGR058W10713333331e-31
Scas_618.84272523221e-31
CAGL0K05709g11032863331e-31
CAGL0M02233g7672913292e-31
Scas_564.712103253303e-31
Scas_700.546983363221e-30
KLLA0C01650g11122843222e-30
Scas_613.55173113143e-30
Scas_640.14*7282823183e-30
CAGL0B01925g9442823194e-30
Scas_493.211172863195e-30
AFR724C4402713096e-30
KLLA0F19536g11042723187e-30
AFL188C4722663099e-30
ACR133C8512613132e-29
YDR507C (GIN4)11422833142e-29
CAGL0L11550g10722463132e-29
CAGL0M11396g11922903133e-29
CAGL0F04741g4422573034e-29
YFR014C (CMK1)4462473025e-29
Kwal_23.35904992823046e-29
YJL128C (PBS2)6683093051e-28
YDR122W (KIN1)10642733081e-28
KLLA0F09020g9281693071e-28
Scas_700.288962633043e-28
CAGL0K10604g4462462964e-28
YHR102W (KIC1)10802463044e-28
ACR119W9312663034e-28
YCL024W (KCC4)10372833035e-28
CAGL0K12562g16821553035e-28
Kwal_47.172528722993016e-28
YFL033C (RIM15)17701603001e-27
KLLA0D07348g9092502982e-27
Scas_707.369153262982e-27
ACR218W15691602982e-27
ACL104C9472452972e-27
CAGL0M02299g8932612954e-27
Kwal_14.115915211632955e-27
CAGL0L05632g6773092926e-27
Scas_580.610152462902e-26
YDR523C (SPS1)4902462832e-26
Scas_201.1*2742182723e-26
AER223C9022452873e-26
KLLA0C04191g7972302846e-26
YGL158W (RCK1)5123222807e-26
Kwal_26.87518482982821e-25
CAGL0I09504g5282842781e-25
KLLA0E21780g10162452821e-25
CAGL0F00649g5143242771e-25
YGL180W (ATG1)8973612812e-25
Kwal_27.97638682222802e-25
Scas_582.16382832792e-25
Scas_707.315981602803e-25
Scas_685.245152672744e-25
Kwal_55.215458652452775e-25
CAGL0L06006g9422902768e-25
YAR019C (CDC15)9742582759e-25
Kwal_0.1555873202721e-24
AFL217C6913082722e-24
Kwal_56.237178582322732e-24
KLLA0C08525g15512542742e-24
KLLA0F09031g6331492712e-24
KLLA0C17160g8313002722e-24
KLLA0C00979g4832652672e-24
Scas_713.79832432713e-24
Scas_673.20*7582522703e-24
ACL054W9722902704e-24
CAGL0M03729g8612042694e-24
Kwal_26.735514463652714e-24
Scas_573.105693332656e-24
CAGL0C05005g10762482687e-24
AEL205W7932202669e-24
KLLA0A07403g8792042661e-23
Kwal_33.140815803082631e-23
YHL007C (STE20)9392702652e-23
CAGL0K02167g11623352652e-23
CAGL0H01639g5212482612e-23
KLLA0E15378g7243082623e-23
CAGL0M10153g8672762623e-23
Scas_711.2515152662625e-23
AER264C14832522591e-22
Scas_598.67903032562e-22
Kwal_23.52908192042562e-22
Kwal_27.97734062852502e-22
CAGL0B03509g5973132542e-22
Scas_675.25272772522e-22
Kwal_23.632515422562553e-22
CAGL0K02673g9152052543e-22
KLLA0D07304g4652072503e-22
Scas_668.228932422526e-22
KLLA0F12188g5463302496e-22
AFR092W14232662519e-22
KLLA0F23507g4872252469e-22
ACR117W5242142461e-21
YJL095W (BCK1)14782672492e-21
AER222C4233182403e-21
KLLA0B13607g9892112454e-21
CAGL0J00539g4883032414e-21
Kwal_26.78619552052454e-21
Kwal_26.87034442052395e-21
CAGL0L03520g14474002438e-21
Scas_618.156203482418e-21
Scas_707.349053122421e-20
Kwal_47.1726311273312411e-20
Scas_713.216413822391e-20
AAL029W5343242372e-20
YBR274W (CHK1)5272132372e-20
Scas_720.9416832682412e-20
ABR014W9712002402e-20
YCR073C (SSK22)13312612402e-20
CAGL0M11748g4473372333e-20
KLLA0F01276g5192142353e-20
CAGL0J03828g4672142325e-20
Kwal_56.238414323372306e-20
Kwal_55.203267502292347e-20
KLLA0F14190g13382672357e-20
CAGL0I04422g4222832281e-19
ACL053C11813672341e-19
AFR205C4573132281e-19
YGL179C (TOS3)5602602292e-19
YER129W (PAK1)11423422312e-19
Kwal_55.220013633042242e-19
Scas_640.165052852282e-19
CAGL0D02244g4872422263e-19
Scas_713.384323372244e-19
KLLA0A02497g3622282205e-19
ADR379C4922382246e-19
Scas_633.297892922241e-18
Scas_619.5*5102972221e-18
CAGL0B02739g6762242241e-18
KLLA0F20053g4443342201e-18
KLLA0B13112g7302302231e-18
KLLA0C04213g3943052191e-18
AEL284C4792372202e-18
ACL191C3652232162e-18
CAGL0I03498g4513132182e-18
CAGL0K01617g7743072213e-18
ADL168C3623042153e-18
Scas_700.354392042173e-18
Kwal_33.132221481122013e-18
YHR030C (SLT2)4843122183e-18
AGR048C4533342174e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B12716g
         (705 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...  1303   0.0  
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   920   0.0  
Scas_721.124                                                          910   0.0  
Kwal_26.7635                                                          885   0.0  
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   879   0.0  
Scas_717.69                                                           877   0.0  
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   736   0.0  
Kwal_47.16761                                                         363   e-115
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   354   e-112
Scas_703.5                                                            354   e-111
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   353   e-111
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   353   e-110
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   350   e-110
KLLA0B07205g complement(624606..625973) some similarities with s...   276   3e-85
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...   273   9e-85
CAGL0M08404g complement(836791..838179) some similarities with s...   273   3e-84
Kwal_56.24059                                                         268   2e-83
Scas_651.18                                                           267   6e-83
Scas_689.25*                                                          268   7e-83
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   266   9e-83
Kwal_33.13846                                                         266   1e-82
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   279   1e-80
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   278   1e-80
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   278   2e-80
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   258   5e-80
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   259   1e-79
Kwal_27.10581                                                         275   2e-79
Scas_715.34                                                           274   4e-79
Scas_690.13                                                           256   8e-79
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   270   1e-77
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   251   2e-76
Kwal_56.22788                                                         226   7e-66
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   228   7e-65
Kwal_23.6458                                                          230   1e-64
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   227   5e-64
Scas_629.16                                                           227   2e-63
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   227   3e-63
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   215   3e-61
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   218   2e-60
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   216   5e-60
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   208   3e-59
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   209   3e-59
Scas_720.103                                                          211   3e-58
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   206   5e-58
Scas_593.14d                                                          201   7e-57
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...   177   1e-49
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...   174   2e-48
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...   173   5e-48
Kwal_56.24091                                                         167   1e-45
Scas_705.23                                                           170   2e-45
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   167   4e-44
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   166   2e-43
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   165   2e-43
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   163   7e-43
Kwal_23.3992                                                          163   1e-42
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   162   1e-41
Scas_627.7                                                            154   2e-41
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   161   5e-41
Kwal_56.22693                                                         159   3e-40
Scas_660.20                                                           158   4e-40
Scas_716.33                                                           155   5e-40
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   157   8e-40
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   153   2e-39
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   154   5e-39
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   154   5e-39
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   151   1e-38
Kwal_33.14554                                                         153   1e-38
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   152   2e-38
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...   154   2e-38
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   152   4e-38
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   152   6e-38
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   152   7e-38
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   152   7e-38
Scas_654.12                                                           149   2e-37
Kwal_47.18307                                                         146   8e-37
Kwal_26.7788                                                          148   1e-36
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...   145   8e-36
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...   144   8e-36
Kwal_26.8709                                                          144   1e-35
Scas_616.10                                                           144   3e-35
Scas_502.2                                                            142   6e-35
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...   139   7e-35
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   141   9e-35
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...   137   1e-34
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...   140   2e-34
Scas_644.15                                                           139   4e-34
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   138   5e-34
Kwal_47.18233                                                         137   8e-34
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   137   2e-33
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...   137   2e-33
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   136   3e-33
Scas_693.17                                                           137   3e-33
Scas_700.34                                                           137   3e-33
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   135   3e-33
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   135   4e-33
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...   133   6e-33
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   134   6e-33
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   136   6e-33
Scas_660.28                                                           134   9e-33
Kwal_0.96                                                             131   1e-32
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   135   1e-32
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   134   2e-32
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...   130   2e-32
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...   130   3e-32
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...   133   5e-32
Kwal_56.22476                                                         132   6e-32
Kwal_26.8796                                                          132   7e-32
Kwal_33.13112                                                         130   9e-32
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...   132   1e-31
Scas_618.8                                                            128   1e-31
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   132   1e-31
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...   131   2e-31
Scas_564.7                                                            131   3e-31
Scas_700.54                                                           128   1e-30
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   128   2e-30
Scas_613.5                                                            125   3e-30
Scas_640.14*                                                          127   3e-30
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...   127   4e-30
Scas_493.2                                                            127   5e-30
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...   123   6e-30
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...   127   7e-30
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...   123   9e-30
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...   125   2e-29
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   125   2e-29
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...   125   2e-29
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...   125   3e-29
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...   121   4e-29
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...   120   5e-29
Kwal_23.3590                                                          121   6e-29
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...   122   1e-28
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...   123   1e-28
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   122   1e-28
Scas_700.28                                                           121   3e-28
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...   118   4e-28
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...   121   4e-28
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...   121   4e-28
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   121   5e-28
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   121   5e-28
Kwal_47.17252                                                         120   6e-28
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   120   1e-27
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...   119   2e-27
Scas_707.36                                                           119   2e-27
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...   119   2e-27
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...   119   2e-27
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...   118   4e-27
Kwal_14.1159                                                          118   5e-27
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...   117   6e-27
Scas_580.6                                                            116   2e-26
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...   113   2e-26
Scas_201.1*                                                           109   3e-26
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....   115   3e-26
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...   114   6e-26
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...   112   7e-26
Kwal_26.8751                                                          113   1e-25
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...   111   1e-25
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...   113   1e-25
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...   111   1e-25
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...   112   2e-25
Kwal_27.9763                                                          112   2e-25
Scas_582.1                                                            112   2e-25
Scas_707.3                                                            112   3e-25
Scas_685.24                                                           110   4e-25
Kwal_55.21545                                                         111   5e-25
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...   110   8e-25
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...   110   9e-25
Kwal_0.155                                                            109   1e-24
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...   109   2e-24
Kwal_56.23717                                                         109   2e-24
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...   110   2e-24
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...   108   2e-24
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...   109   2e-24
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...   107   2e-24
Scas_713.7                                                            108   3e-24
Scas_673.20*                                                          108   3e-24
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...   108   4e-24
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...   108   4e-24
Kwal_26.7355                                                          108   4e-24
Scas_573.10                                                           106   6e-24
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...   107   7e-24
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...   107   9e-24
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...   107   1e-23
Kwal_33.14081                                                         105   1e-23
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...   106   2e-23
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...   106   2e-23
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...   105   2e-23
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...   105   3e-23
CAGL0M10153g complement(1010688..1013291) some similarities with...   105   3e-23
Scas_711.25                                                           105   5e-23
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...   104   1e-22
Scas_598.6                                                            103   2e-22
Kwal_23.5290                                                          103   2e-22
Kwal_27.9773                                                          100   2e-22
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...   102   2e-22
Scas_675.2                                                            101   2e-22
Kwal_23.6325                                                          102   3e-22
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...   102   3e-22
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...   100   3e-22
Scas_668.22                                                           101   6e-22
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...   100   6e-22
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...   101   9e-22
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    99   9e-22
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    99   1e-21
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...   100   2e-21
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    97   3e-21
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    99   4e-21
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    97   4e-21
Kwal_26.7861                                                           99   4e-21
Kwal_26.8703                                                           97   5e-21
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    98   8e-21
Scas_618.15                                                            97   8e-21
Scas_707.34                                                            98   1e-20
Kwal_47.17263                                                          97   1e-20
Scas_713.21                                                            97   1e-20
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    96   2e-20
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    96   2e-20
Scas_720.94                                                            97   2e-20
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    97   2e-20
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    97   2e-20
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    94   3e-20
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    95   3e-20
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    94   5e-20
Kwal_56.23841                                                          93   6e-20
Kwal_55.20326                                                          95   7e-20
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    95   7e-20
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    92   1e-19
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    95   1e-19
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    92   1e-19
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    93   2e-19
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    94   2e-19
Kwal_55.22001                                                          91   2e-19
Scas_640.16                                                            92   2e-19
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    92   3e-19
Scas_713.38                                                            91   4e-19
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    89   5e-19
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    91   6e-19
Scas_633.29                                                            91   1e-18
Scas_619.5*                                                            90   1e-18
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    91   1e-18
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    89   1e-18
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    91   1e-18
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    89   1e-18
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    89   2e-18
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    88   2e-18
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    89   2e-18
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    90   3e-18
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    87   3e-18
Scas_700.35                                                            88   3e-18
Kwal_33.13222                                                          82   3e-18
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    89   3e-18
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    88   4e-18
Scas_683.6                                                             87   4e-18
KLLA0D09328g complement(788565..791705) some similarities with s...    89   4e-18
Scas_623.11                                                            87   4e-18
Scas_680.20                                                            88   5e-18
Kwal_23.5576                                                           88   5e-18
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    88   7e-18
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    85   7e-18
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    87   9e-18
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    87   9e-18
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    87   1e-17
Scas_688.14                                                            87   1e-17
Scas_716.73                                                            86   1e-17
Kwal_27.12559                                                          86   1e-17
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    86   1e-17
Kwal_33.14167                                                          87   2e-17
Scas_602.11                                                            87   2e-17
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    86   2e-17
KLLA0E11979g complement(1060048..1061892) some similarities with...    87   2e-17
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    87   2e-17
Scas_721.132                                                           86   2e-17
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    87   2e-17
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    87   3e-17
Scas_651.3                                                             86   3e-17
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    84   3e-17
Kwal_0.307                                                             86   3e-17
Scas_643.20                                                            86   4e-17
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    86   4e-17
Kwal_14.1416                                                           84   6e-17
Scas_568.9*                                                            82   6e-17
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    82   7e-17
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    85   7e-17
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    85   9e-17
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    84   9e-17
Scas_548.6                                                             85   1e-16
Kwal_14.2497                                                           83   1e-16
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    84   1e-16
Scas_477.5                                                             84   1e-16
Kwal_26.7552                                                           84   1e-16
Scas_628.9                                                             84   1e-16
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    82   2e-16
Kwal_26.8347                                                           83   2e-16
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    83   2e-16
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    80   3e-16
Scas_710.28                                                            81   3e-16
Scas_544.6                                                             82   3e-16
Scas_667.18                                                            82   4e-16
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    82   5e-16
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    80   5e-16
Kwal_47.17868                                                          80   5e-16
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    82   6e-16
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    82   6e-16
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    81   6e-16
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    80   1e-15
Kwal_23.4276                                                           80   1e-15
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    79   1e-15
Scas_721.110                                                           80   1e-15
Kwal_23.5668                                                           81   2e-15
Scas_336.1                                                             80   2e-15
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    80   2e-15
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    80   2e-15
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    80   3e-15
Kwal_33.13831                                                          80   3e-15
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    80   3e-15
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    80   3e-15
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    79   3e-15
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    80   3e-15
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    79   3e-15
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    80   3e-15
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    78   4e-15
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    78   4e-15
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    77   4e-15
Scas_634.5                                                             79   4e-15
Kwal_27.11803                                                          75   5e-15
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    79   6e-15
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    79   6e-15
Scas_613.13*                                                           77   6e-15
Kwal_26.7154                                                           79   7e-15
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    79   8e-15
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    77   1e-14
Kwal_33.13984                                                          78   1e-14
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    76   1e-14
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    75   2e-14
Scas_635.1                                                             76   2e-14
Scas_721.46                                                            75   2e-14
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    75   3e-14
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    75   3e-14
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    77   3e-14
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    74   4e-14
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    75   4e-14
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    74   4e-14
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    76   5e-14
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    74   5e-14
Kwal_17.2687                                                           74   5e-14
Kwal_26.7682                                                           75   7e-14
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    75   7e-14
Scas_678.13                                                            75   8e-14
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    75   9e-14
Kwal_14.1273                                                           74   1e-13
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    75   1e-13
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    74   1e-13
Scas_678.24                                                            75   2e-13
Kwal_56.24584                                                          73   2e-13
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    73   3e-13
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    72   3e-13
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    74   3e-13
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    71   3e-13
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    71   4e-13
Kwal_27.11919                                                          69   6e-13
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    70   1e-12
KLLA0C16577g complement(1451181..1452695) some similarities with...    70   2e-12
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    71   2e-12
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    69   5e-12
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    69   7e-12
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    69   8e-12
Scas_651.19                                                            69   8e-12
Scas_684.28                                                            69   8e-12
Kwal_27.10004                                                          69   9e-12
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    68   1e-11
Kwal_33.13681                                                          68   2e-11
Kwal_23.3471                                                           65   2e-11
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    67   2e-11
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    67   3e-11
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    66   4e-11
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    65   1e-10
Scas_689.24                                                            65   1e-10
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    64   3e-10
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    62   4e-10
KLLA0A06820g complement(615686..618004) some similarities with s...    64   4e-10
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    64   4e-10
Scas_649.30                                                            63   4e-10
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    63   5e-10
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    63   6e-10
Scas_718.90                                                            63   6e-10
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    63   7e-10
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    62   8e-10
Scas_683.12                                                            61   9e-10
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    60   1e-09
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    62   2e-09
Scas_695.33                                                            61   2e-09
Kwal_26.7276                                                           61   2e-09
Scas_22.1                                                              59   2e-09
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    60   2e-09
Scas_673.34*                                                           61   3e-09
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    60   3e-09
KLLA0C03938g complement(358851..360632) some similarities with s...    60   3e-09
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    60   4e-09
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    60   4e-09
Kwal_27.11830                                                          60   4e-09
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    59   5e-09
Scas_653.25                                                            60   6e-09
Scas_610.7                                                             59   7e-09
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    59   7e-09
Scas_711.15                                                            59   8e-09
Scas_568.13                                                            59   8e-09
Kwal_33.14434                                                          59   9e-09
Scas_654.17                                                            59   1e-08
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    58   1e-08
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    58   1e-08
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    58   1e-08
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    59   1e-08
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    58   2e-08
Scas_671.16                                                            58   2e-08
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    58   2e-08
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    58   2e-08
CAGL0M08360g complement(833220..835520) some similarities with s...    58   2e-08
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    58   3e-08
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    57   3e-08
Scas_704.50                                                            57   3e-08
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    57   3e-08
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    57   3e-08
Kwal_47.18098                                                          57   3e-08
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    57   3e-08
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    57   3e-08
KLLA0F22297g complement(2083448..2085547) some similarities with...    57   3e-08
Kwal_55.21900                                                          57   5e-08
Scas_697.12                                                            56   5e-08
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    56   6e-08
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    55   7e-08
Scas_677.18                                                            56   7e-08
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    56   8e-08
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    56   1e-07
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    55   1e-07
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    55   1e-07
Scas_707.7                                                             55   1e-07
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    55   1e-07
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    55   1e-07
KLLA0B06501g complement(576636..579089) some similarities with s...    55   2e-07
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    55   2e-07
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    55   2e-07
Kwal_27.11777                                                          54   2e-07
Kwal_33.14596                                                          55   2e-07
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    55   2e-07
Kwal_33.14192                                                          54   2e-07
Kwal_55.20189                                                          55   2e-07
Scas_689.22                                                            55   2e-07
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    54   3e-07
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    54   3e-07
Kwal_47.17345                                                          54   3e-07
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    54   4e-07
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    53   5e-07
CAGL0K01661g complement(146952..148400) some similarities with t...    53   5e-07
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    54   5e-07
Kwal_27.11542                                                          53   6e-07
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    53   6e-07
Scas_601.6                                                             53   6e-07
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    52   6e-07
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    53   7e-07
Scas_648.17                                                            52   9e-07
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    52   9e-07
Scas_655.2                                                             52   1e-06
CAGL0K11990g complement(1155395..1158370) some similarities with...    52   1e-06
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    51   1e-06
Scas_703.47                                                            52   1e-06
Scas_584.11                                                            52   2e-06
Kwal_14.1249                                                           51   2e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    52   2e-06
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    51   2e-06
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    51   2e-06
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    51   2e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    51   3e-06
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    50   3e-06
Scas_698.37                                                            50   4e-06
Kwal_56.24274                                                          50   4e-06
Kwal_55.20221                                                          51   4e-06
Kwal_55.21709                                                          50   4e-06
Kwal_33.15381                                                          50   5e-06
Kwal_27.10945                                                          50   6e-06
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    50   6e-06
Scas_661.27                                                            50   7e-06
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    49   8e-06
Kwal_26.8941                                                           49   8e-06
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    49   1e-05
KLLA0F22605g complement(2109034..2111913) similar to sp|P41695 S...    49   1e-05
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    49   1e-05
CAGL0H08437g complement(825191..829423) similar to sp|P22219 Sac...    49   1e-05
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    48   1e-05
Kwal_14.2554                                                           49   1e-05
AGR315C [4626] [Homologous to ScYGR188C (BUB1) - SH; ScYJL013C (...    49   2e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    49   2e-05
Scas_458.1                                                             48   2e-05
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    48   2e-05
Scas_721.61                                                            48   2e-05
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    48   2e-05
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...    47   3e-05
KLLA0D12100g complement(1031728..1033161) some similarities with...    47   3e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    47   3e-05
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    47   3e-05
Kwal_33.13225                                                          47   5e-05
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    47   7e-05
CAGL0I08899g complement(863636..866431) similar to sp|P41695 Sac...    47   7e-05

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 1303 bits (3372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/705 (91%), Positives = 644/705 (91%)

Query: 1   MYSWKLSSKFRFGRSXXXXXXXXXXXXXXXIDGNDNRSSVDRKATIVPGSATVVQXXXXX 60
           MYSWKLSSKFRFGRS               IDGNDNRSSVDRKATIVPGSATVVQ     
Sbjct: 1   MYSWKLSSKFRFGRSKDKDEKHHKHMDEVDIDGNDNRSSVDRKATIVPGSATVVQSRAST 60

Query: 61  XXXXXXXXXGHSVHSSGFKGTITEGSMSTDISGEDISMTNGRDRDSTEVQXXXXXXXXXF 120
                    GHSVHSSGFKGTITEGSMSTDISGEDISMTNGRDRDSTEVQ         F
Sbjct: 61  DTRTTSDDTGHSVHSSGFKGTITEGSMSTDISGEDISMTNGRDRDSTEVQSKSNNNSSNF 120

Query: 121 KXXXXXXXXXXXXXXXXXXXXXXXPVENENTHSSNGILTVKVYSGDSFKLPLPITYNEQV 180
           K                       PVENENTHSSNGILTVKVYSGDSFKLPLPITYNEQV
Sbjct: 121 KQQQQQLLAQQQQIQYQQQQSQQQPVENENTHSSNGILTVKVYSGDSFKLPLPITYNEQV 180

Query: 181 LSKLLSSGVDVTSTTQQDSLEELIQSMHGLSLLREEDKLLSGEDASHFIPASVILPGSKN 240
           LSKLLSSGVDVTSTTQQDSLEELIQSMHGLSLLREEDKLLSGEDASHFIPASVILPGSKN
Sbjct: 181 LSKLLSSGVDVTSTTQQDSLEELIQSMHGLSLLREEDKLLSGEDASHFIPASVILPGSKN 240

Query: 241 LNSLLYFTIEFDNTIATIEPESGTLNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPS 300
           LNSLLYFTIEFDNTIATIEPESGTLNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPS
Sbjct: 241 LNSLLYFTIEFDNTIATIEPESGTLNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPS 300

Query: 301 QNWQETQISNNDILGDYVKKIRNNSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKM 360
           QNWQETQISNNDILGDYVKKIRNNSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKM
Sbjct: 301 QNWQETQISNNDILGDYVKKIRNNSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKM 360

Query: 361 GKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVS 420
           GKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVS
Sbjct: 361 GKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVS 420

Query: 421 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLS 480
           KSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLS
Sbjct: 421 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLS 480

Query: 481 RSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTF 540
           RSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTF
Sbjct: 481 RSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTF 540

Query: 541 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP 600
           CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP
Sbjct: 541 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP 600

Query: 601 DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMG 660
           DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMG
Sbjct: 601 DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMG 660

Query: 661 AMDTSNFDQEFTREQPVDSVVNDFLSESVQQQFGGWTYVGSEQLG 705
           AMDTSNFDQEFTREQPVDSVVNDFLSESVQQQFGGWTYVGSEQLG
Sbjct: 661 AMDTSNFDQEFTREQPVDSVVNDFLSESVQQQFGGWTYVGSEQLG 705

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/553 (77%), Positives = 496/553 (89%)

Query: 153 SSNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQSMHGLSL 212
           +S GI+T+KVY+G+SFKLP  +T N Q+L KLLSSGV+  S T + S++ELI S+  ++L
Sbjct: 160 NSTGIMTIKVYNGNSFKLPFALTSNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTL 219

Query: 213 LREEDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPESGTLNRPIFNK 272
             +EDKLL G+ A+++IPA++ LP S++LN L+Y TIEFDNT+ATIEPE G L  P+FNK
Sbjct: 220 SEDEDKLLPGDAATNYIPATIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNK 279

Query: 273 ISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKIRNNSDIHLDSF 332
           ISTFDVTR+LP+LK++VF RIPSILLPS+ WQ+   + +  L D +KK+ +N D+ LDSF
Sbjct: 280 ISTFDVTRKLPYLKVNVFVRIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSF 339

Query: 333 HLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGS 392
            LPLNL+ +SA++IRLYNH W+ +E  +G++N+++DYKPS +K LSIDDFDLLKVIGKGS
Sbjct: 340 QLPLNLQFNSATSIRLYNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGS 399

Query: 393 FGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSS 452
           FGKVMQV+K+DTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQS 
Sbjct: 400 FGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSP 459

Query: 453 EKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENIL 512
           EKLYLVLAFINGGELF+HLQ+EGRFDLSR+RFYTAELLCALE LH  ++IYRDLKPENIL
Sbjct: 460 EKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENIL 519

Query: 513 LDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYE 572
           LDYQGHIALCDFGLCKLNMKDQ+KT TFCGTPEYLAPELLLGQGY+KVVDWWTLGVLLYE
Sbjct: 520 LDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYE 579

Query: 573 MLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIK 632
           MLTGLPPYYDEDVPKMYKKILQ+PLRFPD FD++AK+LLI LLCRDPKRRLGY+G+DEIK
Sbjct: 580 MLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIK 639

Query: 633 SHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDFLSESVQQQ 692
            HPFF+QLSWKRL MKGYIPPYKPPVM A+DTSNFDQEFTRE+PVDSVVNDFLSESVQQQ
Sbjct: 640 RHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQ 699

Query: 693 FGGWTYVGSEQLG 705
           FGGWTYVGSEQLG
Sbjct: 700 FGGWTYVGSEQLG 712

>Scas_721.124
          Length = 684

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/561 (76%), Positives = 497/561 (88%), Gaps = 5/561 (0%)

Query: 149 ENTH-SSNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQSM 207
           +NTH SS+GI+T+K+Y+GD+F LP PIT N+Q+LSKLL SG+   ST   D ++ L+  +
Sbjct: 115 QNTHISSSGIMTIKIYNGDAFTLPFPITSNQQILSKLLGSGISPPSTATPD-VDTLVSQL 173

Query: 208 HGLSLLRE---EDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPESGT 264
             + L  +   E+ LL+ + +S FIPA++ LPGS  LN LLYFTIEFDNT+ATIEPE GT
Sbjct: 174 SRVQLQNQGPAEENLLASDVSSKFIPATIKLPGSSVLNPLLYFTIEFDNTVATIEPEYGT 233

Query: 265 LNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKIRNN 324
           + +P+FNKISTFDVTR+LPFLKIDVFARIPSILLPS+ WQ+   +N++ L + ++KI +N
Sbjct: 234 MTKPVFNKISTFDVTRKLPFLKIDVFARIPSILLPSKMWQQEMSANDEKLKEMLEKINSN 293

Query: 325 SDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDL 384
            D+HLDSF LP+NLK D+ASNIRLYNHHW+ LE+ +G++N+S+DYKPS +K LSIDDFDL
Sbjct: 294 QDVHLDSFQLPINLKFDTASNIRLYNHHWVSLENGLGRINISIDYKPSRNKPLSIDDFDL 353

Query: 385 LKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 444
           LKVIGKGSFGKVMQVRK+DT KIYALKAIRK+YIVSKSEVTHTLAERTVLAR+D PFIVP
Sbjct: 354 LKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCPFIVP 413

Query: 445 LKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYR 504
           LKFSFQS +KLYLVLA INGGELFYHLQ+EGRFDLSRSRFY AELLCALE LH+ ++IYR
Sbjct: 414 LKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRFYAAELLCALETLHNLNVIYR 473

Query: 505 DLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWW 564
           DLKPENILLDYQGHIALCDFGLCKLNMKD +KT TFCGTPEYLAPELLLGQGYTKVVDWW
Sbjct: 474 DLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGQGYTKVVDWW 533

Query: 565 TLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLG 624
           TLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPD FD+DAKDLLIGLL RDP RRLG
Sbjct: 534 TLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDGFDRDAKDLLIGLLSRDPTRRLG 593

Query: 625 YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDF 684
            +G+DEIK+HPFF+QLSWKRL MKGYIPPYKPPV  A+DTSNFDQEFTRE+PVDSVV++F
Sbjct: 594 CNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAIDTSNFDQEFTREKPVDSVVDEF 653

Query: 685 LSESVQQQFGGWTYVGSEQLG 705
           LSESVQ+QFGGWTYVGSEQLG
Sbjct: 654 LSESVQKQFGGWTYVGSEQLG 674

>Kwal_26.7635
          Length = 691

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/730 (62%), Positives = 532/730 (72%), Gaps = 74/730 (10%)

Query: 1   MYSWKLSSKFRFGRSXXXXXXXXXXXXXXXIDGND----------------NRSSVDRKA 44
           MYSWK++SKFRFGRS                + +                  R SVDRK 
Sbjct: 1   MYSWKIASKFRFGRSKEEKEKEKEKDKTKEKEKHGLFHHKSHKSDSSYMEPPRESVDRKE 60

Query: 45  TIVPGSATVVQXXXXXXXXXXXXXXGHSVHSSGFKGTITEGSMST-----DISGEDISMT 99
           TIV  S+++                   + S   K   T+ S+ST       SGE   M 
Sbjct: 61  TIVASSSSIAPVR---------------LSSEVNKFPATDSSVSTVRDSVSTSGEYDGMY 105

Query: 100 NGRDRDSTEVQXXXXXXXXXFKXXXXXXXXXXXXXXXXXXXXXXXPVENENTHSSN--GI 157
           +G    S   +                                     N  T   N  GI
Sbjct: 106 DGNGSSSVMDEAFDS--------------------------------NNSTTDEPNFSGI 133

Query: 158 LTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQSMHGLSLLR--E 215
           +T+KVY G+  +LP PIT N Q+L KLL SGV +   T + S +EL+ S+  L L    +
Sbjct: 134 MTIKVYGGEVLRLPFPITSNVQILKKLLHSGV-INQDTDEASADELVSSLSQLHLSDGGD 192

Query: 216 EDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPESGTLNRPIFNKIST 275
           E+ L+ G  A+ +IPA++ LP S +LN LLYFT+EFDNT+ATIEPESGT++   FNKIST
Sbjct: 193 EENLIDGNTATRYIPATITLPNSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKIST 252

Query: 276 FDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKIRNNSDIHLDSFHLP 335
           FDVTR+L FLKIDVFARIPSILLPS++WQ+   S++  L D + +I +N DIH+DS++LP
Sbjct: 253 FDVTRKLNFLKIDVFARIPSILLPSKSWQQLN-SSDPSLKDILDRINDNQDIHIDSYNLP 311

Query: 336 LNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGK 395
           L L  D+AS+ RLYNH WI L    GKLNLSVDYKP+T++ LS+DDF+LLKVIGKGSFGK
Sbjct: 312 LTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGK 371

Query: 396 VMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKL 455
           VMQVRK+DTNK+YALKAIRKSYIVSKSEV HTLAERTVLARV+NPFIVPLKF+FQS +KL
Sbjct: 372 VMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKL 431

Query: 456 YLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDY 515
           Y+VLAFINGGELFYHLQREGRF LSR+R YTAELLCALE LH+ D+IYRDLKPENILLD+
Sbjct: 432 YIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDH 491

Query: 516 QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLT 575
           QGHIALCDFGLCKLNMK Q+KT TFCGTPEYLAPELLLGQGY+KVVDWWTLGVLLYEM+T
Sbjct: 492 QGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMT 551

Query: 576 GLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHP 635
           GLPPYYDEDVPKMYKKILQ+PLRFPD FDKDAKDLLIGLL RDPKRRLG++G+DEIKSHP
Sbjct: 552 GLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHP 611

Query: 636 FFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDFLSESVQQQFGG 695
           FF+QLSWKRL MKGYIPPYKPPVM ++DTSNFDQEFT+E PVDSVVNDFLSESVQQQFGG
Sbjct: 612 FFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGG 671

Query: 696 WTYVGSEQLG 705
           WTYVGSEQLG
Sbjct: 672 WTYVGSEQLG 681

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/554 (75%), Positives = 477/554 (86%), Gaps = 2/554 (0%)

Query: 154 SNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQSMHGLSLL 213
           S G++T+KVY+GD F+LP PIT N+++LS+LL SG+   +      +E ++Q +  L L 
Sbjct: 140 STGVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIASDNHDTSLEVEAILQRISRLELT 199

Query: 214 REE--DKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPESGTLNRPIFN 271
                + LL G+ A+  IP+++ LP S  LN LLYFTIEFDNT+ATIEPESGT+ +PIFN
Sbjct: 200 NSNSNENLLPGDIATQSIPSTIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFN 259

Query: 272 KISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKIRNNSDIHLDS 331
           KISTFDVTR+LP L IDVF RIPSILLP + WQ+   + ++ L   + KI  N D+HLDS
Sbjct: 260 KISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDS 319

Query: 332 FHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKG 391
           F LP+NL IDSA+ IRLYNHHW+EL   +GK+N+SVDYKPS +K LSIDDFDLLKVIGKG
Sbjct: 320 FQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKG 379

Query: 392 SFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQS 451
           SFGKVMQVRK+DT KIYALKAIRKSYIVSKSEVTHTLAERTVLAR+D PFIVPLKFSFQS
Sbjct: 380 SFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQS 439

Query: 452 SEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENI 511
            EKLYLVLA INGGELFYHLQREGRFDLSRSRFY AELLCAL+ LH  D+IYRDLKPENI
Sbjct: 440 QEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENI 499

Query: 512 LLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLY 571
           LLDYQGHIALCDFGLCKLNMKD++KT TFCGTPEYLAPELLLGQGY+KVVDWWTLGVLLY
Sbjct: 500 LLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLY 559

Query: 572 EMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEI 631
           EMLTGLPPYYDE+VPKMYKKILQDPL FPD FD+DAKDLLIGLL RDP+RRLGY+G+DEI
Sbjct: 560 EMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEI 619

Query: 632 KSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDFLSESVQQ 691
           K+HPFF+QLSWKRL MKGYIPPYKPPV  A DTSNFDQEFTRE+P+DSVV+++LSESVQ+
Sbjct: 620 KNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQK 679

Query: 692 QFGGWTYVGSEQLG 705
           QFGGWTYVGSEQLG
Sbjct: 680 QFGGWTYVGSEQLG 693

>Scas_717.69
          Length = 674

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/564 (73%), Positives = 486/564 (86%), Gaps = 4/564 (0%)

Query: 146 VENENTHSSNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQ 205
           + N++   + GI+T+KVY+G+ F LP+ IT NE +LS+LLSSG++       + ++ LI 
Sbjct: 105 MSNKDIDGTAGIMTIKVYNGEGFILPVSITSNETILSRLLSSGINSAHVNLSNEVDALIS 164

Query: 206 SMHGLSLLR----EEDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPE 261
            +  + L      +E+KL++GE  + +IPA+V LPGS  LN LLYFTIEFDNT+ATIEPE
Sbjct: 165 RLSRMQLETSRNIQEEKLINGETCTKYIPATVKLPGSNRLNPLLYFTIEFDNTVATIEPE 224

Query: 262 SGTLNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKI 321
            G +  P+FNKISTFDVTR+LP+LKIDVFARIPSILLPS+ WQ+TQ  ++  +   + KI
Sbjct: 225 YGLMADPVFNKISTFDVTRKLPYLKIDVFARIPSILLPSKLWQQTQSEHDSRMKVILDKI 284

Query: 322 RNNSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDD 381
            +N D+HLDS  +P+NLK DSA+NIRLYNHHW+ LE+ +G++N+SVDYKPS +K L+IDD
Sbjct: 285 NSNQDVHLDSLQIPINLKFDSAANIRLYNHHWVTLENTLGRINISVDYKPSKNKRLTIDD 344

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           FDLLKVIGKGSFGKVMQVRKRDT KIYALKAIRKSYIVSKSEVTHTLAERTVLARV+ PF
Sbjct: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCPF 404

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDI 501
           IVPLKFSFQS EKLYLVLA INGGELFYHLQ+EGRF+LSR+RFYTAELLCALE LH+ D+
Sbjct: 405 IVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDV 464

Query: 502 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVV 561
           IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQ+KT TFCGTPEYLAPELLL QGY+KVV
Sbjct: 465 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVV 524

Query: 562 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKR 621
           DWWTLG+LLYEMLTGLPPYYDEDVPKMY+KILQDPLRFP+ FD+DAKDLLIGLL RDP R
Sbjct: 525 DWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEGFDRDAKDLLIGLLSRDPDR 584

Query: 622 RLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVV 681
           RLG +G+ EIK+HPFF+QLSWKRL  KGYIPPYKPPV  A DT NFDQEFT+E+P+DSVV
Sbjct: 585 RLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVV 644

Query: 682 NDFLSESVQQQFGGWTYVGSEQLG 705
           +++LSESVQ+QFGGWTYVGSEQLG
Sbjct: 645 DEYLSESVQKQFGGWTYVGSEQLG 668

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/565 (63%), Positives = 448/565 (79%), Gaps = 13/565 (2%)

Query: 148 NENTHSSNGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDS-----LEE 202
           +EN HS  G+LTVKVYSG +F +P+PIT ++ +L  LL+S +   S+ + D+     +E+
Sbjct: 142 DENMHS--GLLTVKVYSGSNFTMPVPITSDQGILHNLLNSSI---SSLEGDNNTYAEMEQ 196

Query: 203 LIQSMHGLSLLRE--EDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEP 260
           LI  +  + L  +  E++L+S   +S FIPA + +PG  +   L+Y T+E+DNT+ATI P
Sbjct: 197 LITQLSQVHLANQTSEEQLISNAFSSTFIPAVIKVPGHDDY-PLIYMTVEYDNTMATIYP 255

Query: 261 ESGTLNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKK 320
           E GT+++P+FNKISTFDVTR+LPFLK  VF +IPS LLPS  WQ+     +  +   ++ 
Sbjct: 256 EGGTISKPVFNKISTFDVTRKLPFLKCSVFIKIPSALLPSMRWQQEAALADPNMRSILET 315

Query: 321 IRNNSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSID 380
           I    +I LDSF LP+ L ++SASN RL+NH WI L+  +G +NL+VD+KPS  K + ID
Sbjct: 316 IHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGID 375

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF+LL V+GKGS+GKVMQVRK+DT KIYALKAIRKSYIV+KSEV HTLAERT+LARV+ P
Sbjct: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
           FIVPLKF+FQ+ EKLYLVLA INGGELF+HLQREG FD+SR+RFY +ELL AL++LH  D
Sbjct: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKV 560
           ++YRDLKPENILLD QGHIALCDFGLCKLNMKD EKT+TFCGTPEYLAPE+LLG+GYTKV
Sbjct: 496 VVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKV 555

Query: 561 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPK 620
           VDWWTLGVLLYEMLTGLPPYYDE+V +MYKKIL+ PL FPD  D DAKDLL  LL RDP 
Sbjct: 556 VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPN 615

Query: 621 RRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSV 680
           RRLG +G+DEIK+H FFN L W  +  K Y+PP++P V  A DTSNFD EFT+++PVDSV
Sbjct: 616 RRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSV 675

Query: 681 VNDFLSESVQQQFGGWTYVGSEQLG 705
           ++++LSESVQ QF GW+Y+GSEQLG
Sbjct: 676 IDEYLSESVQNQFKGWSYLGSEQLG 700

>Kwal_47.16761
          Length = 744

 Score =  363 bits (931), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 187/390 (47%), Positives = 261/390 (66%), Gaps = 22/390 (5%)

Query: 326 DIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKM------GKLNLSVDYKPSTHKHLSI 379
           D+ L    L  NL+  S SN    +  W +L+S++      G +++  D+K +  +H   
Sbjct: 276 DMFLGQVRLRPNLESFSHSN----HEQWYKLQSRIVGESVTGHISVKWDFKATMKQHYGP 331

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
            DF++L+++GKG+FG+V QVRK+DT +IYA+K + K  IV K+E+ HT+ ER +L R  +
Sbjct: 332 QDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTAS 391

Query: 440 ---PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEAL 496
              PFIV LKFSFQ+   LYLV  F++GGELF+HLQ+EGRF   R+RFY AEL+ ALE L
Sbjct: 392 KSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYL 451

Query: 497 HDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ- 555
           H+ DI+YRDLKPENILLD  G+IALCDFGL K ++KD  +T TFCGT EYLAPELLL + 
Sbjct: 452 HENDIVYRDLKPENILLDANGNIALCDFGLSKADLKD--RTNTFCGTTEYLAPELLLDES 509

Query: 556 GYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDD-FDKDAKDLLIGL 614
           GYTK+VD+W+LGVL++EM  G  P++ ED  KMY+KI    ++FP D    + +  + GL
Sbjct: 510 GYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGL 569

Query: 615 LCRDPKRRLGY-HGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTR 673
           L R+P+ RLG      E+++HPFF ++ W+ L+ K   PP+KP + G  DTSNFD EFT+
Sbjct: 570 LNRNPRHRLGAIDDGRELRAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFDPEFTQ 629

Query: 674 EQPV----DSVVNDFLSESVQQQFGGWTYV 699
                     +    LS ++Q +F G+T+V
Sbjct: 630 TSTSFMNKQGIAATPLSPAMQAKFVGFTFV 659

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  354 bits (909), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/391 (47%), Positives = 262/391 (67%), Gaps = 25/391 (6%)

Query: 328 HLDSFHLPLNLKIDSASNIRLYNHHWIEL------ESKMGKLNLSVDYKPSTHKHLSIDD 381
           H D F   + L+ ++ +   ++N  W +L      ES  G++ +  +Y  +  +H    D
Sbjct: 245 HGDVFLGQVRLRPNTHTKHDVHNQ-WSKLNGRTVGESVSGEILVRWEYWHTEKRHYGPQD 303

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-- 439
           F++L+++GKG+FG+V QVRK+DT +IYA+K + K  IV K+E+ HT+ ER +L R  +  
Sbjct: 304 FEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKS 363

Query: 440 -PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHD 498
            PFIV LKFSFQ+   LYLV  F++GGELF+HLQ+EGRF   R++FY AEL+ ALE LHD
Sbjct: 364 CPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHD 423

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ-GY 557
            DI+YRDLKPENILLD  G+IALCDFGL K ++KD  +T TFCGT EYLAPELLL + GY
Sbjct: 424 NDIVYRDLKPENILLDANGNIALCDFGLSKADLKD--RTNTFCGTTEYLAPELLLDETGY 481

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDD-FDKDAKDLLIGLLC 616
           TK+VD+W+LGVL++EM  G  P++ ED  KMY+KI    ++FP D    + +  + GLL 
Sbjct: 482 TKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLN 541

Query: 617 RDPKRRLG-YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTR-- 673
           R+PK RLG  +   E+++HPF + + W+ L+ K   PP+KP +    DTSNFD EFT+  
Sbjct: 542 RNPKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPPPFKPHLTSETDTSNFDPEFTQTS 601

Query: 674 -----EQPVDSVVNDFLSESVQQQFGGWTYV 699
                +QP+ +     LS ++Q +F G+T+V
Sbjct: 602 TSFMNKQPIAATP---LSPAMQAKFAGFTFV 629

>Scas_703.5
          Length = 749

 Score =  354 bits (908), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 249/367 (67%), Gaps = 25/367 (6%)

Query: 353 WIELESKMGKLNLSVD------YKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNK 406
           W  L+S++   N++ D      Y  +  +H   +DF++L+++GKG+FG+V QV+K+DT +
Sbjct: 309 WYPLKSRVLDENVTGDILIKWEYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVKKKDTKR 368

Query: 407 IYALKAIRKSYIVSKSEVTHTLAERTVL---ARVDNPFIVPLKFSFQSSEKLYLVLAFIN 463
           IYA+K + K  IV K+EV HT+ ER +L   A   +PFIV LKFSFQ+   LYLV  F++
Sbjct: 369 IYAMKVLSKKVIVKKNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMS 428

Query: 464 GGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCD 523
           GGELF+HLQ+EGRF   R++FY AEL+ ALE LHD DI+YRDLKPENILLD  G+IALCD
Sbjct: 429 GGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCD 488

Query: 524 FGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ-GYTKVVDWWTLGVLLYEMLTGLPPYYD 582
           FGL K ++KD  +T TFCGT EYLAPELLL + GYTK+VD+W+LGVL++EM  G  P++ 
Sbjct: 489 FGLSKADLKD--RTNTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCGWSPFFA 546

Query: 583 EDVPKMYKKILQDPLRFPDD-FDKDAKDLLIGLLCRDPKRRLGY-HGSDEIKSHPFFNQL 640
           ED  KMY+KI    ++FP D    + +  + GLL R+PK RLG      E+++HPFF  +
Sbjct: 547 EDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADI 606

Query: 641 SWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFT--------REQPVDSVVNDFLSESVQQQ 692
            W  L+ K   PP+KP ++   DTSNFD EFT        + QP+ +     LS ++Q +
Sbjct: 607 DWDALREKKIPPPFKPHLVSETDTSNFDPEFTQTSTSYMNKHQPIAATP---LSPAMQAK 663

Query: 693 FGGWTYV 699
           F G+T+V
Sbjct: 664 FAGFTFV 670

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  353 bits (907), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/408 (46%), Positives = 263/408 (64%), Gaps = 24/408 (5%)

Query: 312 DILGDYVK-KIRNNSDIHLDSFHLPLNLKIDSASNIRLYNHHWIELESKM------GKLN 364
           D+LG + +  I      H D F   + L+ +  +   + +  W  L+S++      G++ 
Sbjct: 263 DVLGSHSELDISVYDSNHEDMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEIL 322

Query: 365 LSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEV 424
           +   Y  +  +H    DF++L+++GKG+FG+V QV+K+DT +IYA+K + K  IV K+E+
Sbjct: 323 VKWHYTLTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEI 382

Query: 425 THTLAERTVLARVDN---PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSR 481
            HT+ ER +L    +   PFIV LKFSFQ+   LYLV  +++GGELF+HLQREGRF   R
Sbjct: 383 AHTIGERNILVTTSSKASPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDR 442

Query: 482 SRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFC 541
           ++FY AEL+ ALE LHD DI+YRDLKPENILLD  G+IALCDFGL K ++KD  +T TFC
Sbjct: 443 AKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD--RTNTFC 500

Query: 542 GTPEYLAPELLLGQ-GYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP 600
           GT EYLAPELLL + GYTK+VD+W+LGVL++EM  G  P+Y ED  KMY+KI    ++FP
Sbjct: 501 GTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFP 560

Query: 601 DD-FDKDAKDLLIGLLCRDPKRRLGY-HGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV 658
            D    + +  + GLL R+PK RLG      E+++HPFF  + W+ LK K   PP+KP +
Sbjct: 561 RDILSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPFKPHL 620

Query: 659 MGAMDTSNFDQEFTREQPVDSVVNDF-------LSESVQQQFGGWTYV 699
           +   DTSNFD EFT  Q   S +N         LS  +Q +F G+T+V
Sbjct: 621 VSETDTSNFDPEFT--QTSTSYMNKHHQMAATPLSPGMQAKFAGFTFV 666

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  353 bits (906), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 179/369 (48%), Positives = 250/369 (67%), Gaps = 24/369 (6%)

Query: 351 HHWIELESKM------GKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDT 404
           H W  L+ ++      G + +   YK +  +H    DF++L+++GKG+FG+V QV+K+DT
Sbjct: 375 HQWHSLKPRVIDEVVSGDILIKWTYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDT 434

Query: 405 NKIYALKAIRKSYIVSKSEVTHTLAERTVL---ARVDNPFIVPLKFSFQSSEKLYLVLAF 461
            +IYA+K + K  IV K+E+ HT+ ER +L   A   +PFIV LKFSFQ+   LYLV  +
Sbjct: 435 QRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDY 494

Query: 462 INGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIAL 521
           ++GGELF+HLQ+EGRF   R++FY AEL+ ALE LHD DI+YRDLKPENILLD  G+IAL
Sbjct: 495 MSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIAL 554

Query: 522 CDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ-GYTKVVDWWTLGVLLYEMLTGLPPY 580
           CDFGL K ++KD  +T TFCGT EYLAPELLL + GYTK+VD+W+LGVL++EM  G  P+
Sbjct: 555 CDFGLSKADLKD--RTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPF 612

Query: 581 YDEDVPKMYKKILQDPLRFPDD-FDKDAKDLLIGLLCRDPKRRLGY-HGSDEIKSHPFFN 638
           + E+  KMY+KI    ++FP D   ++ +  + GLL R+PK RLG      E+++HPFF 
Sbjct: 613 FAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFA 672

Query: 639 QLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFT--------REQPVDSVVNDFLSESVQ 690
            + W+ LK K   PP+KP ++   DTSNFD EFT        + QP+ +     LS ++Q
Sbjct: 673 DIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMMTATP--LSPAMQ 730

Query: 691 QQFGGWTYV 699
            +F G+T+V
Sbjct: 731 AKFAGFTFV 739

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  350 bits (897), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 249/366 (68%), Gaps = 24/366 (6%)

Query: 353 WIELESKM------GKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNK 406
           W +L+S+       G + +  +Y  +  +     DF++L+++GKG+FG+V QVRK+DT +
Sbjct: 290 WHKLKSRALGEHVTGDILIHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMR 349

Query: 407 IYALKAIRKSYIVSKSEVTHTLAERTVLARV---DNPFIVPLKFSFQSSEKLYLVLAFIN 463
           IYA+K + K  IV K+E+ HT+ ER +L R     +PFIV LKFSFQ+   LYLV  F++
Sbjct: 350 IYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMS 409

Query: 464 GGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCD 523
           GGELF+HLQ+EGRF   R++FY AEL+ ALE LHD DI+YRDLKPENILLD  G+IALCD
Sbjct: 410 GGELFWHLQKEGRFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCD 469

Query: 524 FGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ-GYTKVVDWWTLGVLLYEMLTGLPPYYD 582
           FGL K ++KD  +T TFCGT EYLAPELL+ + GYTK+VD+W+LGVL++EM  G  P++ 
Sbjct: 470 FGLSKADLKD--RTNTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFA 527

Query: 583 EDVPKMYKKILQDPLRFPDD-FDKDAKDLLIGLLCRDPKRRLGY-HGSDEIKSHPFFNQL 640
            D  KMY+KI    ++FP D    + +  + GLL R+PK RLG      E+++HPFFN +
Sbjct: 528 SDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFNDI 587

Query: 641 SWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTR-------EQPVDSVVNDFLSESVQQQF 693
            W+ ++ K   PP+KP ++   DTSNFD EFT+       +QP+ +     LS ++Q +F
Sbjct: 588 DWEAVRQKKIPPPFKPHLISETDTSNFDPEFTQTSTSFMNKQPIAATP---LSPAMQAKF 644

Query: 694 GGWTYV 699
            G+T+V
Sbjct: 645 VGFTFV 650

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  276 bits (706), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 134/292 (45%), Positives = 194/292 (66%), Gaps = 6/292 (2%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF +L+ +G GSFG+V  VR     + YA+K ++K+ +V   +V HT  ER +L+ V +P
Sbjct: 144 DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
           FI+ +  +FQ S++L++++ +I GGELF  L++  RF    ++FY AE+  ALE LH   
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKG 263

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKV 560
           IIYRDLKPENILLD  GHI L DFG  K      + T T CGTP+Y+APE++  + Y K 
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFAKY---VPDVTYTLCGTPDYIAPEVVSTKPYNKS 320

Query: 561 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPK 620
           VDWW+ GVL+YEML G  P+YD +  K Y+ IL  P+RFP  F  DA+DL+  L+ RD  
Sbjct: 321 VDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPVRFPPFFHSDAQDLISKLITRDLS 380

Query: 621 RRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVM-GAMDTSNFDQ 669
           +RLG   +GS+++K+HP+F+++ W++L  K    PY+PP+  G  DTS +D+
Sbjct: 381 QRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDR 432

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score =  273 bits (698), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 130/292 (44%), Positives = 195/292 (66%), Gaps = 6/292 (2%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           +F +L+ +G GSFG+V  +R R   + YA+K ++K  +V   +V HT  ER +L+ V +P
Sbjct: 86  NFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHP 145

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
           FI+ +  +FQ ++++++++ +I GGELF  L++  RF    ++FY AE+  ALE LH  D
Sbjct: 146 FIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKD 205

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKV 560
           IIYRDLKPENILLD  GHI + DFG  K      + T T CGTP+Y+APE++  + Y K 
Sbjct: 206 IIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPYNKS 262

Query: 561 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPK 620
           +DWW+ G+L+YEML G  P+YD +  K Y+KIL   LRFP  F++D KDLL  L+ RD  
Sbjct: 263 IDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLS 322

Query: 621 RRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFDQ 669
           +RLG   +G++++K+HP+F ++ W++L  +    PY+PP+  G  DTS FD+
Sbjct: 323 QRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDK 374

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  273 bits (699), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 197/304 (64%), Gaps = 6/304 (1%)

Query: 369 YKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTL 428
           Y  +T    ++ DF +L+ +G GSFG+V  +R     + YALKA++K  +V   +V HT 
Sbjct: 139 YGANTSGKYTLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTN 198

Query: 429 AERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAE 488
            ER +L+ V +PFI+ +  +FQ S+ +++V+ +I GGELF  L++  RF    ++FY AE
Sbjct: 199 DERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 258

Query: 489 LLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLA 548
           +  ALE LH  +IIYRDLKPENILLD  GHI + DFG  K      + T T CGTP+Y+A
Sbjct: 259 VCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDVTYTLCGTPDYIA 315

Query: 549 PELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAK 608
           PE++  + Y K VDWW+ G+L+YEML G  P+YD +  K Y+ IL   L+FP  F  D +
Sbjct: 316 PEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQ 375

Query: 609 DLLIGLLCRDPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTS 665
           DLL  L+ RD  +RLG   +GS+++K+HP+F+++ W++L  +    PY+PP+  G  DTS
Sbjct: 376 DLLSKLITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTS 435

Query: 666 NFDQ 669
            FD+
Sbjct: 436 QFDR 439

>Kwal_56.24059
          Length = 353

 Score =  268 bits (684), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 193/301 (64%), Gaps = 7/301 (2%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           S++DF +L+ +G GSFG+V  VR     + YA+K ++K  ++   ++ HT  ER +L  V
Sbjct: 39  SLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLV 98

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           D+PF++ +  +FQ S  L++V+ +I GGELF  L++  RF    ++FY AE++ ALE LH
Sbjct: 99  DHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLH 158

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
             DIIYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE++  + Y
Sbjct: 159 SHDIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVIATKPY 215

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCR 617
            K VDWW+LG+L++EML G  P+YD    K Y+KILQ  + +P  F  D  DLL  L+  
Sbjct: 216 NKSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLLCKLITS 275

Query: 618 DPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFDQEFTRE 674
           D  RRLG    G  ++KSHP+F+++ W++L  K    PY+PP+  G  DTS FDQ +  E
Sbjct: 276 DLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ-YPEE 334

Query: 675 Q 675
           Q
Sbjct: 335 Q 335

>Scas_651.18
          Length = 371

 Score =  267 bits (683), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 193/295 (65%), Gaps = 6/295 (2%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           +++DF +L+ +G GSFG+V  +R     + YALK ++K  IV   +V HT  ER +L+ V
Sbjct: 55  TLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLSVV 114

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            +PF+V +  +FQ  E++++++ +I GGELF  L++  RF    ++FY AE+  ALE LH
Sbjct: 115 SHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 174

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
             DIIYRDLKPENILLD  GHI + DFG  K      + T T CGTP+Y+APE++  + Y
Sbjct: 175 SMDIIYRDLKPENILLDKNGHIKITDFGFAKYV---PDITYTLCGTPDYIAPEVVSTKPY 231

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCR 617
            K VDWW+ G+L+YEML G  P+YD +  K Y+ IL   L+FP+ F  D KDLL  L+ +
Sbjct: 232 NKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFPNFFHDDVKDLLSKLITK 291

Query: 618 DPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFDQ 669
           +   RLG   +GS+++K HP+F+++ W++L  +    PY+PP+  G  DTS FD+
Sbjct: 292 NLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDR 346

>Scas_689.25*
          Length = 409

 Score =  268 bits (686), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 135/295 (45%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           +IDDF++L+  G GSFG+V  VR     + YALK ++K  +V   +V HT  ER +L+  
Sbjct: 95  TIDDFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSVS 154

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            + FIV L  +FQ SE L++++ ++ GGELF  L+R  RF    ++FY AE+  AL+ LH
Sbjct: 155 VHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVAKFYAAEVCLALDYLH 214

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
             DIIYRDLKPEN+LLD  GHI + DFG  K      + T T CGTP+Y+APE++  + Y
Sbjct: 215 SLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYV---PDVTYTLCGTPDYIAPEVISAKPY 271

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCR 617
            K VDWW+ G+L+YEML+G  P+YD    K Y+ IL  PL+FP  F  DA+DLL  L+ R
Sbjct: 272 NKSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENILNAPLKFPKYFTPDAQDLLSRLITR 331

Query: 618 DPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFDQ 669
           D   RLG   +G+++IK+H +F+++ W +L  +    PY+PP+  G  DTS FD+
Sbjct: 332 DLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDR 386

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  266 bits (681), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 190/295 (64%), Gaps = 6/295 (2%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           S+ DF +++ +G GSFG+V  VR     + YA+K ++K+ +V   ++ HT  ER +L  V
Sbjct: 47  SLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDERRMLKLV 106

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           ++PF++ +  +FQ S  L++V+ +I GGELF  L++  RF    ++FY AE+  ALE LH
Sbjct: 107 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLH 166

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
             +IIYRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APE++  + Y
Sbjct: 167 FHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVETVTWTLCGTPDYIAPEVIATKPY 223

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCR 617
            K VDWW+LGVL+YEML G  P+YD    K Y+KIL   + +P  F+ D  DLL  LL  
Sbjct: 224 NKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLLSKLLTA 283

Query: 618 DPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFDQ 669
           D  RR+G    G+ +IKSHP+F ++ W++L  K    PY+PP+  G  DTS FDQ
Sbjct: 284 DLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 338

>Kwal_33.13846
          Length = 375

 Score =  266 bits (680), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 193/295 (65%), Gaps = 6/295 (2%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           +++DF +L+ +G GSFG+V  VR     + YA+K ++K  IV   +V HT  ER +L+ V
Sbjct: 61  TLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVV 120

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            +PFI+ +  +FQ +E +++++ +I GGELF  L++  RF    ++FY AE+  ALE LH
Sbjct: 121 SHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 180

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
             DIIYRDLKPEN+LLD  GH+ + DFG  K      + T T CGTP+Y+APE++  + Y
Sbjct: 181 AQDIIYRDLKPENVLLDKNGHVKITDFGFAKFV---PDVTYTLCGTPDYIAPEVVSTKPY 237

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCR 617
            K VDWW+ G+L++EML G  P+YD +  K Y+ IL   L+FP  F  D +DLL  L+ R
Sbjct: 238 NKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQFPPFFHSDVQDLLSQLITR 297

Query: 618 DPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVM-GAMDTSNFDQ 669
           D  +RLG   +GS+++K+H +F+++ W++L  +    PY+PPV  G  DTS +D+
Sbjct: 298 DLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYDR 352

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  279 bits (713), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 207/328 (63%), Gaps = 6/328 (1%)

Query: 377  LSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-- 434
            +S+DDF LLKV+GKG+FGKV+  R ++T+ + A+K ++K  I+   ++    AE+ V   
Sbjct: 829  VSLDDFILLKVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLL 888

Query: 435  -ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCAL 493
                 +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q   R  + R++FY AE+L +L
Sbjct: 889  ATETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNR-RLSVRRAKFYAAEVLLSL 947

Query: 494  EALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL 553
            +  HD  +IYRDLK ENILL  +GHI + D+GLCK NM    KT+TFCGTPE++APE+L 
Sbjct: 948  KYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILK 1007

Query: 554  GQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIG 613
            GQ YTK VDWWT GVLLY+ML    P+  ED  +++  IL D   +P D   D   +  G
Sbjct: 1008 GQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1067

Query: 614  LLCRDPKRRLGYHGSD--EIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEF 671
            LL +DP++RLG    D  EI + PFF+ +++  +      PP+ P +  A DTS F++EF
Sbjct: 1068 LLTKDPEKRLGAGPKDALEIMAEPFFSNINFDDILNLRVEPPFVPEIKAADDTSYFEKEF 1127

Query: 672  TREQPVDSVVNDFLSESVQQQFGGWTYV 699
            T   P  + +   LS  +Q++F G++++
Sbjct: 1128 TSAPPTLTPLPSVLSSVLQEEFRGFSFM 1155

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  278 bits (712), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 141/328 (42%), Positives = 205/328 (62%), Gaps = 6/328 (1%)

Query: 377  LSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-- 434
            +S+D+F LLKV+GKG+FGKV+  R ++TN++ A+K ++K  I+   ++    AE+ V   
Sbjct: 812  VSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLL 871

Query: 435  -ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCAL 493
              +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + R++FY AE+L AL
Sbjct: 872  ATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEVLLAL 930

Query: 494  EALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL 553
            +  HD  +IYRDLK ENILL  +GHI + D+GLCK  M    KT+TFCGTPE++APELL 
Sbjct: 931  KFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELLR 990

Query: 554  GQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIG 613
             Q YTK VDWW  GVLLY+ML    P+  +D  +++  IL D   +P D   D   +  G
Sbjct: 991  EQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1050

Query: 614  LLCRDPKRRLGYHGSD--EIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEF 671
            LL +DP++RLG    D  EI   PFF  +++  L      PPY P +  A DTS F+QEF
Sbjct: 1051 LLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDTSYFEQEF 1110

Query: 672  TREQPVDSVVNDFLSESVQQQFGGWTYV 699
            T   P  + +   LS + Q++F G++Y+
Sbjct: 1111 TSAPPSLTPLPSVLSTTQQEEFRGFSYM 1138

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  278 bits (711), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 137/335 (40%), Positives = 209/335 (62%), Gaps = 6/335 (1%)

Query: 370  KPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA 429
            K    + +S+DDF LLKV+GKG+FGKV+  R ++T+++ A+K ++K +I+   ++    A
Sbjct: 810  KTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARA 869

Query: 430  ERTVL---ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYT 486
            E+ V     +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + R++FY 
Sbjct: 870  EKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 928

Query: 487  AELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEY 546
            AE+L AL+  HD  IIYRDLK ENILL  +GHI + D+GLCK  M    +T+TFCGTPE+
Sbjct: 929  AEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEF 988

Query: 547  LAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKD 606
            +APE+L  Q YTK VDWW  GVLLY+ML    P+  +D  +++  IL D   +P D   D
Sbjct: 989  MAPEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1048

Query: 607  AKDLLIGLLCRDPKRRLGYHGSD--EIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDT 664
               +  GLL +DP++RLG    D  E+   PFF  +++  +      PPY P +  A DT
Sbjct: 1049 IVQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDT 1108

Query: 665  SNFDQEFTREQPVDSVVNDFLSESVQQQFGGWTYV 699
            S F++EFT   P  + +   LS ++Q++F G++++
Sbjct: 1109 SYFEKEFTAAPPTLTPLPSILSSNLQEEFRGFSFM 1143

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  258 bits (660), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 189/295 (64%), Gaps = 6/295 (2%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           S+ DF +++ +G GSFG+V  VR     + YA+K ++K  ++   ++ HT  ER +L  V
Sbjct: 32  SLQDFQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLKVV 91

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           ++PF++ +  +FQ +  L++V+ +I GGELF  L++  RF    ++FY AE+  ALE LH
Sbjct: 92  EHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLH 151

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
             +IIYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE++  + Y
Sbjct: 152 AHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVITTKPY 208

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCR 617
            K +DWW+LG+L++EML G  P+YD    K Y+KIL   + FP  F  DA DLL  L+  
Sbjct: 209 NKSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLLGKLITD 268

Query: 618 DPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFDQ 669
           D  RRLG    GS +IKSHP+F+++ W++L  K    PY+PP+  G  D+S FDQ
Sbjct: 269 DLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQ 323

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  259 bits (661), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 191/301 (63%), Gaps = 7/301 (2%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           ++ DF +++ +G GSFG+V  VR     + YA+K ++K  I+   ++ HT  ER +L  V
Sbjct: 58  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLV 117

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           ++PF++ +  +FQ S  L++V+ +I GGELF  L++  RF    ++FY AE+  ALE LH
Sbjct: 118 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLH 177

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
             +IIYRDLKPENILLD  GHI + DFG  K  +     T T CGTP+Y+APE++  + Y
Sbjct: 178 SHNIIYRDLKPENILLDRNGHIKITDFGFAKEVIT---VTWTLCGTPDYIAPEVITTKPY 234

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCR 617
            K VDWW+LG+L++EML G  P+YD    K Y+KIL   + +P  F  D  DLL  L+  
Sbjct: 235 NKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVYPPFFHPDVVDLLGKLITA 294

Query: 618 DPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFDQEFTRE 674
           D  RRLG    G D+IKSHP+F ++ W++L  K    PY+PP+ +G  D+S FDQ +  E
Sbjct: 295 DLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFDQ-YPEE 353

Query: 675 Q 675
           Q
Sbjct: 354 Q 354

>Kwal_27.10581
          Length = 1154

 Score =  275 bits (703), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 205/330 (62%), Gaps = 6/330 (1%)

Query: 375  KHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 434
            + +S+DDF LLKV+GKG+FGKV+    ++  ++ A+K ++K +I+   ++    AE+ V 
Sbjct: 820  RKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVF 879

Query: 435  ---ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLC 491
                +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + R++FY AE+L 
Sbjct: 880  LLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEVLL 938

Query: 492  ALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPEL 551
            AL+  HD  +IYRDLK ENILL  +GHI + D+GLCK  M    KT+TFCGTPE++APE+
Sbjct: 939  ALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAPEI 998

Query: 552  LLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLL 611
            L  Q YTK VDWW  GVLLY+ML    P+  ED  +++  IL D   +P D   D   + 
Sbjct: 999  LKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIF 1058

Query: 612  IGLLCRDPKRRLGYHGSD--EIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQ 669
             GLL +DP+RRLG    D  E+ + PFF  + +  +      PPY P +  A DTS F++
Sbjct: 1059 QGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAADDTSYFEK 1118

Query: 670  EFTREQPVDSVVNDFLSESVQQQFGGWTYV 699
            EFT   P  + +   LS ++Q++F G++++
Sbjct: 1119 EFTSAPPTLTPLPSVLSSNLQEEFRGFSFM 1148

>Scas_715.34
          Length = 1150

 Score =  274 bits (701), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 135/333 (40%), Positives = 205/333 (61%), Gaps = 6/333 (1%)

Query: 372  STHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER 431
            S  + +S+D+F LLKV+GKG+FGKV+  R ++T ++ A+K ++K  I+   ++    AE+
Sbjct: 813  SKRRKVSLDNFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEK 872

Query: 432  TVL---ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAE 488
             V     +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + R++FY AE
Sbjct: 873  KVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAE 931

Query: 489  LLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLA 548
            +L AL+  HD  +IYRDLK ENILL  QGHI + D+GLCK  M    KT+TFCGTPE++A
Sbjct: 932  VLLALKYFHDNGVIYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEFMA 991

Query: 549  PELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAK 608
            PE+L  QGYT+ VDWW  GVLLY+ML    P+  +D  +++  IL D   +P D   D  
Sbjct: 992  PEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIV 1051

Query: 609  DLLIGLLCRDPKRRLGYHGSD--EIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSN 666
             +  GLL +DP+ RLG    D  E+   PFF  ++++ +      PPY P +    DTS 
Sbjct: 1052 QIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNINFEDILNLRVQPPYVPEIKSPEDTSY 1111

Query: 667  FDQEFTREQPVDSVVNDFLSESVQQQFGGWTYV 699
            F+ EFT   P  + +   L+ + Q++F G++++
Sbjct: 1112 FEHEFTSAPPTLTPLPSILTTTQQEEFRGFSFM 1144

>Scas_690.13
          Length = 354

 Score =  256 bits (653), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 132/301 (43%), Positives = 189/301 (62%), Gaps = 7/301 (2%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           ++ DF +++ +G GSFG+V  VR     + YA+K ++K  +V   ++ HT  ER +L  V
Sbjct: 40  TLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDERRMLKLV 99

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           ++PF++ +  +FQ S  L++V+ +I GGELF  L++  RF    ++FY AE+   LE LH
Sbjct: 100 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLH 159

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
             +IIYRDLKPENILLD  GHI + DFG  K   +    T T CG P+Y+APE++  + Y
Sbjct: 160 SHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGPPDYIAPEVIATKPY 216

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCR 617
            K VDWW+LGVL++EML G  P+YD    K Y+KILQ  + +P  F  D  DLL  L+  
Sbjct: 217 NKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPTFFHPDVVDLLGKLITA 276

Query: 618 DPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFDQEFTRE 674
           D  RR+G    GS +IK HP+F+++ W++L  K    PY+PP+  G  DTS FDQ +  E
Sbjct: 277 DLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQ-YPEE 335

Query: 675 Q 675
           Q
Sbjct: 336 Q 336

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  270 bits (690), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 208/335 (62%), Gaps = 6/335 (1%)

Query: 370  KPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA 429
            + +  + +S+D+F LLKV+GKG+FGKV+  + ++T+++ A+K ++K  I+   ++    A
Sbjct: 812  RAAKRRKVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARA 871

Query: 430  ERTVL---ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYT 486
            E+ V     +  +PF+  L  SFQ+  ++Y  + FI GG+L +H+Q + R  + R++FY 
Sbjct: 872  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 930

Query: 487  AELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEY 546
            AE+L AL+  HD  +IYRDLK ENILL  +GHI + D+GLCK  M    +T+TFCGTPE+
Sbjct: 931  AEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEF 990

Query: 547  LAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKD 606
            +APE+L  Q YTK VDWW  GVLLY+ML    P+  +D  +++  IL D   +P D   +
Sbjct: 991  MAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGE 1050

Query: 607  AKDLLIGLLCRDPKRRLGY--HGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDT 664
               +  GLL +DP++RLG     +DE+   PFF  +++  +      PPY P +    DT
Sbjct: 1051 IVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDT 1110

Query: 665  SNFDQEFTREQPVDSVVNDFLSESVQQQFGGWTYV 699
            S F+QEFT   P  + +   L+ S Q++F G++++
Sbjct: 1111 SYFEQEFTSAPPTLTPLPSVLTTSQQEEFRGFSFM 1145

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  251 bits (640), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 193/301 (64%), Gaps = 6/301 (1%)

Query: 372 STHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER 431
           +T    ++ DF +L+ +G GSFG+V  VR     + YA+K ++K  +V   +V HT  ER
Sbjct: 66  TTKGKYTLYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDER 125

Query: 432 TVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLC 491
            +L+ V +PFI+ +  +FQ + ++++++ +I GGELF  L++  RF    ++FY AE+  
Sbjct: 126 KMLSVVSHPFIIRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCL 185

Query: 492 ALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPEL 551
           ALE LH  DIIYRDLKPENILLD  GHI L DFG  K      + T T CGTP+Y+APE+
Sbjct: 186 ALEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYV---PDVTYTLCGTPDYIAPEV 242

Query: 552 LLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLL 611
           +  + Y K VDWW+ G+L+YEML G  P+YD++    Y+ IL   ++FP  F+   +DLL
Sbjct: 243 VSTKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKFPPFFNAKVRDLL 302

Query: 612 IGLLCRDPKRRLG--YHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV-MGAMDTSNFD 668
             L+ RD  +RLG   +GS ++K+HP+F+++ W +L  +    PY+PP+  G  DTS +D
Sbjct: 303 SQLITRDLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYD 362

Query: 669 Q 669
           +
Sbjct: 363 R 363

>Kwal_56.22788
          Length = 515

 Score =  226 bits (576), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 132/390 (33%), Positives = 206/390 (52%), Gaps = 62/390 (15%)

Query: 374 HKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVS------------- 420
           H   +++DF  ++V+G+G++GKV+ V+   T+++YA+K ++K+ I+              
Sbjct: 117 HGTRTLEDFAPVRVLGRGAYGKVLLVKDSHTSRLYAMKQLKKAEILIHDGSSEEGQPDSN 176

Query: 421 -KSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDL 479
            +  +  T AERT+L+++++P IV L +SF    KLYL+L FI GGELFYHL+ +G  D 
Sbjct: 177 LEKRLERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLDE 236

Query: 480 SRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQ----- 534
               FY AE+ CAL  LH   ++YRDLKPEN LLD +GH+ L DFGL K++  D      
Sbjct: 237 DTVAFYAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADGG 296

Query: 535 ------EKTTTFC------GTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYD 582
                  +  + C      GTPEY APE+L G+ YT+  DW++LG L+++ML G PPY  
Sbjct: 297 DVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKPPYTG 356

Query: 583 EDVPKMYKKILQDPL-RFPDDFDKDAKDLLIGLLCRD------------------PKRRL 623
            +   +  KIL+D + + P    +  KD L  LL +D                   K++ 
Sbjct: 357 VNHKVILNKILKDKIPKIPSYLSEGMKDFLAALLKKDVTKRWDVDKFWNTDGPKLKKKKA 416

Query: 624 GYHGSDEIKSHPFFNQLSWKRLK----MKGYIPPYKPPVMGAMDTSNFDQEFT------- 672
           G   +   ++H  F ++SW +++     +    P  P +       NFD EFT       
Sbjct: 417 GQAKTTSFQAHFVFRKISWLKMETGELQRNTEGPILPIITDWELAENFDSEFTEMRLDSE 476

Query: 673 -REQPVDSVVNDFLSESVQQQFGGWTYVGS 701
            ++QP +  +N F     +  F G++YV S
Sbjct: 477 AQDQPANLQINGFSRSGDKDVFKGFSYVAS 506

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  228 bits (582), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 122/313 (38%), Positives = 184/313 (58%), Gaps = 29/313 (9%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           F+ ++++G+G  GKV  +R+RDTN+I+ALK + K  ++ + ++   L E+ +LA  D+PF
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPF 383

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSR--SRFYTAELLCALEALHDF 499
           IV L  SFQ+ + LYL + +  GGE F  LQ      ++   ++FY +E++ ALE LH  
Sbjct: 384 IVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLL 443

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLC-------KLNMKDQE-----------KTTTFC 541
             IYRDLKPENILL   GH+ L DF L        K  MKD             +T +F 
Sbjct: 444 GFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFV 503

Query: 542 GTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPD 601
           GT EYLAPE++ G G+T  VDWWTLG+L+YEML G  P+  ++  + +  IL   ++FP 
Sbjct: 504 GTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPH 563

Query: 602 D--FDKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPV 658
           D    K+ KDL+  LL ++  +RLG   G+ +IK HPFF ++ W  L+ +       PP+
Sbjct: 564 DKEVSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWSFLRNQD------PPL 617

Query: 659 MGAMDTSNFDQEF 671
           + A++ +  +  F
Sbjct: 618 IPALNDNGCELPF 630

>Kwal_23.6458
          Length = 868

 Score =  230 bits (587), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/319 (38%), Positives = 187/319 (58%), Gaps = 36/319 (11%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           F+ +K++G+G  GKV  V+++ TN++YALK   K  ++ + ++   LAE+ +LA  ++PF
Sbjct: 464 FEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRILAEQEILATSNHPF 523

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQ--REGRFDLSRSRFYTAELLCALEALHDF 499
           IV L  SFQS + LYL + +  GGE F  LQ  +    D   +RFY++E++ A+E LH  
Sbjct: 524 IVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLM 583

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQE----------------------KT 537
             IYRDLKPENILL   GHI L DF L  +  KD +                      +T
Sbjct: 584 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDTKNPVVKGSAQSSLLDTKICSDGFRT 642

Query: 538 TTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPL 597
            +F GT EY+APE++ G G+T  VDWWTLG+L+YEML G  PY  ++  K +  +L++ +
Sbjct: 643 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPYKGDNTNKTFSNVLKNEV 702

Query: 598 RFP--DDFDKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPY 654
            FP  ++  ++ KDL+  LL +   RRLG   G+ +IK HPFF ++ W  L+ +      
Sbjct: 703 SFPNNNEVSRNCKDLIRKLLIKSETRRLGSKFGASDIKKHPFFKKVQWSLLRNQ------ 756

Query: 655 KPPVMGAMDTSNFDQEFTR 673
           +PP++  +  + +D  FTR
Sbjct: 757 EPPLIPVLTENGYD--FTR 773

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  227 bits (578), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 137/394 (34%), Positives = 202/394 (51%), Gaps = 78/394 (19%)

Query: 350 NHHWIELESKMGKLNLSVD---------------YKPSTHKHLSIDDFDLLKVIGKGSFG 394
           N   +ELE+++G  N S +               +       LS++DF  ++VIGKG+FG
Sbjct: 323 NERRVELETELGSHNWSEERNARQLASLGKKESQFLRLRRTRLSLEDFHTVQVIGKGAFG 382

Query: 395 KVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEK 454
           +V  V+K+DT KIYA+K + KS +  K ++ H  AER VLA  D+P+IV L +SFQ ++ 
Sbjct: 383 EVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGTDSPWIVSLYYSFQDAQY 442

Query: 455 LYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLD 514
           LYL++ F+ GG+L   L R   F    +RFY AE + A+E +H    I+RD+KP+NIL+D
Sbjct: 443 LYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILID 502

Query: 515 YQGHIALCDFGLC----------------------------------------------K 528
            +GHI L DFGL                                                
Sbjct: 503 IRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATTKNGAPNDAGDGSNNRQTMIVDSIN 562

Query: 529 LNMKDQEKTTTF-----------CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGL 577
           L M ++++  T+            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G 
Sbjct: 563 LTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGW 622

Query: 578 PPYYDEDVPKMYKKIL--QDPLRFPDD--FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKS 633
           PP+  E   + Y+KI+  +  L+FP+D     +A+DL+  LL    +R     G+DEIKS
Sbjct: 623 PPFCSETPQETYRKIMNFEQTLQFPEDVHISYEAEDLIRRLLTHSNQRLGRQGGADEIKS 682

Query: 634 HPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNF 667
           HPFF  + W  ++      PY P +    DT  F
Sbjct: 683 HPFFRGVDWNTIRQ--VEAPYIPKLSSITDTRFF 714

>Scas_629.16
          Length = 918

 Score =  227 bits (579), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 176/302 (58%), Gaps = 30/302 (9%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           F+ +K++G+G  GKV  VR++ TN++YALK   KS ++ + ++   LAE+ +LA  ++PF
Sbjct: 519 FEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 578

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSR--SRFYTAELLCALEALHDF 499
           +V L  SFQS + LY  + +  GGE F  LQ      +S   +RFY +E+  ALE LH  
Sbjct: 579 VVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALEYLHLL 638

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQE----------------------KT 537
             IYRDLKPENILL   GHI L DF L  +  KD +                      +T
Sbjct: 639 GFIYRDLKPENILLHKSGHIMLSDFDLS-VQAKDAKVPVMKGSAESTVVDTKICSDGFRT 697

Query: 538 TTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPL 597
            +F GT EY+APE++ G G+T  VDWWTLG+L+YEML G  P+      + +  IL++ +
Sbjct: 698 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDV 757

Query: 598 RFP--DDFDKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPY 654
            FP  +D  ++ KDL+  LLC++  +RLG   G+ ++K HPFF ++ W  L+ +   PP 
Sbjct: 758 SFPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWSFLRNQE--PPL 815

Query: 655 KP 656
            P
Sbjct: 816 IP 817

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  227 bits (578), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/319 (37%), Positives = 187/319 (58%), Gaps = 36/319 (11%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           F+ ++++G+G  GKV  V+++ TN++YALK   KS ++ + ++   LAE+ +LA  ++PF
Sbjct: 497 FEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 556

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSR--SRFYTAELLCALEALHDF 499
           +V L  SFQS + LYL + +  GGE F  LQ      +S   ++FY +E+  ALE LH  
Sbjct: 557 VVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLL 616

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQE----------------------KT 537
             IYRDLKPENILL   GHI L DF L  +  KD +                      +T
Sbjct: 617 GFIYRDLKPENILLHQSGHIMLSDFDLS-IQAKDAKVPVVKGNAQSTVVDTKICSDGFRT 675

Query: 538 TTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPL 597
            +F GT EY+APE++ G G+T  VDWWTLG+L+YEML G  P+  E+  + +  IL+  +
Sbjct: 676 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDV 735

Query: 598 RFP--DDFDKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPY 654
            FP  ++  ++ KDL+  LL ++  +RLG   G+ +IK HPFF +++W  L+ +      
Sbjct: 736 TFPNNNEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQ------ 789

Query: 655 KPPVMGAMDTSNFDQEFTR 673
           +PP++  +  + +D  FT+
Sbjct: 790 EPPLIPVLTENGYD--FTK 806

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  215 bits (547), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 129/352 (36%), Positives = 191/352 (54%), Gaps = 48/352 (13%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIV-------------SKSEVT 425
           +DDF  ++ +G+G++GKV+ V+   ++K+YA+K ++K+ I+              +  + 
Sbjct: 167 LDDFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEKRIE 226

Query: 426 HTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFY 485
            T AERT+L+++++P IV L +SF  + KLYLVL +I GGELFYHL+ +G  D     FY
Sbjct: 227 RTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTVAFY 286

Query: 486 TAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTT------- 538
            AEL CAL+ LH   I+YRDLKPEN LL+ +GH+ L DFGL K ++ D   T        
Sbjct: 287 AAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGENVN 346

Query: 539 ---TFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD 595
              +  GTPEY APE+L G+ YT+  DW++LG L+Y+ML G PP+   +   +  KI Q+
Sbjct: 347 QLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNHKIILNKIKQE 406

Query: 596 P--LRFPDDFDKDAKDLLIGLLCRDP------------------KRRLGYHGSDEIKSHP 635
               R P       KD L  LL +DP                  K++ G   +     H 
Sbjct: 407 KTGARIPSYLSDGFKDYLGALLRKDPTKRWDVDKYWAQDGPKTKKKKAGQAKTTNYIGHF 466

Query: 636 FFNQLSWKRL----KMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVND 683
            F ++ WK+L      K  + P  P +       NFD EFT E+ +D+ + D
Sbjct: 467 IFRKIIWKQLLSGDLQKISVGPILPIITDWELAENFDTEFT-EKRLDTSIYD 517

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  218 bits (556), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/313 (37%), Positives = 179/313 (57%), Gaps = 32/313 (10%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           F+ ++++G+G  GKV  VR++ ++++YALK   K+ ++ + ++   LAE+ +LA  ++PF
Sbjct: 461 FEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIKRILAEQEILATSNHPF 520

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSR--SRFYTAELLCALEALHDF 499
           IV L  SFQ+ + LYL + +  GGE F  LQ      +S   +RFY +E+  ALE LH  
Sbjct: 521 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLM 580

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGL-----------CKLNMK----------DQEKTT 538
             IYRDLKPENILL   GH+ L DF L            K N +          D  +T 
Sbjct: 581 GFIYRDLKPENILLHQSGHVMLSDFDLSVQAKGTRNPQVKGNAQSSLVDTKVCSDGFRTN 640

Query: 539 TFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLR 598
           +F GT EY+APE++ G G+T  VDWWTLG+L YEML G  P+  ++  + +  IL++ + 
Sbjct: 641 SFVGTEEYIAPEVIRGNGHTASVDWWTLGILTYEMLFGFTPFKGDNTNQTFSNILKNDVY 700

Query: 599 FP--DDFDKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPYK 655
           FP  +D  +  KDL+  LL +   +RLG   G+ EIK HPFF  + W  L+ +      +
Sbjct: 701 FPNNNDISRTCKDLIKKLLVKKESKRLGSKFGASEIKKHPFFKTVQWALLRNQ------E 754

Query: 656 PPVMGAMDTSNFD 668
           PP++  +    +D
Sbjct: 755 PPLIPVLTEDGYD 767

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  216 bits (549), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 174/302 (57%), Gaps = 30/302 (9%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           F+ ++++G+G  G+V  VR++ TN++YALK   K  ++ + ++   L E+ +LA  ++PF
Sbjct: 379 FEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNHPF 438

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSR--SRFYTAELLCALEALHDF 499
           IV L  SFQ+ + LYL + +  GGE F  LQ      +S   +RFY++E+  ALE LH  
Sbjct: 439 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLM 498

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQE----------------------KT 537
             IYRDLKPENILL   GHI L DF L  +  KD +                      +T
Sbjct: 499 GFIYRDLKPENILLHQSGHIMLSDFDLS-VQAKDTKNPQVKGNASHSLVDTKICSDGFRT 557

Query: 538 TTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPL 597
            +F GT EY+APE++ G G+T  VDWWTLG+L+YEML G  P+  ++  + +  IL++ +
Sbjct: 558 NSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEV 617

Query: 598 RFPDDFD--KDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPY 654
             P++ +  +  KDL+  LL ++  +RLG   G+ +IK HPFF    W  L+ +   PP 
Sbjct: 618 VIPNNNETSRACKDLIRKLLIKNENKRLGSKLGASDIKKHPFFKNDQWSLLRNQE--PPL 675

Query: 655 KP 656
            P
Sbjct: 676 IP 677

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  208 bits (530), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 126/360 (35%), Positives = 188/360 (52%), Gaps = 65/360 (18%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIV-------SKSE------- 423
           ++ DF  ++V+G+G++GKV+ V+  +T+K+YA+K +RK+ I+       SK E       
Sbjct: 124 NLHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKREDEDKNDG 183

Query: 424 ------------VTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHL 471
                       +  T AER++L+ +++P IV L +SF  + KLYL+L +I GGELFYHL
Sbjct: 184 NNNDNDDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHL 243

Query: 472 QREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCK--- 528
           +  G  D +   FY AE+ CAL  LH   ++YRDLKPEN LL+ +GH+ L DFGL K   
Sbjct: 244 KEHGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSA 303

Query: 529 ----LNMKDQEKTT---TFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYY 581
               ++ +D E      +  GTPEY APE+LLG+ Y++  DW++LG LLY+ML G PPY 
Sbjct: 304 NDSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYT 363

Query: 582 DEDVPKMYKKILQDPL--RFPDDFDKDAKDLLIGLLCRDPKRR----------------- 622
             +   +  KI Q+    + P    +  KD+L  LL ++  +R                 
Sbjct: 364 GSNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETAKRWNVDKYWAKTGANNKPT 423

Query: 623 ------LGYHGSDEIKSHPFFNQLSWKRLK----MKGYIPPYKPPVMGAMDTSNFDQEFT 672
                  G   +     H  F ++ WK L+     K  + P  P +       NFD EFT
Sbjct: 424 KSKKKKSGAARTSLFTEHFIFRKIDWKLLESGQLQKTTLGPIVPVITDLELAENFDTEFT 483

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  209 bits (531), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 128/346 (36%), Positives = 186/346 (53%), Gaps = 52/346 (15%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKS---------------- 422
           ++DF  ++V+G+G++GKV+ V+ + T+K++A+K ++K+ IV  +                
Sbjct: 143 LEDFKPVRVLGRGAYGKVLLVKDQLTSKLFAMKQLKKAEIVVTAPEEESTDGEDAVLLPA 202

Query: 423 ----EVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFD 478
                V  T AERT+L+++++P IV L +SF    KLYLVL +I GGELFYHL+ +G  D
Sbjct: 203 VVEKRVERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLD 262

Query: 479 LSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCK--LNMKDQ-- 534
                FY AE+ CAL+ LH   I+YRDLKPEN LLD +GH+ L DFGL K  +N  D   
Sbjct: 263 EVTVSFYAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPL 322

Query: 535 -----EKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY 589
                E+  +  GTPEY APE+L GQ YT+  DW++LG L Y+ML G PP+   +   + 
Sbjct: 323 GGEQVEELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTGANHKVIL 382

Query: 590 KKILQDP-LRFPDDFDKDAKDLLIGLLCRDPKRR------------------LGYHGSDE 630
            KI QD  ++ P       KD L  LL +D  +R                   G   +  
Sbjct: 383 SKIKQDKGIKIPHYLSDGMKDYLNALLKKDIGKRWDVDRFWDKEGTKTKKKKAGQAKTSC 442

Query: 631 IKSHPFFNQLSWKRLK----MKGYIPPYKPPVMGAMDTSNFDQEFT 672
            +SH  F +++WK ++     +    P  P +       NFD EFT
Sbjct: 443 YQSHFIFRKINWKLMENGDLQRTTYGPIIPVITDWELAENFDSEFT 488

>Scas_720.103
          Length = 804

 Score =  211 bits (537), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 185/354 (52%), Gaps = 50/354 (14%)

Query: 350 NHHWIELESKMGKLNLSVDYKPSTHKHL--------------SIDDFDLLKVIGKGSFGK 395
           NH   E++    K   S+D +P   + L              +   F+ +K++G+G  GK
Sbjct: 359 NHTQSEVQISKDKRTYSIDSEPKRSQRLRNKSFGNKFQDIKVNPQSFEKIKLLGQGDVGK 418

Query: 396 VMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKL 455
           V  V+++ TN +YA+K   K  ++ + ++   + E+ +LA  ++PFIV L  SFQ+ + L
Sbjct: 419 VFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPFIVTLYHSFQTEDYL 478

Query: 456 YLVLAFINGGELFYHLQREGRFDLSR--SRFYTAELLCALEALHDFDIIYRDLKPENILL 513
           YL + +  GGE F  LQ      +    +RFY +E+L ALE LH    IYRDLKPENILL
Sbjct: 479 YLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLLGFIYRDLKPENILL 538

Query: 514 DYQGHIALCDFGLCKLNMKDQE----------------------------KTTTFCGTPE 545
              GHI L DF L  ++ KD +                            +T +F GT E
Sbjct: 539 HKSGHIMLSDFDLS-VHAKDSKNPIFMKDGILPTTNSNLIVDTKICSEGFRTNSFVGTEE 597

Query: 546 YLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP--DDF 603
           Y+APE++ G G+T  VDWWTLG+L++EML G  P+  +   + +  IL     FP  +D 
Sbjct: 598 YIAPEVIRGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFANILSKDFEFPNSNDI 657

Query: 604 DKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPYKP 656
            ++ K+L+  LL ++  +RLG   G+ EIK H FF  ++W  L+ +   PP  P
Sbjct: 658 TRNCKNLIKKLLTKNETKRLGSKMGAAEIKKHSFFKNVNWNMLRNEE--PPLIP 709

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  206 bits (523), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 183/364 (50%), Gaps = 70/364 (19%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIV------------------- 419
           I DF  ++V+G+G++GKV+ V+ + T+K+YA+K ++K+ I+                   
Sbjct: 142 ISDFKPIRVLGQGAYGKVILVKDKQTSKLYAMKQLKKAEILIAPTDANTESMDKLAELDK 201

Query: 420 ---SKSE-----VTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHL 471
              S+ E     +  T AERT+L+++++P IV L +SF  + KLYL+L +I GGELF+HL
Sbjct: 202 PVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHL 261

Query: 472 QREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNM 531
           +  G  +     FY AE+ CAL+ LH   ++YRDLKPEN LL+  GH+ L DFGL K + 
Sbjct: 262 KEHGTLEEDTVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSA 321

Query: 532 --------------KDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGL 577
                         +D  +  +  GTPEY APE+LLGQ YT   DW++LG LLY+MLTG 
Sbjct: 322 SNASQEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGK 381

Query: 578 PPYYDEDVPKMYKKILQDPL--RFPDDFDKDAKDLLIGLLCRDPKRR------------- 622
           PPY   +   +  KI  D    + P       KD+L  LL  DPK+R             
Sbjct: 382 PPYTGANHKVIANKIKNDKQGPKIPYYLSDGMKDVLGALLKSDPKKRWDVDKYWSEPKKD 441

Query: 623 ----------LGYHGSDEIKSHPFFNQLSWKRLK----MKGYIPPYKPPVMGAMDTSNFD 668
                          +   +SH  F ++ WK L           P  P +       NFD
Sbjct: 442 NSQKKGQKKKKSKERTSPFQSHFVFRKVDWKGLSSGELQNTTFGPIVPVITDWELAENFD 501

Query: 669 QEFT 672
            EFT
Sbjct: 502 SEFT 505

>Scas_593.14d
          Length = 495

 Score =  201 bits (512), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 118/303 (38%), Positives = 178/303 (58%), Gaps = 38/303 (12%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIV------SKSE-------- 423
           ++ DF  ++V+G+G++GKV+ V+ + TNK+YA+K ++K+ I+      S  E        
Sbjct: 132 TVKDFRPVRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 424 VTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSR 483
           +  T AE+++LA +++P IV L +SF  + KLYL+L +I GGELF+HL+ +G  D     
Sbjct: 192 IERTFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVA 251

Query: 484 FYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCK--------------- 528
           FY AE+ CAL+ LHD  I+YRDLKPEN LL+ +GH+ L DFGL K               
Sbjct: 252 FYAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTS 311

Query: 529 LNMKDQEKTT--TFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP 586
           LN   ++ +T  +  GTPEY APE+L G  Y K  DW++LG L+Y+ML+G PPY   +  
Sbjct: 312 LNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKPPYTGANHK 371

Query: 587 KMYKKILQDPL--RFPDDFDKDAKDLLIGLLCRDPKRRL---GYHGSDEIKSHPFFNQLS 641
            +  KI +D    + P    +  KD+L  LL +D  +R     Y  ++ IK+    NQ+ 
Sbjct: 372 VILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKRWDVDKYWAAEPIKNGK--NQMK 429

Query: 642 WKR 644
            K+
Sbjct: 430 KKK 432

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score =  177 bits (450), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/268 (36%), Positives = 154/268 (57%), Gaps = 4/268 (1%)

Query: 370 KPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA 429
           K + +  LS+ DF++ + +GKG FGKV  VR + +  I ALKAI K+ I+  + +     
Sbjct: 88  KSTYNNKLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKR 147

Query: 430 ERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAEL 489
           E  +   +D+P I+ L   F   +++YL++     GEL+  L+  G F+   +  Y  ++
Sbjct: 148 EVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQI 207

Query: 490 LCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAP 549
             AL  +H   II+RD+KPEN+L+ +   + L DFG   LN  +  K  T CGT +YL+P
Sbjct: 208 ADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILN-PEGSKRKTLCGTIDYLSP 266

Query: 550 ELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKD 609
           E++  + Y + VD W LGVL YE++ G+PP+ +      YK+IL+  L FP+   KDAKD
Sbjct: 267 EMITPREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDLNFPESISKDAKD 326

Query: 610 LLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
           L+  LL  D  +RL   G   +K+HP+ 
Sbjct: 327 LISKLLVTDTTQRLSLTG---VKTHPWI 351

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score =  174 bits (441), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/274 (35%), Positives = 162/274 (59%), Gaps = 8/274 (2%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 434
           +++++ DF++ K++GKG FGKV  V+ R+T  I ALKA+ K  IV  +       E  + 
Sbjct: 93  ENMTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQ 152

Query: 435 ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
               +  +  L   F   +++YL++ ++  GEL+  L+  G  + + + ++  ++  AL+
Sbjct: 153 GSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALD 212

Query: 495 ALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG 554
            +H  +I++RD+KPENIL+ +   I L DFG    N +D +K  T CGT +YL+PEL+  
Sbjct: 213 YMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYN-EDGQKRKTLCGTIDYLSPELIKS 271

Query: 555 QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM-YKKILQDPLRFPDDFDKDAKDLLIG 613
           + Y   VD W LGVL YE+L G PP ++ED  +M Y++IL+  L+FP +    A+DL++ 
Sbjct: 272 REYNNKVDVWALGVLTYELLVGSPP-FEEDTKEMTYRRILRCDLKFPLNVSPQARDLIVR 330

Query: 614 LLCRDPKRRLGYHGSDEIKSHPFF--NQLSWKRL 645
           LL  +P +R+      E+KSH +   N+ SW  L
Sbjct: 331 LLQFEPSKRIPL---SEVKSHAWIANNRGSWTDL 361

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score =  173 bits (439), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 155/268 (57%), Gaps = 4/268 (1%)

Query: 372 STHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER 431
           S  ++L + DF++ KV+GKG FG+V  VR  ++  + ALKA+ K  I+  +       E 
Sbjct: 99  SKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREV 158

Query: 432 TVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLC 491
            + + + +P +  L   F   +++YL++ ++  GEL+ HL+    F+   + +Y  ++  
Sbjct: 159 EIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMAD 218

Query: 492 ALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPEL 551
           AL+ +H+ +I++RD+KPENI++ +   I L DFG   +  K   K  T CGT +YL+PEL
Sbjct: 219 ALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGS-KRKTLCGTVDYLSPEL 277

Query: 552 LLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLL 611
           +  + Y + VD W LGVL YE+L G PP+ +E     YK+IL+  L FPD  D +A+ L+
Sbjct: 278 IRSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLI 337

Query: 612 IGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
             LL  DP  R+      E+K HP+  +
Sbjct: 338 SRLLEYDPGDRIPL---KEVKKHPWIEK 362

>Kwal_56.24091
          Length = 381

 Score =  167 bits (422), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 158/269 (58%), Gaps = 4/269 (1%)

Query: 371 PSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAE 430
           P  ++ +S+DDF++ K +GKG FGKV  V+ + T  I ALKA++KS IV  +       E
Sbjct: 112 PVHYQDISLDDFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRRE 171

Query: 431 RTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELL 490
             + + + +P +  L   F   +++YL++ ++  GEL+ HL+  G F+   +  +  ++ 
Sbjct: 172 VEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMA 231

Query: 491 CALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPE 550
            AL  +H  +I++RD+KPENILL +Q  + L DFG    N+ +  K  T CGT +YL+PE
Sbjct: 232 DALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGN-SKRKTLCGTMDYLSPE 290

Query: 551 LLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDL 610
           L+  + Y   VD W LGVL YE+L G PP+ ++     YK+I++  LRFPD     A+DL
Sbjct: 291 LIKSREYDNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFPDQVSPHARDL 350

Query: 611 LIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
           +  LL  DP+ R+      ++K HP+  +
Sbjct: 351 ISRLLEYDPQNRIPL---KDVKRHPWIKK 376

>Scas_705.23
          Length = 553

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/395 (29%), Positives = 185/395 (46%), Gaps = 78/395 (19%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF+++  +G+G +G+V   RKRDT ++ ALK + K  +   +E  H L ER +L    + 
Sbjct: 157 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLFKLNETNHVLTERDILTTTRSD 216

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRF-DLSRSRFYTAELLCALEALHDF 499
           ++V L ++FQ +E LYL + F+ GG+ F  L    RF   + +RFY +E+ CA+ ALH+ 
Sbjct: 217 WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLC----------------------------KLNM 531
              +RDLKPEN L+D +GHI L DFGL                             + ++
Sbjct: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335

Query: 532 KDQEKTTT------------FCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPP 579
           +D+ K  T              G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P
Sbjct: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395

Query: 580 YYDEDVPKMY------KKILQDPL--RFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEI 631
           +      + Y      KK L+ P+       F     D++  L+  DP  RL     + I
Sbjct: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEHI 452

Query: 632 KSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFD------------QEFTREQPVDS 679
           K  P+F ++++  L+     PP+ P +    D   FD              F R+  + S
Sbjct: 453 KRMPYFAEVNFNTLRQSA--PPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSS 510

Query: 680 VVND-----------FLSESVQQQFGGWTYVGSEQ 703
           +V+D           F   + Q+   G  Y GSE 
Sbjct: 511 MVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEH 545

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  167 bits (422), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 165/353 (46%), Gaps = 56/353 (15%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF+++  +G+G +G+V   RKRDT ++ ALK + K  +V  +E  H L ER +L    + 
Sbjct: 170 DFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLVKLNETNHILTERDILTTTRSE 229

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
           ++V L ++FQ  E LYL + F+ GG+    L          +RFY +E+ CA+ ALH+  
Sbjct: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 527
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349

Query: 528 -------KLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580
                   L   D     +  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409

Query: 581 YDEDVPKMY------KKILQDPLRFPDDFDKDAKDL---LIGLLCRDPKRRLGYHGSDEI 631
                 + Y      K+ L+ P  F +D      D    LI  L  DP  RL     + +
Sbjct: 410 SGSSTNETYENLRHWKRTLRRP--FLNDGRSAISDRAWELITRLIADPINRL--RSFEHV 465

Query: 632 KSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDF 684
           K   +F+++++  L+     PP+ P +    D   FD +FT E  +    + F
Sbjct: 466 KRMNYFHEINFDTLRQLS--PPFTPQLDNETDAGYFD-DFTNEADMAKYADVF 515

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  166 bits (421), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 153/276 (55%), Gaps = 10/276 (3%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT---VLARV 437
           DF   + +G GS+  V +   R T +++A+K   K +I+S+++V +   E+    +LA  
Sbjct: 9   DFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHG 68

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           ++P I+ L ++F  SE LY VL F  GGEL   LQ +GRF+ + ++ +  +L+ ALE +H
Sbjct: 69  NHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIH 128

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQ-EKTTTFCGTPEYLAPELLLGQ 555
              +++RDLKPEN+LL  +G + + DFG+   L   D    T++F GT EY++PELLL  
Sbjct: 129 GCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELLLQN 188

Query: 556 GYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLL 615
                 D W +G +LY+   G PP+  E+    ++KI+     +     +   DL+  +L
Sbjct: 189 KSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKIL 248

Query: 616 CRDPKRRLGYHGSDEIKSHPFFNQLSW--KRLKMKG 649
             DP  R   +   +IK+H +F  + W  K L  KG
Sbjct: 249 VLDPDSR---YTLPQIKNHAWFQGIDWTNKELIWKG 281

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  165 bits (418), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/342 (30%), Positives = 162/342 (47%), Gaps = 54/342 (15%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF+++  +G+G +G+V   RK+DT ++ ALK + K  +   +E  H L ER +L    + 
Sbjct: 176 DFEMITQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSE 235

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
           ++V L ++FQ  + LYL + F+ GG+    L          +RFY +E+ CA+ ALHD  
Sbjct: 236 WLVKLLYAFQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLG 295

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 527
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 296 YTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIE 355

Query: 528 -------KLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580
                  +L  K+     +  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 356 DRRKMYNQLREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 415

Query: 581 YDEDVPKMYKKI--LQDPLRFPDDFDKDAK------DLLIGLLCRDPKRRLGYHGSDEIK 632
                 + Y  +   +  LR P   D  A       DL+  L+  DP  RL     + +K
Sbjct: 416 SGSSTNETYDNLRRWKQTLRRPRQSDGRAAFSDRTWDLITRLIA-DPINRL--RSFEHVK 472

Query: 633 SHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTRE 674
              +F  +++  L  +  IPP+ P +    D   FD +FT E
Sbjct: 473 RMSYFADINFSTL--RSMIPPFTPQLDSETDAGYFD-DFTSE 511

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  163 bits (412), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 165/352 (46%), Gaps = 52/352 (14%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           +DF++L  +G+G +G+V   RKRDT ++ ALK + K  +   +E  H L ER +L    +
Sbjct: 142 NDFEMLTQVGQGGYGQVYLARKRDTKEVCALKILNKKLLHRLNETNHVLTERDILTTTRS 201

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
            ++V L ++FQ S  LYL + F+ GG+    L        + +RFY +E+ CA+ ALH+ 
Sbjct: 202 EWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLLINTKYLKSTHARFYISEMFCAVNALHEL 261

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLCK------------------------------- 528
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 262 GYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERPI 321

Query: 529 ---------LNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPP 579
                    L   D     +  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L    P
Sbjct: 322 EDRRKMYHDLRDTDINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVSFTP 381

Query: 580 YYDEDVPKMYKKI--LQDPLRFPDDFD-----KDAKDLLIGLLCRDPKRRLGYHGSDEIK 632
           +      + Y+ +   +  LR P   +      D     I  L  DP  RL     + +K
Sbjct: 382 FSGATTNETYENLRHWRKTLRRPRLGNGRYAVSDRTWAFITSLIADPINRL--KSFEHVK 439

Query: 633 SHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDF 684
             P+F+++ + +L+     PP+ P +   +D   FD +FT E  +    + F
Sbjct: 440 RMPYFSEIDFSKLREMS--PPFIPQLDSEVDAGYFD-DFTNEADMAKYADVF 488

>Kwal_23.3992
          Length = 571

 Score =  163 bits (412), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 105/344 (30%), Positives = 164/344 (47%), Gaps = 58/344 (16%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF+++  +G+G +G+V   RKRDT +I ALK + K  ++  +E  H L ER +L    + 
Sbjct: 175 DFEMITQVGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSE 234

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
           ++V L ++FQ    LYL + F+ GG+    L          +RFY +E+ CA++ALH   
Sbjct: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 527
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354

Query: 528 -------KLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580
                   L   D    ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414

Query: 581 YDEDVPKMY------KKILQDPL----RFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDE 630
                 + Y      K++L+ P     R+   F     DL+I L+  DP  RL     + 
Sbjct: 415 SGSSTNETYENLRCWKQVLRRPRCDNGRYA--FSDRTWDLIIRLIA-DPISRL--RSFEH 469

Query: 631 IKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTRE 674
           +K   +F ++S++ L  +   PP+ P +    D   FD +FT E
Sbjct: 470 VKKMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSE 510

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  162 bits (411), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 154/281 (54%), Gaps = 17/281 (6%)

Query: 377 LSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 436
           + I DF   + +G GS+  V+    RD+ K YA+K + K Y++ + +V +   E+  L +
Sbjct: 120 MGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQK 179

Query: 437 VD-NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEA 495
           ++    I  L F+FQ    LY +L +   G+    +++ G  + + +R+Y ++++ A+++
Sbjct: 180 LNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDS 239

Query: 496 LHDFDIIYRDLKPENILLDYQGHIALCDFGLCKL------NMKDQE-------KTTTFCG 542
           LH+  II+RD+KPENILLD    + L DFG  K+      N  D +       K+ +F G
Sbjct: 240 LHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG 299

Query: 543 TPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDD 602
           T EY++PELL         D W  G +LY+ML G PP+   +    ++K+++    F   
Sbjct: 300 TAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAG 359

Query: 603 FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
           F +  KDL+  LL RDP  RL      +IK+H FF++++++
Sbjct: 360 FPQIVKDLVKKLLVRDPNDRLTIK---QIKAHLFFHEVNFE 397

>Scas_627.7
          Length = 349

 Score =  154 bits (390), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 154/267 (57%), Gaps = 6/267 (2%)

Query: 372 STHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER 431
           S  K LS+DDF++ K +GKG FGKV  VR ++T  I ALK + K+ IV  +       E 
Sbjct: 81  SPPKPLSLDDFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREV 140

Query: 432 TVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRF-DLSRSRFYTAELL 490
            +   +++P +  L   F   +++YL++ ++  GEL+  L+  G F D+  SRF   ++ 
Sbjct: 141 EIQTSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRF-VFQIA 199

Query: 491 CALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPE 550
            AL  LHD  II+RDLKPENIL+ +   I L DFG   +N +   K  T CGT +YL+PE
Sbjct: 200 DALNYLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPRGV-KRKTLCGTIDYLSPE 258

Query: 551 LLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDL 610
           ++  + Y   VD W LGVL YE++ G PP+ ++     YK+IL++ ++FP+    D KDL
Sbjct: 259 MIRSREYDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHDVKDL 318

Query: 611 LIGLLCRDPKRRLGYHGSDEIKSHPFF 637
           +  LL  +P  R+      ++  HP+ 
Sbjct: 319 ISKLLKYNPSERISMR---DVMKHPWI 342

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  161 bits (407), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 157/297 (52%), Gaps = 17/297 (5%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 438
           I+DF   + +G GS+  V+     ++NK YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 152 INDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLK 211

Query: 439 N-PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           N   I+ L F+FQ    LY +L +   G+L   +++ G  +   +++Y A+++ AL  +H
Sbjct: 212 NTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMH 271

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQE---------KTTTFCGTPEYLA 548
           D  +I+RDLKPENILLD    + L DFG  +L     E         ++ +F GT EY++
Sbjct: 272 DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVS 331

Query: 549 PELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAK 608
           PELL         D W  G +L++M+ G PP+   +    ++K+++    F   F    +
Sbjct: 332 PELLNDNYVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAGFPMTVR 391

Query: 609 DLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTS 665
           DL+  +L ++P+RRL     ++IK+H FF  +++      G +    PP +G    S
Sbjct: 392 DLVKNILIKNPERRLLI---NQIKAHQFFADVNFG----NGSVWDKDPPELGPYKVS 441

>Kwal_56.22693
          Length = 984

 Score =  159 bits (402), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 149/273 (54%), Gaps = 12/273 (4%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV- 437
           I DF   +V+G GS+  VM  R  D+ K YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 155 IKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLN 214

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           D   ++ L F+FQ    LY +L +   G+    +++ G      + +Y+A++L A++ LH
Sbjct: 215 DGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQ--------EKTTTFCGTPEYLAP 549
              I++RD+KPENILLD    + L DFG  ++  KD+        E++ +F GT EY++P
Sbjct: 275 HKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSP 334

Query: 550 ELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKD 609
           ELL         D W  G +L++M+ G PP+   +    ++K+++    F   F    +D
Sbjct: 335 ELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRD 394

Query: 610 LLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSW 642
           L+  +L + P++RL    + +IK H FF  +++
Sbjct: 395 LIKKILVKSPEQRL---DASQIKKHHFFKDVNF 424

>Scas_660.20
          Length = 957

 Score =  158 bits (400), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 155/282 (54%), Gaps = 25/282 (8%)

Query: 381 DFDLLKVIGKGSFGKVMQ-VRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT---VLAR 436
           DF   + +G GS+  V + + KR+T +I+A+K   K++I+ +S+V +   E+    +LA+
Sbjct: 10  DFIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAK 69

Query: 437 VDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEAL 496
             +P IV L ++F   E LY VL ++ GGEL   L +   F    S+ +T +L+  LE +
Sbjct: 70  AHHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFI 129

Query: 497 HDFDIIYRDLKPENILLDYQGHIALCDFGLCKL----NMKDQEKTTTFCGTPEYLAPELL 552
           H   +I+RDLKPEN+LLD  G + + DFG        N    + +++F GT EY++PELL
Sbjct: 130 HSQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELL 189

Query: 553 LGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP--------DDFD 604
           L    +   D W LG ++++ +TG PP+  E+  K ++KI+   L +P        + F 
Sbjct: 190 LHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVA--LDYPWSSTNIHNNKFL 247

Query: 605 KDAKDLLIGL----LCRDPKRRLGYHGSDEIKSHPFFNQLSW 642
            +   L+I L    L  +PK RL      +IK  P+F  ++W
Sbjct: 248 NNINPLIINLVRKILVLEPKDRLSL---KKIKQDPWFATVNW 286

>Scas_716.33
          Length = 573

 Score =  155 bits (392), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 104/343 (30%), Positives = 164/343 (47%), Gaps = 56/343 (16%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF+++  +G+G +G+V   RK+DTN++ ALK + K  +   +E  H L ER +L    + 
Sbjct: 177 DFEMITQVGQGGYGQVYLARKKDTNEVCALKILNKKLLFKLNETNHVLTERDILTTTRSQ 236

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRF-DLSRSRFYTAELLCALEALHDF 499
           ++V L ++FQ ++ LYL + F+ GG+ F  L    RF   + +RFY +E+  A+ ALHD 
Sbjct: 237 WLVKLLYAFQDTQNLYLAMEFVPGGD-FRTLLINTRFLKSTHARFYISEMFLAVNALHDL 295

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLC-------------------------------- 527
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 296 GYTHRDLKPENFLIDAKGHIKLTDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDKSI 355

Query: 528 ----KLNMKDQEKTTTFC----GTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPP 579
               ++  K +E    +     G+P+Y+A E+L G+ Y   VD+W+L  +L+E L G  P
Sbjct: 356 EDRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGYTP 415

Query: 580 YYDEDVPKMY------KKILQDPL--RFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEI 631
           +      + Y      KK L+ P+       F     D +  L+  DP  RL     + +
Sbjct: 416 FSGSSTNETYENLRHWKKTLRRPMLDNGRPAFSDRTWDFITRLIA-DPINRL--RSFEHV 472

Query: 632 KSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTRE 674
           K   +F  + +  L  +   PP+ P +    D   FD +FT E
Sbjct: 473 KRMTYFESVDFNTL--RDLSPPFIPQLDNETDAGYFD-DFTNE 512

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  157 bits (398), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 158/302 (52%), Gaps = 37/302 (12%)

Query: 373 THKHLSIDDFDLLKVIGKGSFGKVMQ-VRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER 431
           T +  S  DF   + +G GS+  V + + K+  NKIYA+K   K +I+ +++V +   E+
Sbjct: 2   TSRKRSPHDFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEK 61

Query: 432 T---VLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAE 488
               +LA+  +  I+ L ++F   E LY VL F  GGEL   L + G F+   +R +TA+
Sbjct: 62  NTMNLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQ 121

Query: 489 LLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGL------------CKLN-----M 531
           L+ ALE +H   II+RDLKPEN+LLD  G + + DFG              K N      
Sbjct: 122 LIDALEFIHSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGS 181

Query: 532 KDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK 591
           KD +   +F GT EY++PELLL        D W LG ++Y+ + G PP+  E+  K ++K
Sbjct: 182 KDNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRGENELKTFEK 241

Query: 592 ILQDPLRFP-------DDFDKDAKDLLIGLLCR----DPKRRLGYHGSDEIKSHPFFNQL 640
           I+   L +P       ++       L+I L+ +    +   R+     ++IK HP+F+++
Sbjct: 242 IVA--LDYPWGPNNRINNSTSPINPLVINLVQKILVIEVNERISL---EQIKRHPYFSKV 296

Query: 641 SW 642
            W
Sbjct: 297 DW 298

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  153 bits (387), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 162/351 (46%), Gaps = 52/351 (14%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF+++  +G+G +G+V   RK+DT +I ALK + K  ++      H L ER +L    + 
Sbjct: 171 DFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSE 230

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
           ++V L ++FQ  + LYL + F+ GG+    L          +RFY +E+ CA+ ALH   
Sbjct: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 527
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350

Query: 528 -------KLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580
                  KL  ++     +  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410

Query: 581 YDEDVPKMY------KKILQDPLRFPDDFD-KDAKDLLIGLLCRDPKRRLGYHGSDEIKS 633
                 + Y      K +LQ P      +   D    LI  L  DP  RL     + +K 
Sbjct: 411 SGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRL--KSFEHVKR 468

Query: 634 HPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDF 684
             +F+++ +  L+     PP+ P +    D   FD +FT E+ +   V+ F
Sbjct: 469 MRYFSEIDFNTLRTIH--PPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  154 bits (389), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 149/277 (53%), Gaps = 12/277 (4%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT-- 432
           K  S  DF   + +G GS+  V +V +R +   YA+K   K +I+ +++V +   E+   
Sbjct: 3   KRKSPHDFLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTL 62

Query: 433 -VLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLC 491
            +L + ++P I+ L ++F   E LY V+    GGEL   L+R+  F  + +R Y  +L+ 
Sbjct: 63  NLLGQANHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVD 122

Query: 492 ALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQ-----EKTTTFCGTPE 545
            +E +H   +I+RDLKPEN+LLD +G + + DFG    +   D      +  T+F GT E
Sbjct: 123 TVEYIHSMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAE 182

Query: 546 YLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDK 605
           Y++PELLL        D W LG +LY+ L G PP+  ++  + +++I+     +    + 
Sbjct: 183 YVSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANP 242

Query: 606 DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSW 642
            A  L+  +L  DP +R   +  ++IK H +F+ + W
Sbjct: 243 LAAGLVSKILVLDPSQR---YTLEQIKKHKWFSGVDW 276

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  154 bits (389), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 104/148 (70%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           DDF+ +KVIGKG+FG+V  V+K+DT KIYA+K + KS + +K ++ H  AER VLA  D+
Sbjct: 301 DDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAERDVLAGSDS 360

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
           P++V L +SFQ S+ LYL++ F+ GG+L   L R   F    +RFY AE + A+E +H  
Sbjct: 361 PWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEVIHKL 420

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLC 527
             I+RD+KP+NIL+D +GHI L DFGL 
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLS 448

 Score =  107 bits (267), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (60%), Gaps = 8/132 (6%)

Query: 541 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QDPLR 598
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  +  L+
Sbjct: 531 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 590

Query: 599 FPDD--FDKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPYK 655
           FPDD     +A+DL+  LL    + RLG H G+DEIK+HPFF+ + W  ++      PY 
Sbjct: 591 FPDDIHISYEAEDLIRRLLTHS-ENRLGRHGGADEIKAHPFFSGVDWNTIRQVE--APYI 647

Query: 656 PPVMGAMDTSNF 667
           P +    DT  F
Sbjct: 648 PKLSSVTDTRFF 659

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  151 bits (382), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 163/351 (46%), Gaps = 52/351 (14%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           DF+++  +G+G +G+V   RK+DT +I ALK + K+ +   +   H L ER +L    + 
Sbjct: 181 DFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSE 240

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
           ++V L ++FQ    LYL + F+ GG+    L          +RFY +E+ CA++ALH   
Sbjct: 241 WLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLG 300

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 527
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 301 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMD 360

Query: 528 ---KLNMKDQEKTTTFC----GTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580
              K+  + +EK   +     G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 361 YRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 420

Query: 581 YDEDVPKMYKKI--LQDPLRFPDDFD-----KDAKDLLIGLLCRDPKRRLGYHGSDEIKS 633
                 + Y+ +   +  LR P   +      D    LI  L  DP  RL     + +K 
Sbjct: 421 SGSSSNETYENLRRWKQVLRRPRCENGRPAFSDRTWELITRLIADPINRL--RSFEHVKK 478

Query: 634 HPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDF 684
             +F ++ +  L+     PP+ P +    D   FD +FT E  +    + F
Sbjct: 479 MKYFAEIDFANLRSMS--PPFIPQLDSETDAGYFD-DFTNEADMAKYADVF 526

>Kwal_33.14554
          Length = 714

 Score =  153 bits (386), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 103/148 (69%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           +DF  +KVIGKG+FG+V  V+K+DT KIYA+K + KS +  K ++ H  AER VLA  D+
Sbjct: 301 EDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 360

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
           P++V L +SFQ ++ LYL++ F+ GG+L   L R   F    +RFY AE + A+EA+H  
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 420

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLC 527
             I+RD+KP+NIL+D +GHI L DFGL 
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLS 448

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (59%), Gaps = 8/132 (6%)

Query: 541 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QDPLR 598
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  +  L+
Sbjct: 529 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 588

Query: 599 FPDD--FDKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPYK 655
           FPDD     +A+DL+  LL     +RLG H G+DEIKSHPFF  + W  ++      PY 
Sbjct: 589 FPDDIHISYEAEDLIRRLLTH-ADQRLGRHGGADEIKSHPFFRGVDWNTIRQ--VEAPYI 645

Query: 656 PPVMGAMDTSNF 667
           P +    DT  F
Sbjct: 646 PKLSSITDTRFF 657

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  152 bits (385), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 73/147 (49%), Positives = 103/147 (70%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           +DF  +KVIGKG+FG+V  V+K+DT KIYA+K + KS +  K ++ H  AER VLA  D+
Sbjct: 308 EDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 367

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
           P++V L +SFQ ++ LYL++ F+ GG+L   L R   F    +RFY AE + A+EA+H  
Sbjct: 368 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 427

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGL 526
             I+RD+KP+NIL+D +GHI L DFGL
Sbjct: 428 GFIHRDIKPDNILIDIRGHIKLSDFGL 454

 Score =  110 bits (274), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 79/131 (60%), Gaps = 7/131 (5%)

Query: 541 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QDPLR 598
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  +  L 
Sbjct: 532 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLV 591

Query: 599 FPDD--FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKP 656
           FPDD     +A+DL+  LL      RLG HG++EIK+HPFF  + W+ ++  G   PY P
Sbjct: 592 FPDDIHISYEAEDLIRRLLSH-ADERLGRHGANEIKNHPFFRGVDWETIRQVG--APYIP 648

Query: 657 PVMGAMDTSNF 667
            +    DT  F
Sbjct: 649 KLSSVTDTRFF 659

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score =  154 bits (388), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 153/271 (56%), Gaps = 9/271 (3%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKS--EVTHTLAERTVLA 435
           ++  + L K +GKGS G+V   +  +T K+ A+K + K ++ S    ++ + +    ++ 
Sbjct: 69  TVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREIIIM 128

Query: 436 R-VDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
           + + +P ++ L   +++  +LYLVL ++ GGELF +L  +G+   S +  Y  +++ A+ 
Sbjct: 129 KLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVA 188

Query: 495 ALHDFDIIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL 553
             H F+I +RDLKPEN+LLD +   I + DFG+  L   D+   T+ CG+P Y +PE++L
Sbjct: 189 YCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETS-CGSPHYASPEIVL 247

Query: 554 GQGY-TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLI 612
           G+ Y     D W+ G++L+ +LTG  P+ D++V K+  K+     + P     +AKDL+ 
Sbjct: 248 GRKYHGSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQWLSVEAKDLIS 307

Query: 613 GLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
            +L  DP RR+     D+I  H    +   K
Sbjct: 308 RILVVDPNRRITI---DQILQHELLTKYDQK 335

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  152 bits (385), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 147/276 (53%), Gaps = 14/276 (5%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 438
           I DF   + +G GS+  V+     ++ K YA K + K Y++ + +V +   E+  L R++
Sbjct: 197 IKDFKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLN 256

Query: 439 N---PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEA 495
           +   P ++ L F+FQ    LY +L +   G+    ++R G      +++Y A++L A+  
Sbjct: 257 SSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIHH 316

Query: 496 LHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQE--------KTTTFCGTPEYL 547
           LH   II+RD+KPENILLD    I L DFG  KL  ++ E        ++ +F GT EY+
Sbjct: 317 LHKQGIIHRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYV 376

Query: 548 APELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDA 607
           +PELL         D W  G +L++M+ G PP+   +    ++K+++    F   F    
Sbjct: 377 SPELLNDNYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMIL 436

Query: 608 KDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
           +DL+  LL + P++RL      +I+ H FFN ++++
Sbjct: 437 RDLIKQLLVKKPEQRLTIL---QIEKHHFFNDINFR 469

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  152 bits (383), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 91/307 (29%), Positives = 158/307 (51%), Gaps = 30/307 (9%)

Query: 379 IDDFDLLKVIGKGSFGKV-MQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV 437
           I DF    ++G GS+ +V +   K D++K YA+K + K Y++ + +V +   E+T L  +
Sbjct: 115 IKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNL 174

Query: 438 DN-PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEAL 496
            +   ++ L F+FQ    LY +L +   G+    +++ G  +   + +Y+A+++ A+ ++
Sbjct: 175 KSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIYYSAQIIDAIGSM 234

Query: 497 HDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEK-----------TTTFCGTPE 545
           H   II+RD+KPENILLD    I L DFG  KL  K  +K           +++F GT E
Sbjct: 235 HSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAE 294

Query: 546 YLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDK 605
           Y++PELL         D W  G L+Y+M+ G PP+   +    ++K+++    F   F  
Sbjct: 295 YVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPT 354

Query: 606 DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLS------WKR--LKMKGY------I 651
             +DL+  +L + P++RL      +IK H  F  ++      W R   K+  Y      +
Sbjct: 355 IIRDLVKNILVKQPEKRLTI---PQIKEHCLFENINFSDNSVWNRDPPKILPYRINAKSM 411

Query: 652 PPYKPPV 658
            P+ PP+
Sbjct: 412 QPFSPPI 418

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  152 bits (384), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 149/273 (54%), Gaps = 23/273 (8%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT----- 432
           ++  + L K +GKGS G+V   +   + K+ A+K      IV K  V H   + T     
Sbjct: 57  TVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIK------IVPKRNVRHNQKQVTALPYG 110

Query: 433 ------VLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYT 486
                 ++  + +P I+ L   +++  +LYLVL ++ GGELF +L   G+     +  Y 
Sbjct: 111 IEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYF 170

Query: 487 AELLCALEALHDFDIIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQEKTTTFCGTPE 545
            +++  +   H+F+I +RDLKPEN+LLD +   + + DFG+  L   ++   T+ CG+P 
Sbjct: 171 KQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETS-CGSPH 229

Query: 546 YLAPELLLGQGY-TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFD 604
           Y +PE+++GQ Y     D W+ G++L+ +LTG  P+ D++V K+  K+     + P +  
Sbjct: 230 YASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSNVS 289

Query: 605 KDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
           K+AKDL+  +L  DP++R+     D+I  HP  
Sbjct: 290 KEAKDLISKILVVDPEKRITV---DKILEHPLL 319

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  152 bits (383), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 150/277 (54%), Gaps = 15/277 (5%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 438
           I DF   +++G G++  VM    +D+ K YA+K + K Y++ + +V +   E+  L R++
Sbjct: 179 IKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLN 238

Query: 439 NPF-IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           N   IV L F+FQ    LY +L +   G+    +++ G      +R+Y+A+++  ++ LH
Sbjct: 239 NSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLH 298

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQE----------KTTTFCGTPEY 546
              II+RD+KPENILLD    + + DFG  K L  K+++          ++ +F GT EY
Sbjct: 299 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEY 358

Query: 547 LAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKD 606
           ++PELL         D W  G ++++M+ G PP+   +    ++K+++    F   F   
Sbjct: 359 VSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV 418

Query: 607 AKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
            +DL+  +L + P++RL      +I+ H F+  +S++
Sbjct: 419 VRDLVKRILLKVPEQRLTI---PQIEKHHFYKDISFE 452

>Scas_654.12
          Length = 737

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 101/148 (68%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           +DF  +KVIGKG+FG+V  V+K DT KIYA+K + KS +  K ++ H  AER VLA  D+
Sbjct: 317 EDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 376

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
           P++V L +SFQ ++ LYL++ F+ GG+L   L R   F    +RFY AE + A+E +H  
Sbjct: 377 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 436

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLC 527
             I+RD+KP+NIL+D +GHI L DFGL 
Sbjct: 437 GFIHRDIKPDNILIDIRGHIKLSDFGLS 464

 Score =  107 bits (267), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (59%), Gaps = 8/132 (6%)

Query: 541 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QDPLR 598
            GTP+Y+APE+ L QGY +  DWW+LG ++YE L G PP+  E   + Y+KI+  +  L+
Sbjct: 548 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 607

Query: 599 FPDD--FDKDAKDLLIGLLCRDPKRRLGYH-GSDEIKSHPFFNQLSWKRLKMKGYIPPYK 655
           FPDD     +A+DL+  LL     +RLG H G+DEIKSHPFF  + W  ++      PY 
Sbjct: 608 FPDDIHISYEAEDLIRRLLTH-ADQRLGRHGGADEIKSHPFFRGVDWNTIRQ--VEAPYI 664

Query: 656 PPVMGAMDTSNF 667
           P +    DT  F
Sbjct: 665 PKLSSITDTRFF 676

>Kwal_47.18307
          Length = 621

 Score =  146 bits (369), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 84/271 (30%), Positives = 148/271 (54%), Gaps = 11/271 (4%)

Query: 380 DDFDLLKVIGKGSFGKVMQ-VRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER---TVLA 435
           D +  L  +G+GS+  V + V + ++ + YA+K   K +I+ + +V +   E+    +LA
Sbjct: 8   DSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLA 67

Query: 436 RVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEA 495
           +  +  IV L  +F   E LY VL +++GGEL   +QR GR     SR  TA+L+  ++ 
Sbjct: 68  KGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVDY 127

Query: 496 LHDFDIIYRDLKPENILLDYQGHIALCDFG-LCKL---NMKDQEKTTTFCGTPEYLAPEL 551
           +H   +I+RDLKPEN+LL  +G + + DFG  C       ++ ++T +F GT EY++PEL
Sbjct: 128 MHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPEL 187

Query: 552 LLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLL 611
           LL        D W LG ++Y++  G PP+  E+  + ++KI+    ++          ++
Sbjct: 188 LLHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQVVSIV 247

Query: 612 IGLLCRDPKRRLGYHGSDEIKSHPFFNQLSW 642
             +L  DP +R     + ++K +P+F  + W
Sbjct: 248 QSILVTDPLKR---PSAAQLKQNPWFASIDW 275

>Kwal_26.7788
          Length = 1267

 Score =  148 bits (373), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 152/276 (55%), Gaps = 15/276 (5%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-----ERT 432
           +I  + L K +GKGS G+V   +  +T K+ A+K + K+    KS  T +L      E  
Sbjct: 54  TIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKT----KSSRTGSLPYGIEREII 109

Query: 433 VLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCA 492
           ++  + +P ++ L   +++  +L+LVL +++GGELF +L   GR     +  Y  +++  
Sbjct: 110 IMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEG 169

Query: 493 LEALHDFDIIYRDLKPENILLDYQG-HIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPEL 551
               H F+I +RDLKPEN+LLD +   I + DFG+  L   ++   T+ CG+P Y +PE+
Sbjct: 170 TAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETS-CGSPHYASPEI 228

Query: 552 LLGQGYT-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDL 610
           ++G+ Y     D W+ G++L+ +LTG  P+ D+++ ++  K+     + P      A+DL
Sbjct: 229 VMGKNYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQSVSSGAQDL 288

Query: 611 LIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLK 646
           +  +L  DP +R+     +EI +HP   +   KR K
Sbjct: 289 ISRILVVDPDKRISI---NEILAHPLLAKYGNKRSK 321

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score =  145 bits (365), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 139/261 (53%), Gaps = 13/261 (4%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 438
           I ++ + K IG+GSFGKV     R T++   LK   K          + + E     + D
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK-------RDPNVVREVFYHRQFD 86

Query: 439 NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHD 498
            P+I  L     +  ++++VL + +G EL+ HL +E R  L  S+   +++  A+   H+
Sbjct: 87  FPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHE 146

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT 558
              ++RDLK EN+LLD  GH  L DFG  +  M  + +  T CGT  Y+APEL+  + Y 
Sbjct: 147 LKCVHRDLKLENVLLDGNGHAKLTDFGFTR-EMATRSQLETICGTTVYMAPELIERKCYD 205

Query: 559 KV-VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDF-DKDAKDLLIGLLC 616
              VD W+LG++LY M+ G  P+ ++D  K   KI+ D L F  ++   DA DL+ G+L 
Sbjct: 206 GFKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLR 265

Query: 617 RDPKRRLGYHGSDEIKSHPFF 637
           ++P  R+      ++ SHPF 
Sbjct: 266 KNPNERISLA---QVLSHPFL 283

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score =  144 bits (362), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 154/297 (51%), Gaps = 26/297 (8%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVM----------QVRKRDTNKIYALKAIRKSYIVSKSEV 424
           KH++   + +   +G+G FGKV             ++   +K  A+K IR+  IV  SE 
Sbjct: 37  KHVTFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEK 96

Query: 425 THTL-AERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSR 483
              +  E   L  + +P +V L+   Q+S+ + +VL + +GGE + ++QR+ R   S + 
Sbjct: 97  EIKIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTAC 156

Query: 484 FYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGT 543
              A+L+  +  +H  ++++RDLK EN+LLD   ++ + DFG     + D E   T CG+
Sbjct: 157 RLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGS 216

Query: 544 PEYLAPELLLGQG--YTKVVDWWTLGVLLYEMLTGLPPYYD-------EDVPKMYKKILQ 594
           P Y APEL++       +  D W+ G++LY ML G  P+ D       +D+ K+Y+ I +
Sbjct: 217 PCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITR 276

Query: 595 DPLRFPDDFDKDAKDLLIGLLCRDPKRRLGY---HGSDEIKSHPFFNQLS---WKRL 645
            PL+FP+      +DLL  +L  DP +R+     H  + +K H  F  +S   W +L
Sbjct: 277 TPLKFPEYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPHRPFLAVSTSQWDKL 333

>Kwal_26.8709
          Length = 829

 Score =  144 bits (364), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 147/278 (52%), Gaps = 16/278 (5%)

Query: 362 KLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTN------KIYALKAIRK 415
           K   S  Y     KH++   + +   +G+G FGKV     + +N      K  A+K IR+
Sbjct: 20  KSRQSTSYSTQKRKHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR 79

Query: 416 SYIVSKSEVTHTL-AERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQRE 474
             I   SE    +  E   L  +++P IV L+   Q+S+ + +VL + +GGE + ++Q++
Sbjct: 80  DTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKK 139

Query: 475 GRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQ 534
            R     +    A+L+  +  +H   +++RDLK EN+LLD   ++ + DFG     + + 
Sbjct: 140 RRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPEN 199

Query: 535 EKTTTFCGTPEYLAPELLL-GQGY-TKVVDWWTLGVLLYEMLTGLPPYYD-------EDV 585
           E   T CG+P Y APEL++  + Y  +  D W+ GV+LY ML G  P+ D       +D+
Sbjct: 200 ELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDI 259

Query: 586 PKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRL 623
            K+Y+ I + PL+FPD      +DLL  +L  DPKRR+
Sbjct: 260 GKLYRYITRTPLKFPDYIAPVPRDLLREILIPDPKRRI 297

>Scas_616.10
          Length = 1461

 Score =  144 bits (362), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 167/332 (50%), Gaps = 44/332 (13%)

Query: 346 IRLYNHHWIELESKMGKLNLSVDYKPSTHKHL-SIDDFDLLKVIGKGSFGKVMQVRKRDT 404
           I+  N     L  +  + + S D K S  K   ++  + L K +GKGS G+V   +  +T
Sbjct: 64  IQSVNDATKRLSQQDSQFSTSTDTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIET 123

Query: 405 NKIYALKAIRKSYIV----SKSEVT------------HTLA------------------- 429
            ++ A+K + K + +    S S V+             TLA                   
Sbjct: 124 GQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGI 183

Query: 430 --ERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTA 487
             E  ++  + +P ++ L   +++  +LYLVL +++GGELF +L  +G+     +  Y  
Sbjct: 184 EREIVIMKLISHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFK 243

Query: 488 ELLCALEALHDFDIIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQEKTTTFCGTPEY 546
           +++  +   H F+I +RDLKPEN+LLD +   I + DFG+  L + ++   T+ CG+P Y
Sbjct: 244 QIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIKIADFGMAALELPNKLLQTS-CGSPHY 302

Query: 547 LAPELLLGQGY-TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDK 605
            +PE+++G+ Y     D W+ G++L+ +LTG  P+ D+++ K+  K+     R P     
Sbjct: 303 ASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPSTLSP 362

Query: 606 DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
           +A+DL+  +L  DP +R+    +D I +HP  
Sbjct: 363 EAQDLISRILVIDPSKRI---TTDRILNHPLI 391

>Scas_502.2
          Length = 1116

 Score =  142 bits (359), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 142/268 (52%), Gaps = 12/268 (4%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 438
           I DF   +++G G++  VM     D+ K YA+K + K Y++ + +V +   E+  L R++
Sbjct: 171 IKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLN 230

Query: 439 NP-FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           N   I+ L F+FQ    LY +L +   G+L   +++ G  +     +Y A+++ A++ +H
Sbjct: 231 NSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMH 290

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQ-------EKTTTFCGTPEYLAP 549
              II+RD+KPENILLD    + + DFG  K L+ K          ++ +F GT EY++P
Sbjct: 291 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSP 350

Query: 550 ELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKD 609
           ELL         D W  G ++++M+ G PP+   +    ++K+++    F   F    +D
Sbjct: 351 ELLNDNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTVVRD 410

Query: 610 LLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
           L+  +L + P++RL       I+ H FF
Sbjct: 411 LVKRILIKAPEQRLTIEA---IEKHHFF 435

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score =  139 bits (350), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 141/290 (48%), Gaps = 33/290 (11%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           D + L K +G G +  V + + + T +  A+K         + +      E  +L RV +
Sbjct: 198 DKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQH 257

Query: 440 PFIVPLKFSF-----QSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
           P IV L  SF     +S  + YLVL  I+ GELF  + R+       S+    +LL  L+
Sbjct: 258 PNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 495 ALHDFDIIYRDLKPENILLDYQG-------------------HIALCDFGLCKLNMKDQE 535
            LH+ +II+RD+KPENILL+                       + + DFGL K    + +
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKF-TGEMQ 376

Query: 536 KTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDE-DVPKMYKKILQ 594
            T T CGTP Y+APE+L  +GYT  VD W+ GV+LY  L G PP+ D+   P + ++ILQ
Sbjct: 377 FTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQ 436

Query: 595 DPLRFP----DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQL 640
               F     D  D     L+  LL  +P  R   +  DE  +HP+FN +
Sbjct: 437 AKYAFYSPYWDKIDDSVLHLISNLLVLNPDER---YNIDEALNHPWFNDI 483

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  141 bits (356), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 143/278 (51%), Gaps = 18/278 (6%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           D+   + +G+G F +  Q+ K D+ KI+A K + K  I S+      L+E  +   + + 
Sbjct: 80  DYHRGQFLGEGGFARCFQI-KDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            IV     F+ +  +Y++L     G L   +++         RF+  ++   ++ +H   
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNR 198

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ--GYT 558
           +I+RDLK  NI  D   ++ + DFGL  +   D+E+  T CGTP Y+APE+L+G+  G++
Sbjct: 199 VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMGKHSGHS 258

Query: 559 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDD--FDKDAKDLLIGLLC 616
             VD W++GV+LY +L G PP+  +DV  +Y++I Q    +P D    +DAK L+  +L 
Sbjct: 259 YEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILS 318

Query: 617 RDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPY 654
            +P  R       EI  + +F          +G  PPY
Sbjct: 319 LNPMERPSIQ---EIMDYVWF----------RGTFPPY 343

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score =  137 bits (345), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 134/251 (53%), Gaps = 10/251 (3%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           D+   K +G G+FG V Q R    N+  A+K + K  +   +E+     E ++L ++D+P
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRAL-KGNELQMLYDELSILQKLDHP 113

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            IV  K  F+S EK Y+V     GGELF  + ++G+F  + +     ++L A+E +H  +
Sbjct: 114 NIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQN 173

Query: 501 IIYRDLKPENIL-LDY--QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
           +++RDLKPEN+L LD   +  + + DFG+ K    + +      G+  Y+APE+L   G+
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH 233

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QDPLRFP----DDFDKDAKDLL 611
            K  D W+LGV+ Y +L G  P+  E      +++    DP+ F     ++  K+AK  +
Sbjct: 234 GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNNISKEAKQFI 293

Query: 612 IGLLCRDPKRR 622
           +  L   P RR
Sbjct: 294 LRALTLTPARR 304

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score =  140 bits (353), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 131/239 (54%), Gaps = 5/239 (2%)

Query: 388 IGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKF 447
           +G+G F +  Q+ K D+ K++A K + K  I S+      L+E  +   + +P IV    
Sbjct: 79  LGEGGFARCFQM-KDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHPNIVQFTD 137

Query: 448 SFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLK 507
            F+    +Y++L     G L   L++  +      RF+T +++ A++ +H   II+RDLK
Sbjct: 138 CFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLK 197

Query: 508 PENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ--GYTKVVDWWT 565
             NI  D   ++ + DFGL  +   D+E+  T CGTP Y+APE+L G+  G++  VD W+
Sbjct: 198 LGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTGKHTGHSFEVDIWS 257

Query: 566 LGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDD--FDKDAKDLLIGLLCRDPKRR 622
           +GV++Y +L G PP+  ++V  +Y++I      FP D     +AK L+  +L  DP  R
Sbjct: 258 IGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLER 316

>Scas_644.15
          Length = 726

 Score =  139 bits (350), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 131/239 (54%), Gaps = 5/239 (2%)

Query: 388 IGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKF 447
           +G+G F +  Q+ K ++ KI+A K + K  I ++      L+E  +   + +P IV    
Sbjct: 98  LGEGGFARCFQI-KDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHPNIVHFVD 156

Query: 448 SFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLK 507
            F+    +Y++L   + G L   +++         RF+T ++  A++ +H   +I+RDLK
Sbjct: 157 CFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRRVIHRDLK 216

Query: 508 PENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ--GYTKVVDWWT 565
             NI  D   ++ + DFGL  +   ++E+  T CGTP Y+APE+L+G+  G++  VD W+
Sbjct: 217 LGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMGKHAGHSFEVDIWS 276

Query: 566 LGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDD--FDKDAKDLLIGLLCRDPKRR 622
           +GV++Y +L G PP+  +DV  +Y +I      +P D     +AK L+  +LC DP  R
Sbjct: 277 IGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVER 335

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  138 bits (347), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 147/277 (53%), Gaps = 14/277 (5%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 437
           + ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  VGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +     +R +  +++ A+E  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQQIISAVEYCH 153

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
              I++RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APE++ G+ Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 212

Query: 558 T-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLC 616
               VD W+ GV+LY ML    P+ DE +P ++K I       P      A DL+  +L 
Sbjct: 213 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLI 272

Query: 617 RDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPP 653
            +P  R+  H   EI       Q  W ++ +  Y+ P
Sbjct: 273 VNPLNRISIH---EIM------QDEWFKVDLAEYLVP 300

>Kwal_47.18233
          Length = 598

 Score =  137 bits (345), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 162/318 (50%), Gaps = 16/318 (5%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 437
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 86

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +   + +R +  +++ A+E  H
Sbjct: 87  RHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 145

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
              I++RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APE++ G+ Y
Sbjct: 146 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLRTSCGSPNYAAPEVISGKLY 204

Query: 558 T-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLC 616
               VD W+ GV+LY ML    P+ DE +P ++K I       P      A +L+  +L 
Sbjct: 205 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLIKRMLI 264

Query: 617 RDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQP 676
            +P  R+  H   EI       Q  W ++ M+ Y+ P  P +    +    D E   +  
Sbjct: 265 VNPLNRITIH---EIM------QDEWFKVDMQDYLIP--PDLKNEAENHGHDGEQQGQND 313

Query: 677 VDSVVNDFLSESVQQQFG 694
            +  V+D L   + +  G
Sbjct: 314 AEEEVDDSLVTMLSKTMG 331

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/305 (30%), Positives = 153/305 (50%), Gaps = 38/305 (12%)

Query: 373 THKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKI-YALKAIRKSYIVSKSEVTHTLAER 431
           T +  S  +F   + +G GS+  V +   +   K  YA+K   K +I+ +++V +   E+
Sbjct: 2   TSRKRSPHEFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEK 61

Query: 432 T---VLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAE 488
               +LAR ++P IV L ++F   E LY VL + +GGEL   L + G F  S ++ + A+
Sbjct: 62  NTLNLLARGNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQ 121

Query: 489 LLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKL--NMKDQEKT--------- 537
           L+  LE +H   +I+RDLKPEN+LL  +G + + DFG      N  D++ T         
Sbjct: 122 LVDTLEFMHARGVIHRDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANEGIP 181

Query: 538 -------------TTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDED 584
                        ++F GT EY++PELLL    +   D W LG ++Y+ + G PP+  E+
Sbjct: 182 KDDVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRGEN 241

Query: 585 VPKMYKKILQ-----DPLRFPD--DFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
             K ++KI+      +P R  +    +    +L+  +L  D  +R      D+IK  P+F
Sbjct: 242 ELKTFEKIVSLDYSWNPERQTNFGTINIQVVNLVRRMLTIDTTQRATI---DQIKRDPWF 298

Query: 638 NQLSW 642
             + W
Sbjct: 299 ANVDW 303

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score =  137 bits (344), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/314 (28%), Positives = 154/314 (49%), Gaps = 42/314 (13%)

Query: 371 PSTHKHLSIDDFDLLKVIGKGSFGKV---------MQVRKRDTN-----------KIYAL 410
           P   KH++   + +   +G+G FGKV          Q    + N           K  A+
Sbjct: 37  PKHRKHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAI 96

Query: 411 KAIRKSYIVS-KSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFY 469
           K I++ +I    S+ T    E   L  + +P IV L+   Q+S+ + +VL +  GGE + 
Sbjct: 97  KLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYK 156

Query: 470 HLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKL 529
            +QR+ R   + +    ++L+ A+  +H   +++RDLK EN+LLD + ++ + DFG    
Sbjct: 157 FIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNE 216

Query: 530 NMKDQEKTTTFCGTPEYLAPELLL-GQGY-TKVVDWWTLGVLLYEMLTGLPPYYDE---- 583
            ++      T CG+P Y APEL++  + Y  +  D W+ G++L+ ML G  P+ D+    
Sbjct: 217 FLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP 276

Query: 584 ---DVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQL 640
              D+ ++Y  IL  PL+FP+  +   +DLL  +L  DPK+R+       I+ HP+    
Sbjct: 277 DGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRS---IEKHPWLESH 333

Query: 641 S---------WKRL 645
           S         W RL
Sbjct: 334 STFLSITPDEWDRL 347

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  136 bits (343), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 130/246 (52%), Gaps = 5/246 (2%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           D+     +G+G F +  Q+ K D  K++A K + K  I S+      L+E  +   + +P
Sbjct: 89  DYHRGHFLGEGGFARCFQM-KDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHP 147

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            IV     F+    +Y++L     G +   L++         RF   +++ A+  +H   
Sbjct: 148 NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRR 207

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ--GYT 558
           +I+RDLK  NI  D + ++ + DFGL  +   D+E+  T CGTP Y+APE+L G+  G++
Sbjct: 208 VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHS 267

Query: 559 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDD--FDKDAKDLLIGLLC 616
             VD W++GV+LY +L G PP+  ++V  +Y++I      FP D     DAK+L+  LL 
Sbjct: 268 YEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQ 327

Query: 617 RDPKRR 622
            +P  R
Sbjct: 328 LNPAAR 333

>Scas_693.17
          Length = 1049

 Score =  137 bits (346), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 100/339 (29%), Positives = 159/339 (46%), Gaps = 47/339 (13%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIR--------KSYIVSKSEVTHTLA 429
           S+ D+D ++ +G GS GKV   + R TN++ A+K +         K Y    +  T  L+
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS 126

Query: 430 ERTVLARVDN-----------------------PFIVPLKFSFQSSEKLYLVLAFINGGE 466
           E+ V+ R  N                       P I  L      S   Y++  +++GG+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 467 LFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGL 526
           L  ++ + G    SR+R +T ++  AL+ LH  +I++RDLK ENI++   G+I L DFGL
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 527 CKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT-KVVDWWTLGVLLYEMLTGLPPYYDEDV 585
             L  K   K  T+CG+  + APELL    Y    +D W+ GV+LY ++ G  P+ DE+ 
Sbjct: 247 SNLYDKCN-KLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 305

Query: 586 PKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRL 645
             +++KI Q  + +P     +   LL  +L  DP +R      D++ +H       W   
Sbjct: 306 NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRATL---DQVMNH------HWMVR 356

Query: 646 KMKG----YIPPYKPPVMGAMDTSNFDQEFTREQPVDSV 680
              G    YIP   P  +  +D     +E  R + VD V
Sbjct: 357 DCDGPPKSYIPDRPPLTIEQLDVKVI-KEMKRLEFVDDV 394

>Scas_700.34
          Length = 864

 Score =  137 bits (344), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 139/269 (51%), Gaps = 20/269 (7%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQVRKR----------DTNKIYALKAIRKSYIVS-KSE 423
           KH++   + +   +G+G FGKV     +          D  K  A+K IR+  I    S+
Sbjct: 41  KHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSK 100

Query: 424 VTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSR 483
                 E   L  + +P IV L+   Q+S+ + +VL + +GGE + ++QR+ R     + 
Sbjct: 101 EIKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPAC 160

Query: 484 FYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGT 543
              A+L+  +  +H   +++RDLK EN+LLD   ++ + DFG         E   T CG+
Sbjct: 161 RLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSCGS 220

Query: 544 PEYLAPELLLG-QGY-TKVVDWWTLGVLLYEMLTGLPPYYD-------EDVPKMYKKILQ 594
           P Y APEL++  + Y  K  D W+ GV+LY ML G  P+ D       +D+ ++Y  I Q
Sbjct: 221 PCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHYITQ 280

Query: 595 DPLRFPDDFDKDAKDLLIGLLCRDPKRRL 623
            PL+FPD  +   +DLL  +L  DP+RR+
Sbjct: 281 TPLKFPDYINPIPRDLLRRILISDPRRRI 309

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  135 bits (341), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 136/250 (54%), Gaps = 5/250 (2%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 437
           I ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 110

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +     +R +  +++ A+E  H
Sbjct: 111 RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
              I++RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APE++ G+ Y
Sbjct: 170 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 228

Query: 558 T-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLC 616
               VD W+ GV+LY ML    P+ DE +P ++K I       P      A  L+  +L 
Sbjct: 229 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI 288

Query: 617 RDPKRRLGYH 626
            +P  R+  H
Sbjct: 289 VNPLNRISIH 298

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  135 bits (340), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 138/250 (55%), Gaps = 5/250 (2%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 437
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +   + +R +  +++ A+E  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 153

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
              I++RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APE++ G+ Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 212

Query: 558 T-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLC 616
               VD W+ GV+LY ML    P+ DE +P ++K I       P    + A +L+  +L 
Sbjct: 213 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLIKRMLI 272

Query: 617 RDPKRRLGYH 626
            +P  R+  H
Sbjct: 273 VNPLNRITIH 282

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score =  133 bits (335), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 144/291 (49%), Gaps = 33/291 (11%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           D + L K +G G +  V + + + T +  A+K         + +      E T+L ++ +
Sbjct: 191 DKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHH 250

Query: 440 PFIVPLKFSF-----QSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
           P IV L  SF     ++  + YLVL  I+ GELF  + ++       S+    ++L  L+
Sbjct: 251 PNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 495 ALHDFDIIYRDLKPENILLDYQG-------------------HIALCDFGLCKLNMKDQE 535
            LH  +II+RD+KPENILL+ +                     + + DFGL K    + +
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFT-GEMQ 369

Query: 536 KTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDE-DVPKMYKKILQ 594
            T T CGTP Y+APE+L+ +GYT  VD W+ GV+LY  L G PP+ D+   P + ++I+ 
Sbjct: 370 FTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQIMS 429

Query: 595 DPLRFP----DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLS 641
               F     D+ D  A  L+  LL  DP+ R   +  D   +HP+ + +S
Sbjct: 430 AKYAFYSPYWDEIDDAALHLISNLLVLDPENR---YDVDAAAAHPWLDSVS 477

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  134 bits (338), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 147/277 (53%), Gaps = 14/277 (5%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 437
           I  + ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 90

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +     +R +  +++ A++  H
Sbjct: 91  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQQIISAVDYCH 149

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
              I++RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APE++ G+ Y
Sbjct: 150 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 208

Query: 558 T-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLC 616
               VD W+ GV+LY ML    P+ DE +P ++K I       P+   + A  L+  +L 
Sbjct: 209 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLI 268

Query: 617 RDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPP 653
            +P  R+  H   EI       Q  W ++ +  Y+ P
Sbjct: 269 VNPVNRITVH---EIM------QDEWFKVDLPDYLVP 296

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  136 bits (343), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 124/210 (59%), Gaps = 6/210 (2%)

Query: 430 ERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAEL 489
           E  ++  + +P ++ L   +++  +LYLVL +++GGELF +L  +G+     +  Y  ++
Sbjct: 176 EIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQI 235

Query: 490 LCALEALHDFDIIYRDLKPENILLDYQGH-IALCDFGLCKLNMKDQEKTTTFCGTPEYLA 548
           +  +   H F+I +RDLKPEN+LLD +   I + DFG+  L + ++   T+ CG+P Y +
Sbjct: 236 IQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELPNKLLETS-CGSPHYAS 294

Query: 549 PELLLGQGY-TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDA 607
           PE+++G+ Y     D W+ G++L+ +LTG  P+ D+++ K+  K+     + P     DA
Sbjct: 295 PEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDA 354

Query: 608 KDLLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
           KDL+  +L  +P++RL     +EI +HP  
Sbjct: 355 KDLITRILVTNPEKRLTI---NEILNHPLI 381

>Scas_660.28
          Length = 623

 Score =  134 bits (338), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 136/247 (55%), Gaps = 5/247 (2%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARV 437
           I ++ ++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 101

Query: 438 DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALH 497
            +P I+ L    +S +++ +V+ +  G ELF ++ +  +     +R +  +++ A+E  H
Sbjct: 102 RHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
              I++RDLKPEN+LLD   ++ + DFGL  + M D     T CG+P Y APE++ G+ Y
Sbjct: 161 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNI-MTDGNFLKTSCGSPNYAAPEVISGKLY 219

Query: 558 T-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLC 616
               VD W+ GV+LY ML    P+ DE +P ++K I       P    + A  L+  +L 
Sbjct: 220 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASTLIKKMLI 279

Query: 617 RDPKRRL 623
            +P  R+
Sbjct: 280 VNPLNRI 286

>Kwal_0.96
          Length = 427

 Score =  131 bits (329), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 132/252 (52%), Gaps = 10/252 (3%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKS-EVTHTLAERTVLARVDN 439
           D+   K +G GSFG V Q R+  + +  A+K + K  +  K  E+     E ++L ++D+
Sbjct: 45  DYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQKLDH 104

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
           P IV  K  F+S +K Y+V     GGELF  + ++G+F    +     ++L A+E LH  
Sbjct: 105 PNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKAVEYLHSR 164

Query: 500 DIIYRDLKPENILLDYQG---HIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQG 556
           +I++RDLKPEN+L   +     + L DFG+ K    D E      G+  Y+APE++   G
Sbjct: 165 NIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAPEVVTTSG 224

Query: 557 YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK--ILQDPLRFP----DDFDKDAKDL 610
           + K  D W+LGV+ Y +L G  P+  E V    ++  I + P+ F      +   +AKD 
Sbjct: 225 HGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNISNEAKDF 284

Query: 611 LIGLLCRDPKRR 622
           ++  L  +P  R
Sbjct: 285 ILRALTVNPHDR 296

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  135 bits (340), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 85/277 (30%), Positives = 151/277 (54%), Gaps = 20/277 (7%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKS---------EVTHTLA 429
           I  + L + +G GS GKV+  +  +T +I A+K I KS   ++          +V     
Sbjct: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75

Query: 430 ERTV--LARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTA 487
           ER +  +  +++P ++ L   +++++ LY+VL ++  GELF  L + G    + +  +  
Sbjct: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135

Query: 488 ELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYL 547
           +++  +   H   I++RDLKPEN+LLD++ +I L DFG+  L  KD+   T+ CG+P Y 
Sbjct: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETS-CGSPHYA 194

Query: 548 APELLLGQGYTKV-VDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQDPLRFP--DD 602
           APE++ G  Y     D W+ GV+LY +LTG  P+ +ED  +  +  K+       P  D+
Sbjct: 195 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDE 254

Query: 603 FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
              +A+DL++ +L  +P++R+    + EI  HP   +
Sbjct: 255 ISPEARDLIVQILTVEPEQRI---KTREILKHPLLQK 288

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  134 bits (338), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 151/271 (55%), Gaps = 34/271 (12%)

Query: 374 HKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTV 433
           HK+ SI D     ++G+G+F  V +  +R T K +A+K I K  ++ K +      E  V
Sbjct: 188 HKYYSISD----SIVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKR--ELDV 241

Query: 434 LARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCAL 493
           L ++++P IV LK  F+ ++  Y+++ F++GG+L   +   G       R  T ++L A+
Sbjct: 242 LQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAV 301

Query: 494 EALHDFDIIYRDLKPENILLDYQGH--IALCDFGLCKLNMKDQEKTT---TFCGTPEYLA 548
           + +HD  I +RDLKP+NI+++      I + DFGL K+    Q + T   TFCGT  Y+A
Sbjct: 302 KYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKV----QNQNTFLNTFCGTLAYVA 357

Query: 549 PELLLGQG---------YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-----Q 594
           PE++ G+          Y+ +VD W++G L+Y +LTG  P+  +   +++K+I      +
Sbjct: 358 PEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIKRGSYHE 417

Query: 595 DPLRFPDDF--DKDAKDLLIGLLCRDPKRRL 623
            PL+   D+   ++A++ +  LL  DPK R+
Sbjct: 418 GPLK---DYRISEEARNFIDCLLNVDPKERM 445

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score =  130 bits (327), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 131/281 (46%), Gaps = 33/281 (11%)

Query: 386 KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL 445
           K +G G +  V + R ++T +  A+K                  E  +L  + +P IV L
Sbjct: 105 KELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPNIVKL 164

Query: 446 KFSF-----QSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
              F     ++  + YLVL  IN GELF  + R+       ++    +LL  L+ LH  +
Sbjct: 165 IDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRN 224

Query: 501 IIYRDLKPENILLDYQG-------------------HIALCDFGLCKLNMKDQEKTTTFC 541
           II+RD+KPENILL                        + + DFGL K    + + T T C
Sbjct: 225 IIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT-GEMKFTNTLC 283

Query: 542 GTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDV-PKMYKKILQDPLRFP 600
           GTP Y+APE+L+  GYT  VD W+ GVLLY  L G PP+ ++   P M ++ILQ    F 
Sbjct: 284 GTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQILQGKFAFY 343

Query: 601 ----DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
               D+ D     L+  LL  +P  R      ++  +HP+F
Sbjct: 344 SPYWDNIDDSVLHLISNLLVVNPASRFSV---NDALTHPWF 381

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score =  130 bits (326), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 142/274 (51%), Gaps = 12/274 (4%)

Query: 359 KMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYI 418
           K+ KL   V  +PS++ + S  D+   K +G G+FG V Q R   + +  A+K + K  +
Sbjct: 25  KLTKLFNKVTGQPSSYVNKS--DYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKAL 82

Query: 419 VSKSEVTHTLA-ERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRF 477
             +S     L  E ++L ++++P IV  K  F+S EK Y+V     GGELF  +  +G+F
Sbjct: 83  KGQSVQLQMLYDELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKF 142

Query: 478 DLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGH---IALCDFGLCKLNMKDQ 534
               + F   ++L  ++ LH  +I++RDLKPENIL   +     + + DFG+ K    D 
Sbjct: 143 CEVDAVFIVKQILQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDN 202

Query: 535 EKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL- 593
           E      G+  Y+APE+L   G+ K  D W++GV+ Y +L G  P+  E      ++   
Sbjct: 203 ELIHKAAGSMGYVAPEVLTSSGHGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTS 262

Query: 594 -QDPLRFP----DDFDKDAKDLLIGLLCRDPKRR 622
            Q P+ F     ++  K AK+ ++  L   PKRR
Sbjct: 263 GQYPVVFHKPYWNNVSKTAKEFILWALTVSPKRR 296

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score =  133 bits (335), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 153/286 (53%), Gaps = 38/286 (13%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 434
           K  SI+D    +V+G+G+F  V +  +R+T K +A+K I K  ++    V     E  VL
Sbjct: 214 KDFSIND----EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGN--VDGVTRELEVL 267

Query: 435 ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
            R+++P IV LK  ++  E  YL++ F++GG+L   +   G       R  T ++L A+ 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 495 ALHDFDIIYRDLKPENILLDYQGH--IALCDFGLCKLNMKDQEKTT---TFCGTPEYLAP 549
            +H+  I +RDLKP+NIL++      + + DFGL K+    Q+ TT   TFCGT  Y+AP
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKI----QDNTTFMKTFCGTLAYVAP 383

Query: 550 ELLLGQG----------YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-----Q 594
           E++ G+           Y+ +VD W++G L+Y +LTG  P+      ++YK+I      +
Sbjct: 384 EVIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGSYHE 443

Query: 595 DPLRFPDDF--DKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFN 638
            PL+   D+    +A+D +  LL  +P  RL    ++    HP+ +
Sbjct: 444 GPLK---DYWISDEARDFIDSLLQINPVDRL---TAERALQHPWLH 483

>Kwal_56.22476
          Length = 697

 Score =  132 bits (332), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 95/320 (29%), Positives = 156/320 (48%), Gaps = 13/320 (4%)

Query: 330 DSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIG 389
           ++ HL  N ++D  ++     H     + K  KL+      PS  K     D+     +G
Sbjct: 32  ENLHLSSNKRLDHNND----QHRQPVQKKKKEKLSALCKTPPSLIKTRG-RDYHRGHFLG 86

Query: 390 KGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSF 449
           +G F +  Q+ K D  KI+A K + K  I S+      L+E  +   + +  IV     F
Sbjct: 87  EGGFARCFQI-KDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHTNIVQFVDCF 145

Query: 450 QSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPE 509
           +    +Y++L     G L   L+R         RF+T +++ A++ +H   +I+RDLK  
Sbjct: 146 EDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMHSRRVIHRDLKLG 205

Query: 510 NILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ--GYTKVVDWWTLG 567
           NI  D   ++ + DFGL  +   D+E+  T CGTP Y+APE+L G+  G++  VD W+ G
Sbjct: 206 NIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTGKHTGHSYEVDIWSCG 265

Query: 568 VLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDD--FDKDAKDLLIGLLCRDPKRRLGY 625
           V++Y +L G PP+  ++V  +Y++I      FP D     +A  L+  +L  DP  R   
Sbjct: 266 VMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSL 325

Query: 626 HGSDEIKSHPFFNQLSWKRL 645
              DEI  + +F  L   R+
Sbjct: 326 ---DEIIDYVWFRGLFPSRI 342

>Kwal_26.8796
          Length = 796

 Score =  132 bits (333), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 88/270 (32%), Positives = 145/270 (53%), Gaps = 28/270 (10%)

Query: 386 KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVDNPFIVP 444
           +V+G+G+F  V +  +R T K +A+K I K  +V    V   +A E  VL R+D+P IV 
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVG---VMDGVARELEVLQRLDHPRIVS 248

Query: 445 LKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYR 504
           LK  ++  +  YLV+ F++GG+L   +   G       R  T ++L A++ +H   I +R
Sbjct: 249 LKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHR 308

Query: 505 DLKPENILLDYQGH--IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQG------ 556
           DLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++ G+       
Sbjct: 309 DLKPDNILIERDDPVLVKITDFGLAKIQ-GNGTFMKTFCGTLAYVAPEVISGKNSGEKEG 367

Query: 557 --YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-----QDPLRFPDDF--DKDA 607
             Y+ +VD W++G L+Y +LTG  P+       +YK+I      + PL+   D+    DA
Sbjct: 368 NTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGSYHEGPLK---DYRISDDA 424

Query: 608 KDLLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
           +D +   L  DP+ R+    +++   HP+ 
Sbjct: 425 RDFIESFLQVDPRNRM---TAEQALRHPWI 451

>Kwal_33.13112
          Length = 505

 Score =  130 bits (326), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 137/267 (51%), Gaps = 12/267 (4%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           +D+ + +GKGSFG V +   ++T ++ A+K I      ++ ++     E   L+ +  PF
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEE--TQDDIDVLAQEIYFLSELRAPF 93

Query: 442 IVPLKFSFQSSEKLYLVLAFINGG---ELFYHLQREGRFDLSRSRFYTAELLCALEALHD 498
           +     ++     +++V+ F  GG   +L  HL  E R   ++  +   E+L  LE LH 
Sbjct: 94  VTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLP-EHRLPENKVAYIIREVLYGLEYLHS 152

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL-GQGY 557
              I+RD+K  NILL  +G + L DFG+    M    K  TF GTP ++APE++    GY
Sbjct: 153 QRKIHRDVKAANILLTDEGEVKLGDFGVSGQIMATL-KRNTFVGTPYWMAPEIIARDNGY 211

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-LQDPLRFPDDFDKDAKDLLIGLLC 616
            +  D W+LG+   E+LTG PPY   D  K+   I L+ P R    F   A+D +   L 
Sbjct: 212 DEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLT 271

Query: 617 RDPKRRLGYHGSDEIKSHPFFNQLSWK 643
           +DP  R     + ++ SH F N+ +W+
Sbjct: 272 KDPALR---PTASDLLSHKFLNRPTWR 295

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score =  132 bits (333), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/333 (29%), Positives = 150/333 (45%), Gaps = 47/333 (14%)

Query: 360 MGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAI------ 413
           MGK        P      S+ D+D L+ +G GS GKV   + R TN++ A+K +      
Sbjct: 32  MGKAGEEERRMPKPFHRKSLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKS 91

Query: 414 ----------------------RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQS 451
                                 RK      S    T+ E ++   + +P I  L      
Sbjct: 92  FMHKQQLQGLPPPATEEELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTM 151

Query: 452 SEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENI 511
           S   Y++  +++GG+L  ++ + G      +R +   +  AL+ LH  +I++RDLK ENI
Sbjct: 152 SNHFYMLFEYVSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENI 211

Query: 512 LLDYQGHIALCDFGLCKLNMKDQEKTT-TFCGTPEYLAPELLLGQGYT-KVVDWWTLGVL 569
           ++   G I + DFGL   NM D +K   TFCG+  + APELL    YT   VD W+ GV+
Sbjct: 212 MISSSGEIRIIDFGLS--NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVV 269

Query: 570 LYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSD 629
           LY ++ G  P+ DE+   +++KI Q  + +P     D   LL  +L  DP +R       
Sbjct: 270 LYVLVCGKVPFDDENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVVDPYKRA------ 323

Query: 630 EIKSHPFFNQLSWKRLKMKGY-IPP--YKPPVM 659
                    Q+   +   KGY  PP  Y PP +
Sbjct: 324 ------TLKQVVHHQWMQKGYDFPPPSYLPPCV 350

>Scas_618.8
          Length = 427

 Score =  128 bits (322), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 136/252 (53%), Gaps = 10/252 (3%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAI-RKSYIVSKSEVTHTLAERTVLARVDN 439
           D++  K +G GSFG V +  K+  N+  A+K + +K+   ++ ++     E T+L ++ +
Sbjct: 26  DYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTILKKLHH 85

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
           P IV  K  F++ +K+Y+V     GGELF  + ++GRF    +     ++L A+E +H  
Sbjct: 86  PNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQILSAVEYIHSR 145

Query: 500 DIIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQG 556
           DI++RDLKPEN+L         + + DFG+ K   K ++      G+  Y+APE+L   G
Sbjct: 146 DIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYVAPEVLTVDG 205

Query: 557 YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD--PLRFP----DDFDKDAKDL 610
           + K  D W++GV+ Y +L+G   +  E V     +      P++F     D+   DAK+ 
Sbjct: 206 HGKPCDIWSIGVITYTLLSGYAAFVAETVEGFLDECTSGDYPVKFHKPYWDNISDDAKNF 265

Query: 611 LIGLLCRDPKRR 622
           ++  L  +P++R
Sbjct: 266 ILKALDLNPQKR 277

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  132 bits (333), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 148/286 (51%), Gaps = 24/286 (8%)

Query: 372 STHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIV------SKSEVT 425
           S  K+  I  + L + +G GS GKV+      T +  A+K I K+         S  + T
Sbjct: 10  SVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDAT 69

Query: 426 HTL-----AERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLS 480
           + L      E  ++  +++P ++ L   ++++  LYLVL +   GELF  L   G    +
Sbjct: 70  NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPEN 129

Query: 481 RSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTF 540
            +     +++  +   H   +++RDLKPEN+LLD + +I + DFG+  L  +D+   T+ 
Sbjct: 130 EAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKLLETS- 188

Query: 541 CGTPEYLAPELLLG---QGYTKVVDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQD 595
           CG+P Y APE++ G   +G++   D W+ GV+L+ +LTG  P+ +ED  +  +  K+ + 
Sbjct: 189 CGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG 246

Query: 596 PLRFPDD--FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
               PDD    K+A+DLL  LL  DP +R+      EI  HP   +
Sbjct: 247 EFEMPDDDEITKEAQDLLARLLTVDPSKRITIR---EILKHPLLQK 289

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score =  131 bits (329), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 151/291 (51%), Gaps = 36/291 (12%)

Query: 374 HKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTV 433
           +K  SI+D    +V+G G+F  V +  +R+T K +A+K I K  +V   +      E  V
Sbjct: 184 YKDFSIND----EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSR--ELEV 237

Query: 434 LARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCAL 493
           L ++++P IV LK  ++     Y+V+ FI+GG+L   +   G       R  + ++L A+
Sbjct: 238 LQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAI 297

Query: 494 EALHDFDIIYRDLKPENILLDYQGH--IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPEL 551
           + +H   I +RDLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE+
Sbjct: 298 QYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKV-QGNGSIMKTFCGTLAYVAPEV 356

Query: 552 LLG--------------QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL---- 593
           + G                Y+ +VD W++G L++ +LTG  P+      ++Y++I     
Sbjct: 357 IGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIRKGSY 416

Query: 594 -QDPLRFPDDF--DKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLS 641
            + PL+   DF    +A+D + GLL  D  +R+     D+  +HP+  Q S
Sbjct: 417 HEGPLK---DFRISDEARDFIDGLLQVDQSKRMTV---DDALNHPWIKQCS 461

>Scas_564.7
          Length = 1210

 Score =  131 bits (330), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 94/325 (28%), Positives = 150/325 (46%), Gaps = 40/325 (12%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIR---KSYIVSKSEVTHTLAERTVL 434
           S+ D+D L+ +G GS GKV   R   T +I A+K +    K+++  +  +     E+ VL
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVL 217

Query: 435 ARVD-----------------------NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHL 471
            R                         +P I  L      S   Y++  +++GG+L  ++
Sbjct: 218 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 277

Query: 472 QREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNM 531
            + G      +R +   +  ALE +H  +I++RDLK ENI++   G I + DFGL   N+
Sbjct: 278 IQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLS--NV 335

Query: 532 KDQEKT-TTFCGTPEYLAPELLLGQGYT-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY 589
            D++K   TFCG+  + APELL    YT   VD W+ GV+LY ++ G  P+ DE+   ++
Sbjct: 336 FDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 395

Query: 590 KKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKG 649
           +KI Q  + +P+    +   LL  +L  DP RR       ++  HP+         +   
Sbjct: 396 EKIKQGKVDYPNHLSIEVISLLSKMLVVDPLRRASL---KQVVEHPWM-------TRGYD 445

Query: 650 YIPPYKPPVMGAMDTSNFDQEFTRE 674
           Y PP   P    M     D    RE
Sbjct: 446 YPPPSYVPRRIPMTPEIIDNNVIRE 470

>Scas_700.54
          Length = 698

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 98/336 (29%), Positives = 167/336 (49%), Gaps = 40/336 (11%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 434
           K  SI D    +V+G+G+F  V +  +R T K +A+K I K  ++   E      E  VL
Sbjct: 220 KDFSIQD----EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSR--ELEVL 273

Query: 435 ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
            ++D+P IV LK  ++  +  Y+V+ F++GG+L   +   G       +  + ++L A++
Sbjct: 274 QQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVK 333

Query: 495 ALHDFDIIYRDLKPENILLDYQGH--IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELL 552
            +H   I +RDLKP+NIL++      + + DFGL K+   +     TFCGT  Y+APE++
Sbjct: 334 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQ-GNGSFMKTFCGTLAYVAPEVI 392

Query: 553 LGQG--------YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-----QDPLRF 599
            G+G        Y+ +VD W++G L+Y +LTG  P+      ++YK+I      + PL+ 
Sbjct: 393 GGKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGSYHEGPLK- 451

Query: 600 PDDF--DKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPP 657
             DF    +A+  +  LL  +P  RL    + E   HP+        +KM  Y   +K  
Sbjct: 452 --DFRISDEARSFIDSLLQVNPGNRLTAARALE---HPW--------IKMAQYSQSFKEA 498

Query: 658 VMGAMDTSNFDQEFTREQPVDSVVNDFLSESVQQQF 693
              ++  S   Q+    + +D    +F+    +QQ 
Sbjct: 499 SQISLTESLSQQKLL--ESMDDAQYEFVKAQRKQQL 532

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  128 bits (322), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 148/284 (52%), Gaps = 20/284 (7%)

Query: 372 STHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKS--------- 422
           +T K  +I  + L   +G GS GKV+        +  A+K I KS   ++          
Sbjct: 7   TTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDP 66

Query: 423 EVTHTLAERTV--LARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLS 480
           +V     ER +  +  +++P ++ L   +++S+ LY+VL ++  GELF  L   G    +
Sbjct: 67  DVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPEN 126

Query: 481 RSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTF 540
            +  +  +++  +   H   I++RDLKPEN+LLD++ ++ L DFG+  L  KD+   T+ 
Sbjct: 127 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKLLETS- 185

Query: 541 CGTPEYLAPELLLGQGYTKV-VDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQDPL 597
           CG+P Y APE++ G  Y     D W+ GV+LY +LTG  P+ +ED  +  +  K+     
Sbjct: 186 CGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKF 245

Query: 598 RFP--DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
             P  D+   +A+DL+  +L  DP++R+    + EI  HP   +
Sbjct: 246 EMPGDDEISSEAQDLIARILTVDPEQRI---KTREILKHPLLRK 286

>Scas_613.5
          Length = 517

 Score =  125 bits (314), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 98/311 (31%), Positives = 147/311 (47%), Gaps = 42/311 (13%)

Query: 375 KHLSI-DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTV 433
           K LS  D + L K +G G +  V +   + T +  A+K         + +      E  +
Sbjct: 196 KQLSFFDKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNI 255

Query: 434 LARVDNPFIVPLKFSF-----QSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAE 488
           L R+ +P IV L   F     +S  + YLVL  I+ GELF  + ++       ++    +
Sbjct: 256 LMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKAIFNQ 315

Query: 489 LLCALEALHDFDIIYRDLKPENILLDYQG-------------------HIALCDFGLCKL 529
           +L  L+ LH  +II+RD+KPENILL+                       + + DFGL K 
Sbjct: 316 ILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKF 375

Query: 530 NMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDE-DVPKM 588
              + + T T CGTP Y+APE+L  +GYT  VD W+ GV+LY  L G PP+ ++   P +
Sbjct: 376 T-GEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQLGPPSL 434

Query: 589 YKKILQDPLRFP----DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFN------ 638
            ++ILQ    F     D+ D +   L+  LL  D   R  Y   D I +HP+FN      
Sbjct: 435 KEQILQAKFAFYTPYWDNIDDNVLHLISHLLVLDADAR--YSVEDTI-NHPWFNDTRQAN 491

Query: 639 --QLSWKRLKM 647
              L  KRL++
Sbjct: 492 SVSLEMKRLQL 502

>Scas_640.14*
          Length = 728

 Score =  127 bits (318), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 140/282 (49%), Gaps = 23/282 (8%)

Query: 376 HLSIDDFDLLKVIGKGSFGKV---------MQVRKRDTNKIYALKAIRKSYIVSKSEVTH 426
           H+    + +   +G+G FGKV            +  + +K  A+K IR+ +I   SE   
Sbjct: 32  HMKFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEM 91

Query: 427 TL-AERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFY 485
            +  E   L  + +P IV L+   Q+S+ + +VL + +GGE + ++QR+ R   + +   
Sbjct: 92  KIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRL 151

Query: 486 TAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPE 545
            A+L+  +  +H   I++RDLK EN+LLD   ++ + DFG       D E   T CG+P 
Sbjct: 152 FAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPC 211

Query: 546 YLAPELLLGQGYTKV--VDWWTLGVLLYEMLTGLPPYYD-------EDVPKMYKKILQDP 596
           Y APEL++     K    D W+ G++LY ML G  P+ D       ED+ ++Y  I + P
Sbjct: 212 YAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTP 271

Query: 597 LRFPD-DFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFF 637
           L+FP   +       L  +L  +P RR+    S  IK H + 
Sbjct: 272 LKFPRIHYTTFLGICLRHILVSNPVRRM---SSRHIKKHEWL 310

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score =  127 bits (319), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 143/282 (50%), Gaps = 32/282 (11%)

Query: 370 KPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIR---KSYIVSKSEV-- 424
           +P      S+  +D ++ +G GS GKV   + +++N++ A+K +    K+Y+    ++  
Sbjct: 55  QPRVFHRKSLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPP 114

Query: 425 ---------------------THTLAERTVLARVDNPFIVPLKFSFQS-SEKLYLVLAFI 462
                                  T+ E ++   + +P +  L +  Q+ S   Y+   FI
Sbjct: 115 PADENEAKERQKRLNKEISRDKRTVREASLGQILFHPNVCKL-YEMQTLSNHYYMFFEFI 173

Query: 463 NGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALC 522
           +GG+L  ++ + G    + +R  +  +L AL+ LH  +I++RDLK ENI+L   G I L 
Sbjct: 174 SGGQLLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLI 233

Query: 523 DFGLCKLNMKDQEKT-TTFCGTPEYLAPELLLGQGY-TKVVDWWTLGVLLYEMLTGLPPY 580
           DFGL   NM D  K+  TFCG+  + APELL    Y    VD W+ GV+LY ++ G  P+
Sbjct: 234 DFGLS--NMYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPF 291

Query: 581 YDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRR 622
            DE+   +++KI +  + +P     D   LL  +L  DP++R
Sbjct: 292 DDENSSALHEKIKKGKVTYPQFLSIDVISLLSKILVVDPQKR 333

>Scas_493.2
          Length = 1117

 Score =  127 bits (319), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 146/286 (51%), Gaps = 23/286 (8%)

Query: 373 THKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSK--SEVTHTLA- 429
           T K  +I  + L + +G GS GKV       TN+  A+K I KS   +K  S  T  +A 
Sbjct: 13  TIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVAN 72

Query: 430 -----------ERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFD 478
                      E  ++  + +  ++ L   ++++  LY++L +   GELF  L  +G   
Sbjct: 73  TPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP 132

Query: 479 LSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTT 538
              +  +  +++  +   H   I++RDLKPEN+LLD++ +I + DFG+  L  +D+   T
Sbjct: 133 EKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLET 192

Query: 539 TFCGTPEYLAPELLLGQGYTKV-VDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQD 595
           + CG+P Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +ED  +  +  K+   
Sbjct: 193 S-CGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 251

Query: 596 PLRFPDD--FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
               PDD    +DA+DL+  +L  DP +R+    + EI  HP   +
Sbjct: 252 QFEMPDDDEMSRDAQDLISRILTVDPTKRI---KTREILKHPLLQK 294

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score =  123 bits (309), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 83/271 (30%), Positives = 137/271 (50%), Gaps = 13/271 (4%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTV-LARVDNP 440
           +++L+ IG+G+FG V + R   +N+I A+K +    +    E    LA+    L+ + +P
Sbjct: 20  YEILQCIGRGNFGDVYKARDLTSNEIVAIKVVN---LEDTDEPIDLLAQEIFFLSELRSP 76

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQR--EGRFDLSRSRFYTAELLCALEALHD 498
           +I   K +F     +++V+ +  GG     L+   E +    +  F  +E+L  L+ LH 
Sbjct: 77  YITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHS 136

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELL--LGQG 556
              I+RD+K  NILL   GH+ L DFG+    M    K  TF GTP ++APE++    QG
Sbjct: 137 QRKIHRDIKSANILLTDNGHVKLGDFGVSG-QMMVTRKRDTFVGTPFWMAPEVIDRNKQG 195

Query: 557 YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-LQDPLRFPDDFDKDAKDLLIGLL 615
           Y ++ D W+LG+ + E+L G PP    D  K    I  +DP +    F   A+D +   L
Sbjct: 196 YNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCL 255

Query: 616 CRDPKRRLGYHGSDEIKSHPFFNQLSWKRLK 646
            +DP +R     + E+  H F  ++    L+
Sbjct: 256 IKDPSQR---PTAAELLKHRFVKRVRLYNLR 283

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score =  127 bits (318), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 78/272 (28%), Positives = 136/272 (50%), Gaps = 28/272 (10%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIR---KSYIVSKSEVTHTLAERTVL 434
           S+ D+D L+ +G GS GKV   + R TN++ A+K +    KSY+  ++++     E  ++
Sbjct: 94  SLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELM 153

Query: 435 ARVD-----------------------NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHL 471
            R                         +P I  L      S   Y++  +++GG+L  ++
Sbjct: 154 ERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 213

Query: 472 QREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNM 531
            + G      +R +   +  AL+ LH  +I++RDLK ENI++   G I + DFGL  L  
Sbjct: 214 IQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNL-Y 272

Query: 532 KDQEKTTTFCGTPEYLAPELLLGQGYT-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYK 590
            ++++  TFCG+  + APELL    Y    VD W+ GV++Y ++ G  P+ DE+   +++
Sbjct: 273 DNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASVLHE 332

Query: 591 KILQDPLRFPDDFDKDAKDLLIGLLCRDPKRR 622
           KI +  + +P     +   LL  +L  DP +R
Sbjct: 333 KIKKGKVEYPQHLSIECISLLSKMLVVDPLKR 364

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score =  123 bits (309), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 126/266 (47%), Gaps = 30/266 (11%)

Query: 386 KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL 445
           K +G G +  V +   + T +  A+K           +      E  +L  +++  IV L
Sbjct: 159 KELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHENIVKL 218

Query: 446 KFSF-----QSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
              F     +S  + YLVL  I  GELF  + R+ +     +R    ++L  L+ LHD +
Sbjct: 219 LERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFKQILAGLKYLHDRN 278

Query: 501 IIYRDLKPENILLDYQGH-------------------IALCDFGLCKLNMKDQEKTTTFC 541
           II+RD+KPENILL  +                     + + DFGL K    + + TTT C
Sbjct: 279 IIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFT-GEMQFTTTLC 337

Query: 542 GTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDV-PKMYKKILQDPLRF- 599
           GTP Y+A E+L   GYT  VD W+ GVLLY  L G PP+ D+   P M ++ILQ    F 
Sbjct: 338 GTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQGKFAFY 397

Query: 600 -P--DDFDKDAKDLLIGLLCRDPKRR 622
            P  D+ D     L+  LL  DP +R
Sbjct: 398 SPYWDEIDDSVLHLISNLLVVDPAKR 423

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 135/261 (51%), Gaps = 13/261 (4%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 438
           + ++ ++K +G+GSFGKV     + T++   LK   KS      EV +         + +
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYH-------RQFE 86

Query: 439 NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHD 498
            PFI  L     +  ++++ L +  G EL+ +L  + R  L  +R   A+++ A+   H 
Sbjct: 87  YPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHS 146

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT 558
              ++RDLK ENILLD  G+  L DFG  +     + +  T CGT  Y+APEL+  + Y 
Sbjct: 147 LQCVHRDLKLENILLDKNGYAMLTDFGFTR-ECATKTQLETVCGTTVYMAPELIKREAYD 205

Query: 559 KV-VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDK-DAKDLLIGLLC 616
              VD W+LG++LY ML G  P+ ++D  +   KI+ +     D++    AKDL++ LL 
Sbjct: 206 GYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 617 RDPKRRLGYHGSDEIKSHPFF 637
           ++  +R      +E+  HPF 
Sbjct: 266 KNAAQRPNL---NEVLQHPFL 283

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 147/283 (51%), Gaps = 27/283 (9%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYI----VSKSEVTHTLA---- 429
           +I  + L + +G GS GKV   R   T +  A+K I K+      VS + +  +      
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74

Query: 430 ------ERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSR 483
                 E  ++  +++P ++ L   ++++  LYLVL +   GELF  L   G      + 
Sbjct: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAI 134

Query: 484 FYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGT 543
            +  +++  +   H   I++RDLKPEN+LLD++ +I + DFG+  L  + +   T+ CG+
Sbjct: 135 RFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS-CGS 193

Query: 544 PEYLAPELLLG---QGYTKVVDWWTLGVLLYEMLTGLPPYYDED--VPKMYKKILQDPLR 598
           P Y APE++ G   QG+    D W+ GV+L+ +LTG  P+ +ED  +  +  K+ +    
Sbjct: 194 PHYAAPEIVSGIPYQGF--ASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE 251

Query: 599 FP--DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
            P  D+  ++A+DL+  +L  DP+RR+    + +I  HP   +
Sbjct: 252 MPSDDEISREAQDLIRKILTVDPERRI---KTRDILKHPLLQK 291

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 127/246 (51%), Gaps = 7/246 (2%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-P 440
           F   +VIG+G FG V +     T ++YA+K +  +   S+ EV     E   LA +   P
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVL--NLDSSEDEVEDVQREIQFLASLKQIP 73

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            I     S+     L++++ +  GG L   L R G+ D         ELL AL+ +H  +
Sbjct: 74  NITRYYGSYLRGTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKVIHKDN 132

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL-GQGYTK 559
           +I+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD-PLRFPD-DFDKDAKDLLIGLLCR 617
            VD W+LG+  YE+ TG PPY D +  +  + I++  P R  + ++    K+ +   L  
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDE 252

Query: 618 DPKRRL 623
           DP+ RL
Sbjct: 253 DPQERL 258

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score =  125 bits (313), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 138/290 (47%), Gaps = 33/290 (11%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIR---KSYIVSKSEVTHTLAERTVL 434
           S+ D+D L+ +G GS GKV   + R T ++ A+K +    K+++  +      +  + ++
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 435 ARVD-----------------------NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHL 471
            R                         +P I  L      S   Y++  ++ GG+L  ++
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 472 QREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNM 531
            + G      +R +   +  AL+ LH  +I++RDLK ENI++   G I + DFGL   N+
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLS--NV 281

Query: 532 KDQEKTT-TFCGTPEYLAPELLLGQGYT-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY 589
            D  K   TFCG+  + APELL    YT   VD W+ GV+LY ++ G  P+ DE+   ++
Sbjct: 282 YDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLH 341

Query: 590 KKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
           +KI +  + +P     +   LL  +L  DP RR       ++  HP+  +
Sbjct: 342 EKIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRRASL---KQVVEHPWMTK 388

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score =  121 bits (303), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 136/257 (52%), Gaps = 10/257 (3%)

Query: 376 HLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAI-RKSYIVSKSEVTHTLAERTVL 434
           ++S  ++   K +G G+FG V Q R   TN+  A+K + +K+   +  ++     E ++L
Sbjct: 39  YVSKSNYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSIL 98

Query: 435 ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
             + +P IV  K  F+S +K Y+V     GGELF  +  +G+F    +   T ++L A++
Sbjct: 99  QMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVD 158

Query: 495 ALHDFDIIYRDLKPENIL-LDYQ--GHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPEL 551
            +H  ++++RDLKPEN+L +D      + + DFG+ K    + +      G+  Y+APE+
Sbjct: 159 YMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEV 218

Query: 552 LLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD--PLRFP----DDFDK 605
           L   G+ K  D W++GV++Y +L G   +  E V    ++  Q+  P+ F     D+   
Sbjct: 219 LTNNGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISD 278

Query: 606 DAKDLLIGLLCRDPKRR 622
           +AK+ ++  L  DP  R
Sbjct: 279 EAKNFILRALTLDPAER 295

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score =  120 bits (302), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 130/247 (52%), Gaps = 10/247 (4%)

Query: 386 KVIGKGSFGKVMQVRKRDTNKIYALKA-IRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 444
           K +G G+FG V Q +  +T +  A+K  I+K+   +K ++     E  +L R+ +P IV 
Sbjct: 41  KTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVA 100

Query: 445 LKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYR 504
            K  F+S +K Y++     GGELF  + ++G+F    +     E+L A++ +H  +I++R
Sbjct: 101 FKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHR 160

Query: 505 DLKPENIL-LDY--QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVV 561
           DLKPEN+L +D   +  + + DFG+ K    D+E      G+  Y+APE+L   G+ K  
Sbjct: 161 DLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPC 220

Query: 562 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--QDPLRFP----DDFDKDAKDLLIGLL 615
           D W++GV+ Y +L G   +  E V     +    + P++F     D     AK  ++  L
Sbjct: 221 DIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKAL 280

Query: 616 CRDPKRR 622
             DP +R
Sbjct: 281 NLDPSKR 287

>Kwal_23.3590
          Length = 499

 Score =  121 bits (304), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 132/282 (46%), Gaps = 33/282 (11%)

Query: 386 KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL 445
           K +G G +  V +   +D+  + A+K     +   + +      E  +L  + +  IV L
Sbjct: 190 KELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQHKNIVKL 249

Query: 446 KFSF-----QSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
              F     ++  + +LVL  ++ GELF  + R+ R     +     ++L  L  LH  +
Sbjct: 250 IDRFVEPVSKAQIQTFLVLEKVSDGELFDRIVRKTRLREDETNAIFKQILNGLRYLHAKN 309

Query: 501 IIYRDLKPENILLDYQGH-------------------IALCDFGLCKLNMKDQEKTTTFC 541
           II+RD+KPENILL  +                     I + DFGL K  + + + T T C
Sbjct: 310 IIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKF-IGEMQFTNTLC 368

Query: 542 GTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDV-PKMYKKILQDPLRF- 599
           GTP Y+APE+L   GYT  VD W+ GVLLY  L G PP+ ++   P M ++IL     F 
Sbjct: 369 GTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQILNGKFAFY 428

Query: 600 -P--DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFN 638
            P  DD D     L+  LL  +P  R     +    +HP+F+
Sbjct: 429 SPYWDDIDDSCLHLISNLLVVNPAYRFDVQKT---INHPWFS 467

>YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinase
           kinase (MEK) activated by high osmolarity through the
           Sln1p-Ypd1p-Ssk1p two-component osmosensor and the Sho1p
           osmosensor [2007 bp, 668 aa]
          Length = 668

 Score =  122 bits (305), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 151/309 (48%), Gaps = 25/309 (8%)

Query: 361 GKLNLS---VDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSY 417
           GKL+LS   +D+   +   +++D+ + L  +G G++G V +V  + TN I A K +R   
Sbjct: 336 GKLSLSSKGIDFSNGSSSRITLDELEFLDELGHGNYGNVSKVLHKPTNVIMATKEVR--L 393

Query: 418 IVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGEL--FYHLQRE- 474
            + +++    L E  VL + ++P+IV    +F     +Y+ + +++GG L   Y    E 
Sbjct: 394 ELDEAKFRQILMELEVLHKCNSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDESSEI 453

Query: 475 GRFDLSRSRFYTAELLCALEALHD-FDIIYRDLKPENILLDY-QGHIALCDFGLCKLNMK 532
           G  D  +  F    ++  L+ L +  +II+RD+KP NIL    QG + LCDFG+    + 
Sbjct: 454 GGIDEPQLAFIANAVIHGLKELKEQHNIIHRDVKPTNILCSANQGTVKLCDFGVSGNLVA 513

Query: 533 DQEKTTTFCGTPEYLAPELLLG-----QGYTKVVDWWTLGVLLYEMLTGLPPY----YDE 583
              KT   C +  Y+APE +         YT   D W+LG+ + EM  G  PY    YD 
Sbjct: 514 SLAKTNIGCQS--YMAPERIKSLNPDRATYTVQSDIWSLGLSILEMALGRYPYPPETYDN 571

Query: 584 DVPKMYKKILQDPLRFPDD-FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSW 642
              ++   +   P R P D F  DA+D +   L + P+RR  Y    E   HP+  +   
Sbjct: 572 IFSQLSAIVDGPPPRLPSDKFSSDAQDFVSLCLQKIPERRPTYAALTE---HPWLVKYRN 628

Query: 643 KRLKMKGYI 651
           + + M  YI
Sbjct: 629 QDVHMSEYI 637

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score =  123 bits (308), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 135/273 (49%), Gaps = 30/273 (10%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIR---KSYIVSKSEVTHTLAERTVL 434
           S+ D++ ++ +G GS GKV   + R TN++ A+K +    K+++  +  +     E+ VL
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 435 ARVD-----------------------NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHL 471
            R                         +P I  L      S   Y++  +++GG+L  ++
Sbjct: 176 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 235

Query: 472 QREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNM 531
            + G     ++R +   +  AL  LH  +I++RDLK ENI++     I + DFGL   N+
Sbjct: 236 IQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS--NI 293

Query: 532 KDQEKTT-TFCGTPEYLAPELLLGQGYT-KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY 589
            D  K   TFCG+  + APELL    YT   VD W+ GV+L+ ++ G  P+ DE+   ++
Sbjct: 294 YDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLH 353

Query: 590 KKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRR 622
           +KI Q  + +P     +   LL  +L  DPKRR
Sbjct: 354 EKIKQGKVEYPQHLSIEVISLLSKMLVVDPKRR 386

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  122 bits (307), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 109/169 (64%), Gaps = 3/169 (1%)

Query: 371 PSTHKHL--SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTL 428
           P+T K +  SI D+D++K I KG++G V   +KR T + +A+K ++KS +++K++VT+  
Sbjct: 689 PTTGKSIIPSIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVK 748

Query: 429 AERTVL-ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTA 487
           +ER ++  + D P++  L  +FQ+ E L+LV+ +++GG++   ++  G      ++ Y  
Sbjct: 749 SERAIMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYIC 808

Query: 488 ELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEK 536
           E++  ++ +H   II+ DLKP+N+L+D  GHI L DFGL ++ +  + K
Sbjct: 809 EVISGVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRMGLLRRHK 857

>Scas_700.28
          Length = 896

 Score =  121 bits (304), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 130/263 (49%), Gaps = 17/263 (6%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 438
           + ++ +L  IG+GSFGKV   + R T+    LK+       S     + + E     + D
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLKS-------SDKNDPNIVREVFYHRQFD 87

Query: 439 NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHD 498
            P+I  L     +  K+++ L +  G EL+  +    R          A+++  +   H 
Sbjct: 88  YPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHS 147

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTT--TFCGTPEYLAPELLLGQG 556
            + ++RDLK ENILLD  G   L DFG  +  M    KTT  T CGT  Y+APEL+  + 
Sbjct: 148 LNCVHRDLKLENILLDKSGDAKLTDFGFTRECM---TKTTLETICGTTVYMAPELIERKS 204

Query: 557 YTKV-VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL-QDPLRFPDDFDKDAKDLLIGL 614
           Y    +D W+LGV+LY M+ G  P+ ++D  K   KI+ Q P    +    DAKDL++ L
Sbjct: 205 YDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRL 264

Query: 615 LCRDPKRRLGYHGSDEIKSHPFF 637
           L ++P  R      ++I  HPF 
Sbjct: 265 LAKNPNDRPTV---EQILKHPFL 284

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score =  118 bits (296), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 386 KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL 445
           + +G GSFG V + ++  +++  A+K + K  +     +     E  ++  +D+P IV  
Sbjct: 69  RTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPNIVKF 128

Query: 446 KFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRD 505
           K  F++  K Y+V    +GGELF  +  +G++    +     ++L A+E LH  +II+RD
Sbjct: 129 KDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEYLHSQNIIHRD 188

Query: 506 LKPENIL-LDYQ--GHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVD 562
           LKPEN+L LD      I L DFG+ +    D +      G+  Y+APE+    G+ K  D
Sbjct: 189 LKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTSDGHGKPSD 248

Query: 563 WWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD--PLRFP----DDFDKDAKDLLIGLLC 616
            W++GV+ Y +L G  P+  E V     ++  D  P++F     D   + AK+ ++ +L 
Sbjct: 249 IWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAKNFILRILD 308

Query: 617 RDPKRR 622
            DP  R
Sbjct: 309 LDPACR 314

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score =  121 bits (304), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 124/246 (50%), Gaps = 7/246 (2%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSE-VTHTLAERTVLARVDNP 440
           F   +VIG+G FG V +     T ++YA+K +       + E V   +     L ++ N 
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISN- 81

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            I     S+     L++++    GG L   L R G+ D         ELL AL+ +H  +
Sbjct: 82  -ITRYYGSYLKDTSLWIIMEHCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL-GQGYTK 559
           +I+RD+K  N+L+  +G++ LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 199

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD-PLRFPD-DFDKDAKDLLIGLLCR 617
            VD W+LG+  YE+ TG PPY D +  +  + I++  P R  D  +    K+ +   L  
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 618 DPKRRL 623
           DPK RL
Sbjct: 260 DPKERL 265

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score =  121 bits (303), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 140/266 (52%), Gaps = 15/266 (5%)

Query: 372 STHKHLSIDDFDLLKVIGKGSFGKVM----QVRKRDTNKIYALKAIRKSYIVSKSEVTHT 427
           S  K ++   + +   +G+G FGKV     + R    ++  A+K IR+  +   SE    
Sbjct: 35  SKKKQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIK 94

Query: 428 L-AERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYT 486
           +  E   L  + +P IV L+   Q+S+ + +VL + +GGE + ++Q++ R     +    
Sbjct: 95  IYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 154

Query: 487 AELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEY 546
           A+L+  +  +H   + +RDLK EN+LLD   ++ + DFG      K+ +   T CG+P Y
Sbjct: 155 AQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKN-DLMRTSCGSPCY 213

Query: 547 LAPELLL-GQGYT-KVVDWWTLGVLLYEMLTGLPPYYD-------EDVPKMYKKILQDPL 597
            APEL++  + Y+ +  D W+ GV+LY ML G  P+ D       ED+ K+Y+ I    L
Sbjct: 214 AAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSL 273

Query: 598 RFPDDFDKDAKDLLIGLLCRDPKRRL 623
           +FP+      +DLL  +L  +P+ RL
Sbjct: 274 KFPEYIKPIPRDLLKRILVSNPEVRL 299

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  121 bits (303), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 144/283 (50%), Gaps = 21/283 (7%)

Query: 370 KPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSK-------S 422
           KPS+    +I  + L + +G GS GKV   +   T    A+K I KS   +        S
Sbjct: 13  KPSS----TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDS 68

Query: 423 EVTHTLAERTVLARV-DNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSR 481
            + + +    V+ ++  +P ++ L   ++++  LYL+L +   GELF  L   G      
Sbjct: 69  VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPERE 128

Query: 482 SRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFC 541
           +     +++  +   H   I++RDLKPEN+LLD   +I + DFG+  L   D +   T C
Sbjct: 129 AINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQT-DADLLETSC 187

Query: 542 GTPEYLAPELLLGQGYTKVV-DWWTLGVLLYEMLTGLPPYYDE--DVPKMYKKILQDPLR 598
           G+P Y APE++ G  Y     D W+ GV+L+ +LTG  P+ +E  +V  +  K+ +    
Sbjct: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247

Query: 599 FPDDFD--KDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
            P+D +  +DA+DL+  +L  DP++R+      +I SHP   +
Sbjct: 248 MPNDTEISRDAQDLIGKILVVDPRQRIKIR---DILSHPLLKK 287

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  121 bits (303), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 100/155 (64%), Gaps = 1/155 (0%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 436
           SI D+D++K I KG++G V   RK+ T   +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 778 SIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 837

Query: 437 VDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEAL 496
            D P++  L  +FQ+ + L+LV+ ++ GG+L   L+  G       + Y +E++  +E +
Sbjct: 838 SDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSEIIIGVEDM 897

Query: 497 HDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNM 531
           H+  II+ DLKPEN+L+D  GH+ L DFGL +  +
Sbjct: 898 HNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGL 932

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 98/173 (56%), Gaps = 21/173 (12%)

Query: 526  LCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDV 585
            L   N +D ++   F GTP+YLAPE + G G     DWW++G +L+EM+ G PP++ E  
Sbjct: 1089 LILFNPEDSKQDKRFFGTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETP 1148

Query: 586  PKMYKKILQDPLRFP--DDFDK-------DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPF 636
             ++++ IL+  + +P  D  ++       +AKDL++  L  DP +RLGY+G++EIK+HP+
Sbjct: 1149 DQVFRNILEGKIDWPIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPY 1208

Query: 637  FNQLSWKRL--KMKGYIPPYKPPVMGAMDTSNFD------QEFTREQPVDSVV 681
            F  + W  +  +   Y+P  + P     DT  FD      Q+F  +   D+V+
Sbjct: 1209 FKDVKWDHVYDETASYVPNIEDP----EDTDYFDLRGATLQDFGDDNDEDAVL 1257

>Kwal_47.17252
          Length = 872

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 143/299 (47%), Gaps = 53/299 (17%)

Query: 380 DDFDLLKVIGKGSFGKVMQVR---KRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLAR 436
           D + + + IGKGSF  V + R    RD N   A+KA+ +S + +K  + +   E  +L +
Sbjct: 18  DKYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLEIEIAILKK 77

Query: 437 VDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREG----RFDLSRSRF-------- 484
           + +P IV L    ++    +L++ +   G+L + +++ G    +  L R+ F        
Sbjct: 78  IKHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEKYPPPSE 137

Query: 485 ------------YTAELLCALEALHDFDIIYRDLKPENILL-----DYQGH--------- 518
                       Y  +L  AL  L   ++++RD+KP+N+LL     +Y            
Sbjct: 138 SHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRETFHKMGFV 197

Query: 519 -------IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLY 571
                  + + DFG  +  + +     T CG+P Y+APE+L  Q Y    D W++G +LY
Sbjct: 198 GIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILDYQKYNAKADLWSVGTVLY 256

Query: 572 EMLTGLPPYYDEDVPKMYKKI--LQDPLRFPD--DFDKDAKDLLIGLLCRDPKRRLGYH 626
           EM  G PP+   +  +++KKI    D + FP     D   ++L+ GLL  DP +R+G++
Sbjct: 257 EMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELICGLLTFDPSQRMGFN 315

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  120 bits (300), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 100/160 (62%), Gaps = 1/160 (0%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 436
           SI D+D+LK I KG++G V   RK+ T   +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 790 SIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 849

Query: 437 VDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEAL 496
            D P++  L  SFQ+ + L+LV+ ++ GG+L   ++  G      ++ Y  E++  +  +
Sbjct: 850 SDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVNDM 909

Query: 497 HDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEK 536
           H   II+ DLKPEN+L+D  GH+ L DFGL +  +  + K
Sbjct: 910 HQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGLIRRHK 949

 Score = 99.4 bits (246), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 80/148 (54%), Gaps = 16/148 (10%)

Query: 533  DQEKTTTFCGTPEYLAPELLLGQGY-TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKK 591
            D ++   F GTP+YLAPE + G+G   K  DWW++G + +E+L G PP++ E    ++KK
Sbjct: 1140 DSKQNKKFFGTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKK 1199

Query: 592  ILQDPLRFPD---------DFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSW 642
            IL   +++P+             +AKDL+  LL  DP +RLG  G  EIK HP+F  + W
Sbjct: 1200 ILSGVIQWPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDW 1259

Query: 643  KRL--KMKGYIPPYKPPVMGAMDTSNFD 668
              +  +   ++P    P     DT  FD
Sbjct: 1260 DHVYDEEASFVPTIDNP----EDTDYFD 1283

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 127/250 (50%), Gaps = 13/250 (5%)

Query: 387 VIGKGSFGKVM---QVRKRDTNKIYALKAIRKSYIVSKSEV-THTLAERTVLARVDNPFI 442
            +G+G FGKV         D +K  A+K IR+  I   SE       E   L  + +P I
Sbjct: 61  TLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYREINALKHLAHPNI 120

Query: 443 VPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDII 502
           V L+   Q+S+ + +VL + +GGE + ++Q++ R     +    A+L+  +  +H   + 
Sbjct: 121 VTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQLISGVHYMHHKGLA 180

Query: 503 YRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL-GQGY-TKV 560
           +RDLK EN+LLD   ++ + DFG         +   T CG+P Y APEL++  + Y  + 
Sbjct: 181 HRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEARK 240

Query: 561 VDWWTLGVLLYEMLTGL-------PPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIG 613
            D W+ GV+LY ML G             +D+ K+Y  I +  L+FP+  +   +D+L  
Sbjct: 241 ADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLKFPEYINPIPRDILRR 300

Query: 614 LLCRDPKRRL 623
           +L  DP +R+
Sbjct: 301 ILVSDPSKRI 310

>Scas_707.36
          Length = 915

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 156/326 (47%), Gaps = 58/326 (17%)

Query: 365 LSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAI----RKSYIV- 419
           +S+ Y P +   + ++ ++++K +G G  GKV   +    N++ A+K +    +K+Y   
Sbjct: 77  ISLSYDPVSKTQI-LNHYEIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAG 135

Query: 420 -SKSEVTHTLAERTVLARVDNPFIVPLKFSFQ--SSEKLYLVLAFINGGELFY----HLQ 472
             +++      E  ++ + +N  +V L       SS K+YLVL +   G + +     L+
Sbjct: 136 PKRNDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLE 195

Query: 473 REGR----FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLC- 527
            + R        R+R    +++  LE LH   II+RD+KP N+L+D  G + + DFG+  
Sbjct: 196 IDSRGPPQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSL 255

Query: 528 ----KLNMKDQE-KTTTFCGTPEYLAPELLLGQGYTK-----------------VVDWWT 565
                ++  D E + T   GTP + APE+ LG    +                  +D W 
Sbjct: 256 AANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDIWA 315

Query: 566 LGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP------DDFDKD---------AKDL 610
           LG+ LY +L G+ P+  E   K+++KI+ + LRFP      D+   +         AKDL
Sbjct: 316 LGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIREFVHAKDL 375

Query: 611 LIGLLCRDPKRRLGYHGSDEIKSHPF 636
           L  LL ++P +R+      +IK HPF
Sbjct: 376 LNKLLEKNPAKRISI---PDIKVHPF 398

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 103/160 (64%), Gaps = 1/160 (0%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 436
           SI D+D++K I KG++G V    KR T + +A+K +RKS +++K++VT+  +ER ++  +
Sbjct: 678 SIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQ 737

Query: 437 VDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEAL 496
            + P++  L  +FQ+ E L+LV+ +++GG+L   ++  G      ++ Y  E++  ++ +
Sbjct: 738 SEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDDM 797

Query: 497 HDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEK 536
           H   II+ DLKP+N+L+D  GH+ L DFGL ++ +  + K
Sbjct: 798 HMSGIIHHDLKPDNLLIDSNGHVKLTDFGLSRIGLIQRHK 837

 Score =  104 bits (260), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 94/174 (54%), Gaps = 18/174 (10%)

Query: 533  DQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 592
            D++ +  F GTP+YL+PE +LG G +   DWW++G +L+E L G PP++   V  ++K I
Sbjct: 994  DEDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNI 1053

Query: 593  LQDPLRFPDDFDK---------DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
            L   + +P   +K         +AKDL++ LL  +P+ RLG +G+ EIK HP+F  ++W 
Sbjct: 1054 LSGQIDWPSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWS 1113

Query: 644  RL--KMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDFLSESVQQQFGG 695
            ++  +   ++P    P     DT  FD    R   +D ++ D   E   Q   G
Sbjct: 1114 KVYDEEASFVPTVDNP----EDTDYFD---LRGADLDELLRDNYGEDDLQSTSG 1160

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 122/245 (49%), Gaps = 7/245 (2%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-P 440
           F   +VIG+G FG V +     T ++YA+K +  +    + EV     E   LA +   P
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVL--NLDCPEDEVEDVQKEIQFLASLKQVP 82

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            I     S+    KL++++ +  GG L   L R G+ D         +LL AL  +H  +
Sbjct: 83  NITRYYGSYLYDTKLWVIMEYCAGGSL-RTLLRPGKIDEKYLGVIVRKLLIALVYIHKDN 141

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL-GQGYTK 559
           +I+RD+K  N+L+  +GH+ LCDFG+         K  T  GTP ++APE+++ G  Y  
Sbjct: 142 VIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNT 201

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD-PLRFPD-DFDKDAKDLLIGLLCR 617
             D W+LG+  YE+ TG PPY D +  +  + I +  P R    ++    K+ +   L  
Sbjct: 202 KADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDE 261

Query: 618 DPKRR 622
           DP+ R
Sbjct: 262 DPEER 266

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score =  118 bits (295), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 128/261 (49%), Gaps = 13/261 (4%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVD 438
           + ++ + K IG+GSFGKV     R T +   LK   KS      EV +         + D
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYH-------RQFD 91

Query: 439 NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHD 498
            P+I  L     +  K+++ L +  G EL+ HL  + R          A++  A+   H 
Sbjct: 92  YPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHT 151

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT 558
            + ++RDLK EN+LLD  G+  L DFG  + +M  +    T CGT  Y+APE++  + Y 
Sbjct: 152 LNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPEMIQHKPYD 210

Query: 559 KV-VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFD-KDAKDLLIGLLC 616
              VD W+LGV+LY +L G  P+ ++D     +KI+ D     +     +A++L+  LL 
Sbjct: 211 GFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLS 270

Query: 617 RDPKRRLGYHGSDEIKSHPFF 637
           +DP  R     +  I  HPF 
Sbjct: 271 KDPTER---PNTSAILLHPFL 288

>Kwal_14.1159
          Length = 1521

 Score =  118 bits (295), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 106/163 (65%), Gaps = 4/163 (2%)

Query: 370 KPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA 429
           KPST    SI D+D++K I KG++G V   ++R T + +A+K ++KS +++K++VT+  +
Sbjct: 668 KPSTP---SIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKS 724

Query: 430 ERTVL-ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAE 488
           ER ++  + + P++  L  +FQ+   L+LV+ +++GG+L   ++  G       + Y +E
Sbjct: 725 ERAIMMVQSNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISE 784

Query: 489 LLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNM 531
           ++  +E +H   II+ DLKP+N+L+D +GH+ L DFGL ++ +
Sbjct: 785 VIYGVEDMHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGL 827

 Score = 98.6 bits (244), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 70/119 (58%), Gaps = 9/119 (7%)

Query: 536  KTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ- 594
            K   F GTP+YLAPE + G G T   DWW++G +L+E + G PP++   V +++  IL  
Sbjct: 954  KNKKFFGTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNILAG 1013

Query: 595  --DPLRFPDD------FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRL 645
              D   FPD+         +A+DL+  LL  DP +RLG +G++EI  HP+F  + W+ L
Sbjct: 1014 NIDWPAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWENL 1072

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score =  117 bits (292), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 150/309 (48%), Gaps = 25/309 (8%)

Query: 361 GKLNLS---VDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSY 417
           GKL+LS   +D+   +   +++D+   ++ +G G++G V +V  +  N + A+K +R   
Sbjct: 345 GKLSLSSRGIDFSNGSSSRITLDELQFIEELGHGNYGTVSKVLHKPNNVLMAMKEVR--L 402

Query: 418 IVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGEL--FYHLQRE- 474
            + +S+    L E  VL + ++PFIV    +F     +Y+ + +++GG L   Y    E 
Sbjct: 403 ELDESKFRQILMELEVLHKCNSPFIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDENPEM 462

Query: 475 GRFDLSRSRFYTAELLCALEALHDF-DIIYRDLKPENILLDY-QGHIALCDFGLCKLNMK 532
           G  D  +  F T  ++  L  L +  ++I+RD+KP NIL    QG + LCDFG+    + 
Sbjct: 463 GGIDEPQLAFITNAVIQGLRELKEVHNVIHRDVKPTNILCSAKQGTVKLCDFGVSGNLVA 522

Query: 533 DQEKTTTFCGTPEYLAPELLLGQG-----YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPK 587
              KT   C +  Y+APE +         YT   D W+LG+ + EM  G  PY  E    
Sbjct: 523 SLAKTNIGCQS--YMAPERIKSLNPDRGTYTVQSDIWSLGLSILEMALGRYPYPPETFDN 580

Query: 588 MYKKILQ----DPLRFP-DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSW 642
           ++ ++       P + P D F  +A+D +   L + P RR  Y     +  HP+  +   
Sbjct: 581 IFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRRPNY---SNLYEHPWLAKYRS 637

Query: 643 KRLKMKGYI 651
             ++M  YI
Sbjct: 638 IDVQMGPYI 646

>Scas_580.6
          Length = 1015

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 123/246 (50%), Gaps = 7/246 (2%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-P 440
           F   +VIG+G FG V +     T +IYA+K +  +    + EV     E   L+ +   P
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVL--NLDSDEDEVEDVQREVQFLSSLKQIP 94

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            I     S+     L++++ +  GG L   L R G+ D         ELL AL+ +H  +
Sbjct: 95  NITRYYGSYLKDTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKYIHKDN 153

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL-GQGYTK 559
           +I+RD+K  N+L+  +G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 154 VIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYDT 213

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD-PLRFPD-DFDKDAKDLLIGLLCR 617
            VD W+LG+  YE+ TG PPY + +  +  + I +  P R     +    K+ +   L  
Sbjct: 214 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDE 273

Query: 618 DPKRRL 623
           DPK RL
Sbjct: 274 DPKERL 279

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score =  113 bits (283), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 122/246 (49%), Gaps = 8/246 (3%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           + +   IG+G+FG V +   R T +I A+K +   +  S  ++     E   LA + +P 
Sbjct: 18  YSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEH--SDEDIELLAQEIFFLAELKSPL 75

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSR--FYTAELLCALEALHDF 499
           I     +      +++V+ +  GG     L+R     L   +  F   E+   L+ LH+ 
Sbjct: 76  ITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQ 135

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQ--GY 557
             I+RD+K  NILL+ +G + L DFG+   +++   K  TF GTP ++APE++  +  GY
Sbjct: 136 RKIHRDIKAANILLNEEGMVKLGDFGVSG-HIRSTLKRDTFVGTPYWMAPEVVCCEVDGY 194

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-LQDPLRFPDDFDKDAKDLLIGLLC 616
            +  D W+LG+  YE+L GLPP    D  K+   +  + P +    F   AKD + G L 
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLV 254

Query: 617 RDPKRR 622
           + P  R
Sbjct: 255 KTPADR 260

>Scas_201.1*
          Length = 274

 Score =  109 bits (272), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 118/218 (54%), Gaps = 6/218 (2%)

Query: 392 SFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVDNPFIVPLKFSFQ 450
           +FG V Q R+  + +  A+K + K+ +         L  E ++L R+ +P IV  K  F+
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNIVAFKDWFE 104

Query: 451 SSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPEN 510
           S +K Y+V     GGELF  + ++G+F    +     +LL A++ +H  +I++RDLKPEN
Sbjct: 105 SRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPEN 164

Query: 511 IL-LDY--QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLG 567
           +L LD   +  + + DFG+ K    + +      G+  Y+APE+L  +G+ K  D W+LG
Sbjct: 165 VLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGHGKPCDIWSLG 224

Query: 568 VLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDK 605
           V+ Y +L+G  P+  E V    ++  +   R+P  F K
Sbjct: 225 VITYTLLSGYSPFIAESVEGFLEECTRS--RYPVQFHK 260

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score =  115 bits (287), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 126/245 (51%), Gaps = 7/245 (2%)

Query: 367 VDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTH 426
           V+  P+         + L +VIGKG++G V +   R T+++ A+KAI         E   
Sbjct: 4   VNVTPAQRHTGQRKHYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEEELHEHML 63

Query: 427 TLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYT 486
            +    +L  + +  IV      QSS +LY++L +   G L   +++E   + ++++ Y 
Sbjct: 64  EI---DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEALSE-AKAKTYV 119

Query: 487 AELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEY 546
            + L  L+ LHD  +I+RD+K  N+LL   G + L DFG+   + +      T+ G+P +
Sbjct: 120 RQTLRGLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGV---STRVNNMAMTYAGSPNW 176

Query: 547 LAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKD 606
           +APE++LG+G + V D W+LG  + E+LTG PP+Y+         I+ D    P+    +
Sbjct: 177 MAPEVMLGKGASTVSDIWSLGATVVELLTGNPPFYNLVNEAACYAIVNDVYYPPEHLSAE 236

Query: 607 AKDLL 611
            K  +
Sbjct: 237 CKAFM 241

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score =  114 bits (284), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 120/230 (52%), Gaps = 7/230 (3%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           + L +VIG+G++G V +  KR TNK  A+K I       +SE+   + E  +L  + +  
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIE---FEDESELNEHMLEIDLLKNLRHQN 66

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDI 501
           IV  +   Q + +LY++L +   G L   + + G      +  Y  + L  L+ LH+  +
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSL-RDILKHGPLLEDDTVNYVTQTLYGLQYLHEQGV 125

Query: 502 IYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVV 561
           I+RD+K  N+LL  +G + L DFG+   + +      T+ G+P ++APE++ GQG + V 
Sbjct: 126 IHRDIKAANLLLTEEGIVKLADFGV---STRINRMAMTYAGSPNWMAPEVMTGQGASTVS 182

Query: 562 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLL 611
           D W+LG  + E+LTG PP+++         I+ +    P     + KD L
Sbjct: 183 DIWSLGATVVELLTGNPPFHNLVNESACYAIVNEEYIPPLTLSAECKDFL 232

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score =  112 bits (280), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 89/322 (27%), Positives = 149/322 (46%), Gaps = 53/322 (16%)

Query: 364 NLSVDYKPSTHKH---LSIDDFDLLKVIGKGSFGKVMQVR--KRDTNKIYALKAIRKSYI 418
           N S DY  S H++   L + ++ LL  IG+G+F +V +      D     A+KAI K  I
Sbjct: 100 NKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGI 159

Query: 419 VS--------------KSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFING 464
            S              + +V + +A   ++++ +NP         +S+   YLV   + G
Sbjct: 160 SSDAILKGNDRIQGSSRKKVLNEVAIHKLVSK-NNPHCTKFIAFQESANYYYLVTELVTG 218

Query: 465 GELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILL----------D 514
           GE+F  + +   F    +R    ++  A++ +H   I++RD+KPEN+L           D
Sbjct: 219 GEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGD 278

Query: 515 YQGH--------------IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKV 560
            Q                + L DFGL K    +  KT   CGT EY+A E+   + Y+  
Sbjct: 279 MQKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTP--CGTIEYVASEVFTSKRYSMK 336

Query: 561 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP----DDFDKDAKDLLIGLLC 616
           VD W++G +L+ +L G PP+Y+++   + KKI +    F     D+    AK+ +  LL 
Sbjct: 337 VDMWSIGCVLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLE 396

Query: 617 RDPKRRLGYHGSDEIKSHPFFN 638
            DP +R   +  D+  + P+ N
Sbjct: 397 VDPNKR---YDIDDFLNDPWLN 415

>Kwal_26.8751
          Length = 848

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 86/298 (28%), Positives = 142/298 (47%), Gaps = 18/298 (6%)

Query: 356 LESKMGKLNLSVDYKP-----STHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYAL 410
            E    K N+S  Y       S ++   + ++ +LK++G+GSFGKV       T++   L
Sbjct: 6   FEQNQLKANISASYNKLYGQFSLNELQEVGNYKILKIVGEGSFGKVYLASHCLTHQKVVL 65

Query: 411 KAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYH 470
           K      + SK++  + + E     + D   I  L     +   +++ L +  G EL+ +
Sbjct: 66  K------MGSKND-PNVVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEY 118

Query: 471 LQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLN 530
           L  +    L       ++++ A+   H    ++RDLK ENILLD +GH  L DFG  +  
Sbjct: 119 LLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTR-E 177

Query: 531 MKDQEKTTTFCGTPEYLAPELLLGQGYTKV-VDWWTLGVLLYEMLTGLPPYYDED-VPKM 588
              +    T CGT  Y+APEL+  + Y    +D W+LG++LY M+ G  P+ + D V   
Sbjct: 178 CATKGILETICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTK 237

Query: 589 YKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLK 646
           YK +  +P    D  D + K+L+  LL +DP +R       ++  HPF      K L+
Sbjct: 238 YKIVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSL---TQVLQHPFLQPYGLKILE 292

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 88/284 (30%), Positives = 142/284 (50%), Gaps = 33/284 (11%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVR-KRDTNKIYALKAIRKSYI---------VSKSEVTHTL 428
           I D +L   IG+GSFG V   R K D++ + A+K +              VS+  V H+ 
Sbjct: 11  IKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSK 70

Query: 429 AER--TVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYT 486
             +   VL  +D              E L+++L   +GG+LF  ++ +   D   ++FY 
Sbjct: 71  CSKHANVLRVIDCNV---------GGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYF 121

Query: 487 AELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQ--EKTTTFCGT 543
            +L+ AL  LHD  + +RD+KPENILLD +G++ L DFGL  +   KD     +T   G+
Sbjct: 122 QQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTDQRGS 181

Query: 544 PEYLAPELLLGQG-YTKVVDWWTLGVLLYEMLTG-----LPPYYDEDVPKMYKKILQDPL 597
           P Y+APE+L  QG Y  + D W+ GVLL+ +LTG     +P   D++         +  L
Sbjct: 182 PPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNEGKVSL 241

Query: 598 RFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLS 641
              +  +    +LL  +L  DP++R+     ++++ HP+    S
Sbjct: 242 GPWERVELRQMNLLRKILQPDPRKRVSL---EKLRHHPWLTSRS 282

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 122/245 (49%), Gaps = 7/245 (2%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-DNP 440
           F   ++IG+G FG V +     T ++YA+K +      ++ EV     E   L+ +   P
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDN--TEDEVEDIRKEIQFLSSLKQTP 73

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            I     S+    KL++++ +  GG L   L R G  +         E+L AL ++H  +
Sbjct: 74  NITHYYGSYLIDTKLWVIMEYCAGGSL-RTLLRPGIIEEKYIGVIMREILVALISIHRDN 132

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL-GQGYTK 559
           +I+RD+K  NIL+   G + LCDFG+     +   K  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD-PLRFPD-DFDKDAKDLLIGLLCR 617
            VD W+LG+  YE+ TG PPY   +  +  + I +  P R    ++ +  K+ +   L  
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDE 252

Query: 618 DPKRR 622
           DPK R
Sbjct: 253 DPKER 257

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score =  111 bits (277), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 150/324 (46%), Gaps = 67/324 (20%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVRKRDTN----KIYALKAIRKS----YIVSKSEVTHTLAE 430
           ++++ ++  IG+G+F +V +      N    K  A+K + K     + + K+    TL E
Sbjct: 64  LNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNE 123

Query: 431 RTV---LARVDNPFIVPLKFSFQSSEKLY-LVLAFINGGELFYHLQREGRFDLSRSRFYT 486
             +   L + + P +V L   FQ S+K Y  +  +I GGE+F  + +   F    +R   
Sbjct: 124 LNIHLKLTKANVPNVVKL-LEFQVSKKYYYFIQEYIEGGEIFNQIVKYTYFSEDLTRHVI 182

Query: 487 AELLCALEALHDFDIIYRDLKPENILLD----------YQG------------------- 517
            ++  A++ LH+ +II+RD+KPEN++ +          YQ                    
Sbjct: 183 RQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQKLRKSDDPKTKLDEGKFIPG 242

Query: 518 -------HIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELL---------LGQGYTKVV 561
                   + L DFGL +L    +    T CGT  YLAPE+L             Y+  V
Sbjct: 243 IGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAPEVLNQYKVDPRTSNTSYSYKV 302

Query: 562 DWWTLGVLLYEMLTGLPPYYDEDVPK--MYKKILQDPLRFP----DDFDKDAKDLLIGLL 615
           D W +G +LY ML G PP+Y+++  K  +  KI +   +F     D+   +A+DL+  LL
Sbjct: 303 DIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNYKFLAPWWDEISIEAQDLIRNLL 362

Query: 616 CRDPKRRLGYHGSDEIKSHPFFNQ 639
             DP +R   +  D++ +HP+ N 
Sbjct: 363 QVDPAKR---YDIDQLLAHPWLNH 383

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/361 (24%), Positives = 169/361 (46%), Gaps = 57/361 (15%)

Query: 368 DYKPSTHKHL--SIDDFDLLKVIGKGSFGKVMQVR-KRDTNKIYALKAIRKSYIVSKSEV 424
           D+  S + +L  S  ++   K IGKGSF  V +     D ++  A+K + ++ + +K  +
Sbjct: 8   DHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLL 67

Query: 425 THTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRF----DLS 480
            +   E  +L ++ +P IV L    ++S   YL++ +   G+L + L+R         L 
Sbjct: 68  ENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLL 127

Query: 481 RSRF--------------------YTAELLCALEALHDFDIIYRDLKPENILLD-----Y 515
           R+ F                    Y  +L  AL+ L   ++++RD+KP+N+LL      Y
Sbjct: 128 RTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGY 187

Query: 516 QGH----------------IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTK 559
                              + + DFG  +  + +     T CG+P Y+APE+L  Q Y  
Sbjct: 188 HDSKSFHELGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNA 246

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI--LQDPLRFPD--DFDKDAKDLLIGLL 615
             D W++G +++EM  G PP+   +  +++KKI    D + FP   + + + K+L+  LL
Sbjct: 247 KADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLL 306

Query: 616 CRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQ 675
             DP +R+G+   +E  ++   N+      +++  +P  +    G ++++ F  E+  +Q
Sbjct: 307 TFDPAQRIGF---EEFFANKVVNE-DLSSYELEDDLPELESKSKGIVESNMFVSEYLSKQ 362

Query: 676 P 676
           P
Sbjct: 363 P 363

>Kwal_27.9763
          Length = 868

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 122/222 (54%), Gaps = 10/222 (4%)

Query: 362 KLNLSVDYK-PSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVS 420
           K+NL+   K PST  +     + L +V+GKG++G V +   R T+K  A+K I       
Sbjct: 4   KVNLTPAQKVPSTGSN--THHYALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYD--EE 59

Query: 421 KSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLS 480
           +    H L E  +L  + +  IV      Q S +L+++L + + G L   L + G  +  
Sbjct: 60  EELNEHML-EIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSL-RDLIKRGPVEEQ 117

Query: 481 RSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTF 540
           + + Y  + L  L+ LHD  +I+RD+K  N+LLD Q  + L DFG+   + +      T+
Sbjct: 118 QCKTYIRQTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGV---STRVNNLAMTY 174

Query: 541 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYD 582
            G+P ++APE+++GQG + V D W+LG  + E+LTG PP+++
Sbjct: 175 AGSPNWMAPEVMMGQGASTVSDIWSLGATVVEILTGNPPFHN 216

>Scas_582.1
          Length = 638

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 140/283 (49%), Gaps = 22/283 (7%)

Query: 361 GKLNLS---VDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSY 417
           GKL+LS   +D+   +   +++ + + ++ +G G++G V +V  + TN I A+K ++   
Sbjct: 306 GKLSLSSKGIDFSNGSSSRITLAELEFIEELGHGNYGNVSKVLHKPTNVIMAMKEVKLE- 364

Query: 418 IVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGEL--FYHLQRE- 474
            + +++    L E  VL +  +P+IV    +F     +Y+ + +++GG L   Y    E 
Sbjct: 365 -LDEAKFRQILMELEVLHKCKSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDQDPEI 423

Query: 475 GRFDLSRSRFYTAELLCALEALHDF-DIIYRDLKPENILLDY-QGHIALCDFGLCKLNMK 532
           G  D  +       ++  L+ L D   II+RD+KP NIL    QG I LCDFG+    + 
Sbjct: 424 GGIDEPQLAVIATAVIRGLKVLKDVHHIIHRDVKPTNILCSAKQGTIKLCDFGVSGNLVA 483

Query: 533 DQEKTTTFCGTPEYLAPELLLG-----QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPK 587
              KT   C +  Y+APE +         YT   D W+LG+ + EM  G  PY  E    
Sbjct: 484 SMAKTNIGCQS--YMAPERIKSLNPDIATYTVQSDIWSLGLSILEMALGRYPYPPETFDN 541

Query: 588 MYKKILQ----DPLRFP-DDFDKDAKDLLIGLLCRDPKRRLGY 625
           ++ ++       P + P   F K+A+D +   L + P+RRL Y
Sbjct: 542 IFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQKVPERRLNY 584

>Scas_707.3
          Length = 1598

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 99/160 (61%), Gaps = 1/160 (0%)

Query: 378 SIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL-AR 436
           +I D+ +LK I KG++G V   RK+ T   +A+K ++KS +++K++VT+  +ER ++  +
Sbjct: 695 TIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQ 754

Query: 437 VDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEAL 496
            D P++  L  +FQ+ E L+LV+ ++ GG+L   ++  G       + Y  E++  ++ +
Sbjct: 755 SDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEIIVGVDDM 814

Query: 497 HDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEK 536
           H   II+ DLKP+N+L+D  GH+ L DFGL +  +  + K
Sbjct: 815 HRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGLIHRHK 854

 Score =  105 bits (262), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 84/148 (56%), Gaps = 17/148 (11%)

Query: 533  DQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 592
            D ++   F GTP+YLAPE + G G     DWW++G +++E+L G PP++      +++KI
Sbjct: 998  DSKQDKKFFGTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFRKI 1057

Query: 593  LQDPLRFPDDFDK----------DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSW 642
            L   + +P  FD           +AKDL++ LL  DP +RLG +G+DEIK HP+F  ++W
Sbjct: 1058 LSGKIEWP-QFDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFKDVNW 1116

Query: 643  KRL--KMKGYIPPYKPPVMGAMDTSNFD 668
              +  +   ++P  + P     DT  FD
Sbjct: 1117 DHVYDEEASFVPTVENP----EDTDYFD 1140

>Scas_685.24
          Length = 515

 Score =  110 bits (274), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 135/267 (50%), Gaps = 15/267 (5%)

Query: 363 LNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKS 422
           L++  +Y P   K     ++ + + +G+G+FG V +   R TNK+ A+K +    + + +
Sbjct: 6   LSIRREYTPRISKA---HNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVD---LENTN 59

Query: 423 EVTHTLAERTV-LARVDNPFIVPLKFSFQSSEKLYLVLAFINGG---ELFYHLQREGRFD 478
           E    LA+    LA + +P+I+    +      +++V+ +  GG   +L  +    G   
Sbjct: 60  ERLEVLAQEIFFLAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNG-LP 118

Query: 479 LSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTT 538
             +  + T E+L  L+ LH+   I+RD+K  NILL  +GH+ L DFG+    +K   +  
Sbjct: 119 EKKVAYITREILKGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG-QLKSTLRRG 177

Query: 539 TFCGTPEYLAPELLLG--QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDP 596
           T  GTP ++APE+     +GY + +D W+LG+ ++E+L G+PP    D  ++   + +  
Sbjct: 178 TIVGTPYWMAPEVASQNIEGYDEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKS 237

Query: 597 L-RFPDDFDKDAKDLLIGLLCRDPKRR 622
             R    +   AK  +   L ++P  R
Sbjct: 238 APRLQGAYSDAAKSFVALCLIKNPNER 264

>Kwal_55.21545
          Length = 865

 Score =  111 bits (277), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 122/245 (49%), Gaps = 7/245 (2%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN-P 440
           F   +VIG+G FG V +     T ++ A+K +  +   +  EV     E   L+ +   P
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVL--NLDSADDEVEDVQKEIQFLSSLKQVP 76

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500
            I     S+ +  KL++++ +  GG L   L R G+           ELL AL  +H   
Sbjct: 77  NITHYYGSYLNDTKLWVIMEYCAGGSL-RTLLRPGKIGEQYIGVIMRELLTALMHIHKDG 135

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL-GQGYTK 559
           +I+RD+K  N+L+   GHI LCDFG+     + + +  T  GTP ++APE+++ G  Y  
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDT 195

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD-PLRFPDDFDKDA-KDLLIGLLCR 617
            VD W+LG+  YE+ TG PPY + +  +  + I +  P R        A K+++   L  
Sbjct: 196 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDE 255

Query: 618 DPKRR 622
           DPK R
Sbjct: 256 DPKER 260

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score =  110 bits (276), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 141/290 (48%), Gaps = 51/290 (17%)

Query: 386 KVIGKGSFGKVMQVR-KRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 444
           K IGKGSF  V +     D     A+KA+ +S + +K  + +   E  +L ++ +P IV 
Sbjct: 15  KEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVG 74

Query: 445 LKFSFQSSEKLYLVLAFINGGELFYHLQREGRFD----------------------LSRS 482
           L    +++   YLV+ +   G+L + +++    +                      L+R+
Sbjct: 75  LIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRA 134

Query: 483 --RFYTAELLCALEALHDFDIIYRDLKPENILL-----DYQ--------GHIAL------ 521
               Y  +L  AL+ L   ++++RD+KP+N+LL     +Y+        G++ +      
Sbjct: 135 FVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPIL 194

Query: 522 --CDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPP 579
              DFG  +  +       T CG+P Y+APE+L  Q Y    D W++G +L+EM  G+PP
Sbjct: 195 KIADFGFARF-LPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPP 253

Query: 580 YYDEDVPKMYKKI--LQDPLRFPD--DFDKDAKDLLIGLLCRDPKRRLGY 625
           +   +  +++KKI    D + FP+  + +   K+L+  LL  DP +R+G+
Sbjct: 254 FTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGF 303

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score =  110 bits (275), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 127/258 (49%), Gaps = 10/258 (3%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           + L +VIG+GS+G V +   + T+++ A+K +      +  E+   +AE ++L  +++  
Sbjct: 25  YHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYE---NDEELNDIMAEISLLKNLNHNN 81

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGR-FDLSRSRFYTAELLCALEALHDFD 500
           IV      + S +LY++L +   G L   + R       + S+ Y  + L  L+ LH   
Sbjct: 82  IVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEG 141

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKV 560
           +I+RD+K  NILL     + L DFG+  +         T  GT  ++APE+L  +G + +
Sbjct: 142 VIHRDIKAANILLSADNTVKLADFGVSTI---VNSSALTLAGTLNWMAPEILGNRGASTL 198

Query: 561 VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPK 620
            D W+LG  + EMLT  PPY++     +Y  +  D    P  F +  KD L     ++  
Sbjct: 199 SDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMY 258

Query: 621 RRLGYHGSDEIKSHPFFN 638
           +R     +D++  H + N
Sbjct: 259 KR---PTADQLLKHVWIN 273

>Kwal_0.155
          Length = 587

 Score =  109 bits (272), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 144/320 (45%), Gaps = 61/320 (19%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQ-VRKRDTNKIY--------ALKAIRKSYIVS----- 420
           + L + D+ L+  IG+G+F KV + V +  ++K +        A+K I K ++ S     
Sbjct: 150 EQLELQDYKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDA 209

Query: 421 KSEVT---HTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLA-FINGGELFYHLQREGR 476
           KS+ T     L E  +   V     V     FQ S   Y ++   + GGE+F  + R   
Sbjct: 210 KSKATSREQVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTY 269

Query: 477 FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENIL---LDYQGH--------------- 518
           F    SR    +L  A++ +H   I++RD+KPEN+L   +DY+                 
Sbjct: 270 FSEDLSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQ 329

Query: 519 ----------------IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVD 562
                           + L DFGL K       KT   CGT  Y APE++  + Y+  VD
Sbjct: 330 DEGIFRPGIGGGGIGTVKLADFGLSKQIYSTNTKTP--CGTVGYTAPEVVKDERYSMQVD 387

Query: 563 WWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRF--P--DDFDKDAKDLLIGLLCRD 618
            W +G +LY +L G PP+YDE +  + +KI +    F  P  D+    AK+ +  LL  D
Sbjct: 388 MWGIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDEISDGAKNAVRRLLEVD 447

Query: 619 PKRRLGYHGSDEIKSHPFFN 638
           P +R   +  DE  + P+ N
Sbjct: 448 PSKR---YTIDEFLADPWLN 464

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 91/308 (29%), Positives = 150/308 (48%), Gaps = 24/308 (7%)

Query: 361 GKLNLS---VDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSY 417
           GKL+LS   VD+   +   +++D+ + L+ +G G++G V +V  + TN + A+K +R   
Sbjct: 353 GKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGTVSKVLHKPTNIMMAMKEVR--L 410

Query: 418 IVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGEL--FYHLQREG 475
            + +S+    L E  VL +  +P+IV    +F     +Y+ + F++GG L   Y     G
Sbjct: 411 ELDESKFRQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEFMDGGSLDKSYDPHEIG 470

Query: 476 RFDLSRSRFYTAELLCALEALHDF-DIIYRDLKPENILLDY-QGHIALCDFGLCKLNMKD 533
             +  +    T  ++  L+ L D  +II+RD+KP NIL    QG + LCDFG+    +  
Sbjct: 471 GIEEPQLALITESVIRGLKELKDVHNIIHRDVKPTNILCSATQGTVKLCDFGVSGNLVAS 530

Query: 534 QEKTTTFCGTPEYLAPELLLG-----QGYTKVVDWWTLGVLLYEMLTGLPPY----YDED 584
             +T   C +  Y+APE +         Y+   D W+LG+ + EM  G  PY    YD  
Sbjct: 531 LARTNIGCQS--YMAPERIKSLNPDKATYSVQSDIWSLGLSIVEMALGAYPYPPETYDNI 588

Query: 585 VPKMYKKILQDPLRFPDD-FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
             ++   +   P R P D F  DA+D +   L + P+RR  Y     +  HP+  +    
Sbjct: 589 FSQLSAIVDGPPPRLPKDTFSSDAQDFVRLCLQKIPERRPTY---ASLLEHPWLKKYRGL 645

Query: 644 RLKMKGYI 651
            + M  YI
Sbjct: 646 DVHMSEYI 653

>Kwal_56.23717
          Length = 858

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 119/232 (51%), Gaps = 10/232 (4%)

Query: 452 SEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENI 511
           S   Y++  +++GG+L  ++ + G      +R +   +  AL+ LH  +I++RDLK ENI
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENI 64

Query: 512 LLDYQGHIALCDFGLCKLNMKDQEKTT-TFCGTPEYLAPELLLGQGYT-KVVDWWTLGVL 569
           ++   G I + DFGL   NM + +K   TFCG+  + APELL    YT   VD W+ GV+
Sbjct: 65  MISTSGEIKIIDFGLS--NMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVV 122

Query: 570 LYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSD 629
           L+ ++ G  P+ DE+   +++KI Q  + +P     +   LL  +L  DP +R       
Sbjct: 123 LFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPTKRASL---K 179

Query: 630 EIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVV 681
           ++ +H +  +          YIP   P    A+D +   +E  R + +D VV
Sbjct: 180 QVVNHQWMQR--GYDFPAPSYIPHRVPLTADALDATVI-KEMYRLEFIDDVV 228

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 118/254 (46%), Gaps = 19/254 (7%)

Query: 388  IGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT-VLARVDNPFIVPLK 446
            IG GSFG V      DT  I A+K I+     S  ++  +L E   V+  +++P IV   
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQYY 1324

Query: 447  FSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDL 506
                  +K+ + + F  G  L   L+     D   ++ YT +LL  L  LH   +++RD+
Sbjct: 1325 GVEVHRDKVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDI 1384

Query: 507  KPENILLDYQGHIALCDFGLCKLNMKDQEKTTTF------------CGTPEYLAPELLLG 554
            KPENILLD  G I   DFG  KL  K+  K  +              GTP Y+APE + G
Sbjct: 1385 KPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVTG 1444

Query: 555  QGYTKVV--DWWTLGVLLYEMLTGLPPY--YDEDVPKMYKKILQDPLRFP--DDFDKDAK 608
            QG+ K    D W+LG ++ EM+TG  P+   D +   MY        +FP   +     +
Sbjct: 1445 QGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGHLPQFPTKSEISSAGR 1504

Query: 609  DLLIGLLCRDPKRR 622
              +   L +D  +R
Sbjct: 1505 KFISRCLIQDANKR 1518

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 84/149 (56%), Gaps = 11/149 (7%)

Query: 529 LNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM 588
           L++ +  ++  F GTP+YLAPE + G G +   DWW++G + +E L G PP++   V ++
Sbjct: 52  LSLFNPNESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEV 111

Query: 589 YKKILQDPLRFPDDFDK---------DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
           ++ I+   +R+P+  D          DAKDL+I LL  DP +RLG  GS EIK HP+F  
Sbjct: 112 FENIIGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKD 171

Query: 640 LSWKRLKMKGYIPPYKPPVMGAMDTSNFD 668
           + W  +  +   P + P V    DT  FD
Sbjct: 172 VDWDHVYDEQ--PSFVPRVEHPEDTEYFD 198

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 144/300 (48%), Gaps = 52/300 (17%)

Query: 376 HLSIDDFDLLKVIGKGSFGKVMQ-VRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 434
            L  +++ + K IGKGSF  V + +  RD   I A+KA+ +S + +K  + +   E  +L
Sbjct: 15  RLPTENYSVEKEIGKGSFAVVYKGLSLRDGRNI-AIKAVSRSKLKNKKLLENLEVEIAIL 73

Query: 435 ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREG----RFDLSRSRF------ 484
            ++ +P IV L    ++S   YL++ +   G+L + +++      +  L ++ F      
Sbjct: 74  KKIKHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPP 133

Query: 485 --------------YTAELLCALEALHDFDIIYRDLKPENILL-----DYQGH------- 518
                         Y  +L  AL+ L   ++++RD+KP+N+LL     DY          
Sbjct: 134 STEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELG 193

Query: 519 ---------IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVL 569
                    + + DFG  +  + +     T CG+P Y+APE+L  Q Y    D W++G +
Sbjct: 194 FVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTV 252

Query: 570 LYEMLTGLPPYYDEDVPKMYKKI--LQDPLRFPDDFDKDAK--DLLIGLLCRDPKRRLGY 625
           LYEM  G PP+   +  ++++KI    D +  P +   + K  +L+ GLL  DP  R+G+
Sbjct: 253 LYEMCCGRPPFKASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDPDSRMGF 312

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score =  107 bits (267), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 120/265 (45%), Gaps = 21/265 (7%)

Query: 377 LSIDDFDLLKVIGKGSFGKVMQVR-----------KRDTNKIYALKAIRKSYIVSKSEVT 425
           LS+  F LL+ +GKG+FG V               K   N   A+K I   +  S   + 
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEH--SNEPID 59

Query: 426 HTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFY 485
             L E   L+ +  P+I     +F     LY+V+ + + G L   L+   R     + F 
Sbjct: 60  LLLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFI 119

Query: 486 TAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLC---KLNMKDQ--EKTTTF 540
             ++  ALE LH+  +I+RDLK  NILL+  G + L D G+    K N      +   TF
Sbjct: 120 ILQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFNSTRHGGKNLNTF 179

Query: 541 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ---DPL 597
            GTP ++APE++  Q Y    D W+LG+   E+L G PP    D  K   +I +   D +
Sbjct: 180 VGTPFWMAPEIIKNQSYDGKCDIWSLGITTLELLNGKPPMSHLDSMKALMRIPKLNADSI 239

Query: 598 RFPDDFDKDAKDLLIGLLCRDPKRR 622
               D     KD +   L +DP +R
Sbjct: 240 LRNMDISPLGKDFIRSCLQQDPNQR 264

>Scas_713.7
          Length = 983

 Score =  108 bits (271), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 124/243 (51%), Gaps = 9/243 (3%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           + L +VIGKGS+G V +   + T +I A+K +      +  E+   + E  +L  +++  
Sbjct: 26  YQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYD---NDDELIEIMTEIDLLKNLNHVN 82

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGELFYHLQ--REGRFDLSRSRFYTAELLCALEALHDF 499
           IV      Q S  LY++L F + G L   L   ++G  +L  ++ Y  + L  L  LH+ 
Sbjct: 83  IVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD-AKVYIRQTLNGLVYLHEQ 141

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTK 559
            +I+RD+K  N+LLD    + L DFG+   + K      T  G+  +++PE++  +G + 
Sbjct: 142 GVIHRDIKAANLLLDSNDVVKLADFGV---STKVSNTAMTLAGSLHWMSPEIIGNRGAST 198

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDP 619
           + D W+LG  + E++TG PP+Y      +Y  I  DP   P+    +AKD L     ++ 
Sbjct: 199 LSDIWSLGATVVELVTGNPPFYKLVDVNIYYAIENDPFIPPEFLSNEAKDFLKKCFQKNM 258

Query: 620 KRR 622
            +R
Sbjct: 259 YKR 261

>Scas_673.20*
          Length = 758

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 121/252 (48%), Gaps = 25/252 (9%)

Query: 385 LKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 444
           LK IG+G+ G V    +  T+   A+K I    +  +  +     E  VL    +P I+ 
Sbjct: 484 LKRIGEGASGIVYTAYEIGTDISVAIKQID---LKIQPRLQMIWTEMLVLKEYQHPNIIN 540

Query: 445 LKFSFQSSEKLYLVLAFINGGEL-----FYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
              S+   + L++V+ +++GG L     F+    E    + R      E L  L  LH  
Sbjct: 541 FINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICR------ETLFGLNFLHSR 594

Query: 500 DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTK 559
            I++RD+K +NILL   G I + DFG C    +   K TT  GTP ++APE++  + Y  
Sbjct: 595 GIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKEYGP 654

Query: 560 VVDWWTLGVLLYEMLTGLPPYYDED-VPKMY------KKILQDPLRFPDDFDKDAKDLLI 612
            VD W+LG+++ EM+ G PPY  E  V  +Y      K IL++    P+      K+ + 
Sbjct: 655 KVDVWSLGIMIIEMIEGEPPYLHETPVRALYLITTNGKPILKE----PEKVGPVLKNFMD 710

Query: 613 GLLCRDPKRRLG 624
             L  DP+ RL 
Sbjct: 711 ECLRVDPEARLS 722

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score =  108 bits (270), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 140/290 (48%), Gaps = 51/290 (17%)

Query: 386 KVIGKGSFGKVMQVRKRDTNK-IYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 444
           K IG+GSF  V +    D++    A+KA+ +S + +K  + +   E  +L ++ +P IV 
Sbjct: 22  KEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLEIEIAILKKIKHPHIVG 81

Query: 445 LKFSFQSSEKLYLVLAFINGGEL-FYHLQREGRFD---LSRSRF---------------- 484
           L    ++    YL++ +   G+L F+  +R    D   L R+ F                
Sbjct: 82  LLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFEKYPPPSEHHNGLNRV 141

Query: 485 ----YTAELLCALEALHDFDIIYRDLKPENILL-----DY--------QGHIAL------ 521
               Y  +L  AL+ L   ++++RD+KP+N+LL     DY        +G + +      
Sbjct: 142 LVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPIL 201

Query: 522 --CDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPP 579
              DFG  +  + +     T CG+P Y+APE+L  Q Y    D W++G +LYEM  G PP
Sbjct: 202 KIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPP 260

Query: 580 YYDEDVPKMYKKI--LQDPLRFPDD--FDKDAKDLLIGLLCRDPKRRLGY 625
           +   +  ++++KI    D ++FP     +    DL+ GLL  +P +R+G+
Sbjct: 261 FKASNHLELFQKIKKANDVIQFPKHAALESAMVDLICGLLTFEPAKRMGF 310

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 102/204 (50%), Gaps = 13/204 (6%)

Query: 445 LKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRS-------RFYTAELLCALEALH 497
           L+   ++ + L++V+ ++ GG L   ++       + S        +   E    L+ LH
Sbjct: 645 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH 704

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
           D +II+RD+K +N+LLD +  + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 705 DKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEY 764

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD---PLRFPDDFDKDAKDLLIGL 614
              VD W+LG++  EML G PPY +ED  K    I  +    L+ P     + K  L   
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQSLSLEIKRFLSVC 824

Query: 615 LCRDPKRRLGYHGSDEIKSHPFFN 638
           LC D K R     ++E+  H FFN
Sbjct: 825 LCVDVKYRA---STEELLHHSFFN 845

>Kwal_26.7355
          Length = 1446

 Score =  108 bits (271), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 108/365 (29%), Positives = 173/365 (47%), Gaps = 40/365 (10%)

Query: 296  ILLPSQNWQE--TQISNNDILGDYVKKIR----NNSDIHLDSFHLPLNLKIDSASNIRLY 349
            I  P+ N QE  T  SN+  +    K IR      S+   DS    +  K     N +++
Sbjct: 1062 IAKPTNNSQEIITPRSNSLKIPKRTKTIRIIAREASEARRDSKVRSMGRK-----NTKMW 1116

Query: 350  NHHWIEL-ESKMGKLNLSVDYKPSTHKHLSIDDFDLLK--VIGKGSFGKVMQVRKRDTNK 406
                +E+ + KM  +N S       + +    +F  +K  +IGKGSFG V       T +
Sbjct: 1117 GTRVVEVTDKKMVAINKS------KNSNGEYKEFAWIKGEMIGKGSFGSVFLGLNVTTGE 1170

Query: 407  IYALKAIRKSYIVSKSEVTHTL-----AERTVLARVDNPFIVPLKFSFQSSEKLY-LVLA 460
            + A+K +      S+ E T ++     +E   L  +D+  IV     F++   +Y L L 
Sbjct: 1171 MIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHTNIVQY-LGFENKNYVYSLFLE 1229

Query: 461  FINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIA 520
            ++ GG +   ++  G+FD +  RF   ++L  L  LH   I++RD+K +N+LLD  G   
Sbjct: 1230 YVAGGSVGSLIRLYGKFDENLIRFLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICK 1289

Query: 521  LCDFGLCKL-NMKDQEKTTTFCGTPEYLAPELL-LGQGYTKVVDWWTLGVLLYEMLTGLP 578
            + DFG+ K  N        T  GT  ++APE++   QGY+  VD W+LG ++ EM  G  
Sbjct: 1290 ISDFGISKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKR 1349

Query: 579  PYYD-EDVPKMYK--KILQDPLRFPDDFDK----DAKDLLIGLLCRDPKRRLGYHGSDEI 631
            P+ + E V  M+K  K    P   P+D  K    + K+ L      +P++R     +DE+
Sbjct: 1350 PWSNLEVVAAMFKIGKFKSAPP-IPEDTQKIISAEGKEFLDACFEINPEKR---PTADEL 1405

Query: 632  KSHPF 636
             SHPF
Sbjct: 1406 LSHPF 1410

>Scas_573.10
          Length = 569

 Score =  106 bits (265), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 94/333 (28%), Positives = 148/333 (44%), Gaps = 75/333 (22%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQ-VRKR--------DTNKIYALKAIRKSYIVS---KS 422
           + + +  + L++ +G+G+F KV + V +R        +  K  A+K I+K+ +V    K+
Sbjct: 112 EQVELQGYTLIEKVGEGAFSKVFRAVPQRNGPTSFLCENYKEVAIKIIKKTALVGDDPKA 171

Query: 423 EV----------THTLAERTVLARVD--------NPFIVPLKFSFQSSEKLY-LVLAFIN 463
           ++          + T ++  VL  V          P IV     FQ S+  Y +V   I+
Sbjct: 172 DIHVAESHNRKHSKTSSKEQVLKEVSLHKAVSSGCPQIVQF-IDFQESKTYYYIVQELIH 230

Query: 464 GGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHI---- 519
           GGE+F  + +   F    SR    +L  A++ LH   +++RD+KPEN+L +    I    
Sbjct: 231 GGEIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEPIEFIPSKE 290

Query: 520 ------------------------------ALCDFGLCKLNMKDQEKTTTFCGTPEYLAP 549
                                          L DFGL K       KT   CGT  Y AP
Sbjct: 291 PKLRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLSKQIFATNTKTP--CGTVGYTAP 348

Query: 550 ELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRF--P--DDFDK 605
           E++  + Y+  VD W +G +LY ML G PP+YDE +  + +KI +    F  P  D+   
Sbjct: 349 EVVKDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEKISRGEYTFLRPWWDEISA 408

Query: 606 DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFN 638
            AK+ +I LL  DP +R   +  DE    P+ N
Sbjct: 409 GAKNAVIRLLEVDPNKR---YDIDEFLEDPWLN 438

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score =  107 bits (268), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 120/248 (48%), Gaps = 7/248 (2%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 434
           +H S+  + L ++IG+GS+G V +   + T +  A+K +         E+   ++E  +L
Sbjct: 16  EHKSVQ-YQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQ---DDDELVDIMSEIDLL 71

Query: 435 ARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
             +++  IV      Q    LY++L +   G L   + R        ++ Y  + L  L 
Sbjct: 72  KNLNHINIVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLN 131

Query: 495 ALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG 554
            LH+  +I+RD+K  NILLD +  + L DFG   ++ K      T  G+  ++APE++  
Sbjct: 132 YLHEQGVIHRDIKAANILLDSENVVKLADFG---VSTKVNNTAMTLAGSLNWMAPEIIGN 188

Query: 555 QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGL 614
           +G + + D W+LG  + E+LTG PP+++     +Y  I  D    P      AKD L   
Sbjct: 189 RGASTLSDIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQC 248

Query: 615 LCRDPKRR 622
             ++  +R
Sbjct: 249 FAKNMYKR 256

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score =  107 bits (266), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 108/220 (49%), Gaps = 23/220 (10%)

Query: 445 LKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRS-------RFYTAELLCALEALH 497
           L+   ++ + L++V+ ++ GG L   ++     D S S        +   E    L+ LH
Sbjct: 577 LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLH 636

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
           D  II+RD+K +N+LLD  G + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 637 DKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 696

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD---PLRFPDDFDKDAKDLLIGL 614
            + VD W+LG++  EML G PPY +E+  K    I  +    L+ P+    + K  L   
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLKHPELLSLEIKRFLSVC 756

Query: 615 LCRDPKRRLGYHGSDEIKSHPFF----------NQLSWKR 644
           LC D + R     ++E+  H FF          N L WK+
Sbjct: 757 LCVDVRYRA---STEELLHHSFFETSCEPEELANLLKWKK 793

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 106/204 (51%), Gaps = 13/204 (6%)

Query: 445 LKFSFQSSEKLYLVLAFINGGELFYHLQRE-----GRFDLSRSR--FYTAELLCALEALH 497
           L+   ++ + L++V+ ++ GG L   ++       G+  L+  +  +   E    L+ LH
Sbjct: 663 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLH 722

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
           D  II+RD+K +N+LLD +G + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 723 DKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 782

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD---PLRFPDDFDKDAKDLLIGL 614
            + VD W+LG++  EML   PPY +E+  K    I  +    L+ P+    + K  L   
Sbjct: 783 DEKVDVWSLGIMTIEMLESEPPYLNEEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVC 842

Query: 615 LCRDPKRRLGYHGSDEIKSHPFFN 638
           LC D K R     ++E+  H FFN
Sbjct: 843 LCVDVKYRA---STEELLHHSFFN 863

>Kwal_33.14081
          Length = 580

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 89/308 (28%), Positives = 147/308 (47%), Gaps = 24/308 (7%)

Query: 361 GKLNLS---VDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSY 417
           GKL+LS   VD+   +   +++D+ + L+ +G G++G V +V  + TN I A+K +R   
Sbjct: 250 GKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGNVSKVLHKPTNVIMAMKEVRLE- 308

Query: 418 IVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGEL--FYHLQREG 475
            + +S+ T  L E  VL +  +P+IV    +F     +Y+ + +++GG L   Y     G
Sbjct: 309 -LDESKFTQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKSYDSDVLG 367

Query: 476 RFDLSRSRFYTAELLCALEALHDF-DIIYRDLKPENILLD-YQGHIALCDFGLCKLNMKD 533
             D     +    ++  L+ L D  +II+RD+KP N+L    QG + LCDFG+    +  
Sbjct: 368 GIDEPELAYIANAIIQGLKELKDVHNIIHRDVKPTNVLCSAAQGTVKLCDFGVSGNLVAS 427

Query: 534 QEKTTTFCGTPEYLAPELLLG-----QGYTKVVDWWTLGVLLYEMLTGLPPY----YDED 584
             KT   C +  Y+APE +         YT   D W+LG+ + EM  G  PY    +D  
Sbjct: 428 LAKTNIGCQS--YMAPERIKSFNPDKATYTVQSDIWSLGLSILEMAIGTYPYPVETFDNI 485

Query: 585 VPKMYKKILQDPLRFPDD-FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
             ++   +   P + P   F   A+D +   L + P+RR  Y     +  HP+       
Sbjct: 486 FSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQKIPERRRNYAA---LLEHPWLKTHHLS 542

Query: 644 RLKMKGYI 651
            + M  YI
Sbjct: 543 EVNMSEYI 550

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 127/270 (47%), Gaps = 23/270 (8%)

Query: 361 GKLN-LSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIV 419
            KLN +  D  PST        +  L  IG+G+ G V    +  TN   A+K +      
Sbjct: 605 AKLNEICSDGDPSTK-------YANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQP 657

Query: 420 SKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELF----YHLQREG 475
            K  +   + E  V+    +P IV    S+     L++++ ++ GG L     + +  EG
Sbjct: 658 KKELI---INEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEG 714

Query: 476 RFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQE 535
           +           E L  LE LH   +++RD+K +NILL  +G I L DFG C    +   
Sbjct: 715 QIGA-----VCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNL 769

Query: 536 KTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD 595
           K TT  GTP ++APE++  + Y   VD W+LG+++ EM+ G PPY +E   +    I  +
Sbjct: 770 KRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 829

Query: 596 ---PLRFPDDFDKDAKDLLIGLLCRDPKRR 622
               L+ P++     K  L   LC +P+ R
Sbjct: 830 GTPKLKEPENLSSSLKKFLDWCLCVEPEDR 859

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 93/335 (27%), Positives = 156/335 (46%), Gaps = 67/335 (20%)

Query: 365 LSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAI-------RKSY 417
           +S+ Y P + + + ++ ++++K +G G  GKV   R   T ++ A+K +       RK +
Sbjct: 125 ISLTYDPVSKRKV-LNTYEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKFF 183

Query: 418 IV---SKSEVTHTLAERTVLARVDNPFIVPLKFSFQ--SSEKLYLVLAFINGGELFYH-- 470
                 K+E      E  ++ +  +  +V L        S K+YLVL + + GE+ +   
Sbjct: 184 SFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCPP 243

Query: 471 --LQREGRFDLSRSRFYTAELL----CALEALHDFDIIYRDLKPENILLDYQGHIALCDF 524
             L+ E +     S  +T E+L      LE LH   II+RD+KP N+LL   G + + DF
Sbjct: 244 DCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISDF 303

Query: 525 GLC----KLNMKDQEKT------TTFCGTPEYLAPELLLGQ-GYTKV------------- 560
           G+       N+   ++T          GTP + APE+ LG+  + K              
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCI 363

Query: 561 ---VDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFD------------- 604
              +D W LGV LY ++ G+ P+      ++++KI+ DP++FP   D             
Sbjct: 364 SFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQMTEE 423

Query: 605 ---KDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPF 636
              + AKDLL  LL ++P +R+     +EIK HPF
Sbjct: 424 AEYEAAKDLLTRLLEKNPIKRINI---EEIKRHPF 455

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score =  105 bits (261), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 119/248 (47%), Gaps = 12/248 (4%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           F +   IG+G+FG V + +    N++ A+K +      S+ EV     E   LA + +P+
Sbjct: 5   FVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVNLEN--SEEEVELLAQEIFFLAELKSPY 62

Query: 442 IVPLKFSFQSSEKLYLVLAFINGGE----LFYHLQREGRFDLSRSRFYTAELLCALEALH 497
           +     +      +++ + +  GG     L YH          ++RF T E+L  L  LH
Sbjct: 63  VTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYT--SGLPEHKTRFITREILKGLSYLH 120

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL--GQ 555
               I+RD+K  NILL  +G + L DFG+    +    +  TF GTP ++APE++    +
Sbjct: 121 SQRKIHRDIKAANILLTDEGKVKLSDFGVSG-KLLSSFRRDTFVGTPYWMAPEIVAHDSE 179

Query: 556 GYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI-LQDPLRFPDDFDKDAKDLLIGL 614
           GY +  D W+LG+ + EML G PP    D  K+   +  + P +   DF  DAK  +   
Sbjct: 180 GYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGDFSDDAKHFVALC 239

Query: 615 LCRDPKRR 622
           L ++   R
Sbjct: 240 LIKESAIR 247

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 89/308 (28%), Positives = 152/308 (49%), Gaps = 24/308 (7%)

Query: 361 GKLNLS---VDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSY 417
           GKL+LS   VD+   +   + +D+ + L+ +G G++G V +V  + T+ I A+K +R   
Sbjct: 394 GKLSLSSKGVDFSNGSSFRIKLDELEFLEELGHGNYGNVSKVLHKPTHIIMAMKEVR--L 451

Query: 418 IVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGEL--FYHLQREG 475
            + +S+    L E  VL    +P+IV    +F     +Y+ + +++GG L   Y  ++ G
Sbjct: 452 ELDESKFRQILMELEVLHNCQSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKTYDDEQIG 511

Query: 476 RFDLSRSRFYTAELLCALEALHDF-DIIYRDLKPENILLDY-QGHIALCDFGLCKLNMKD 533
             D  +    T+ ++  L+ L D  +II+RD+KP NIL    QG I LCDFG+    +  
Sbjct: 512 GIDEPQLARITSSVIQGLKELKDVHNIIHRDVKPTNILCSASQGTIKLCDFGVSGNLVAS 571

Query: 534 QEKTTTFCGTPEYLAPELLLG-----QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM 588
             KT   C +  Y+APE +         Y+   D W+LG+ + EM  G  PY  E    +
Sbjct: 572 LAKTNIGCQS--YMAPERIKSLNPDKSTYSVQSDIWSLGLSILEMALGAYPYPPETFDNI 629

Query: 589 YKKILQ----DPLRFPD-DFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
           + ++       P + P+  F  DA++ +   L + P+RR  Y     +  HP+  +    
Sbjct: 630 FSQLSAIVDGPPPKLPEGKFSADAQNFVSMCLQKIPERRPTYAA---LLEHPWLKKYENV 686

Query: 644 RLKMKGYI 651
            ++M  YI
Sbjct: 687 DVRMSEYI 694

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 130/276 (47%), Gaps = 31/276 (11%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKR-DTNKIYALKAI------RKSYIVSKSEVTHTLAERT 432
           D F+    IG+G+ G V     R D ++  A+K +      +K  IV++  V  +   + 
Sbjct: 564 DKFETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQN 623

Query: 433 VLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELF----YHLQREGRFDLSRSRFYTAE 488
           ++  +D         S+ S   L++V+ ++ GG L     Y +  EG+           E
Sbjct: 624 IVNYID---------SYLSGLDLWVVMEYMEGGCLTDVVTYCVLTEGQIGA-----VCRE 669

Query: 489 LLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLA 548
           +L  LE LH   +++RD+K +N+LL   G I L DFG C        K TT  GTP ++A
Sbjct: 670 VLQGLEFLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMA 729

Query: 549 PELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD---PLRFPDDFDK 605
           PE++  + Y   VD W+LG+++ EM+ G PPY +E   +    I  +    ++ PD   K
Sbjct: 730 PEIVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSK 789

Query: 606 DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLS 641
           D K+ +   L      R     S E+  H F  +++
Sbjct: 790 DFKEFIDKCLAVTVSERA---ESSELLQHKFITEVA 822

>Scas_711.25
          Length = 1515

 Score =  105 bits (262), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 131/266 (49%), Gaps = 20/266 (7%)

Query: 386  KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSE-----VTHTLAERTVLARVDNP 440
            ++IGKGSFG V       T ++ A+K +      S+ E     V    +E + L  +D+ 
Sbjct: 1218 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDHL 1277

Query: 441  FIVPLKFSFQSSEKLY-LVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
             IV     F++ + +Y L L ++ GG +   ++  GRFD    R    ++L  L  LH  
Sbjct: 1278 NIVQY-LGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSR 1336

Query: 500  DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKD--QEKTTTFCGTPEYLAPELL-LGQG 556
             I++RD+K +N+LLD  G   + DFG+ + + KD       T  GT  ++APE++   QG
Sbjct: 1337 GILHRDMKADNLLLDQDGVCKISDFGISRKS-KDIYSNSDMTMRGTVFWMAPEMVDTKQG 1395

Query: 557  YTKVVDWWTLGVLLYEMLTGLPPYYD-EDVPKMYK--KILQDPLRFPDDF---DKDAKDL 610
            Y+  VD W+LG ++ EM  G  P+ + E V  M+K  K    P   PD      ++ +D 
Sbjct: 1396 YSAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTLPLISQNGRDF 1455

Query: 611  LIGLLCRDPKRRLGYHGSDEIKSHPF 636
            L      DP  R     +D + SHPF
Sbjct: 1456 LDACFEIDPDNR---PTADNLLSHPF 1478

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score =  104 bits (259), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 123/252 (48%), Gaps = 18/252 (7%)

Query: 388  IGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLA-ERTVLARVDNPFIVPLK 446
            IG GSFG V      DT  I A+K I+ +   +  +V  ++  E TVL  +++P +V   
Sbjct: 1197 IGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLNHPNVVQYY 1256

Query: 447  FSFQSSEKLYLVLAFINGGELFYHLQREGRF-DLSRSRFYTAELLCALEALHDFDIIYRD 505
                  +++ + + +  GG L   L   GR  D   ++ Y+ ++L  L  LH+  + +RD
Sbjct: 1257 GVEVHRDRVNIFMEYCEGGSL-ASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRD 1315

Query: 506  LKPENILLDYQGHIALCDFGLC---------KLNMKDQEKTTTFCGTPEYLAPELLLGQG 556
            +KPENILLD+ G I   DFG           KLN++   +     GTP Y++PE + G G
Sbjct: 1316 IKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTG 1375

Query: 557  YTKVV--DWWTLGVLLYEMLTGLPPY--YDEDVPKMYKKILQDPLRFP--DDFDKDAKDL 610
            Y K    D W+LG ++ EM+TG  P+   D     +Y+        FP  ++  +     
Sbjct: 1376 YGKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIKF 1435

Query: 611  LIGLLCRDPKRR 622
            L   L +DP +R
Sbjct: 1436 LSRCLIQDPNQR 1447

>Scas_598.6
          Length = 790

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 139/303 (45%), Gaps = 31/303 (10%)

Query: 355 ELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRK--------RDTNK 406
           E+ SK+  + ++ D  P          F +++  G+G+ G V    +         +T +
Sbjct: 484 EIMSKLKSVTINTDPSPY---------FQMIEKAGQGASGSVYLAERIAIPPGEFDETPE 534

Query: 407 IYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP-LKFSFQSSEKLYLVLAFINGG 465
           +    AI++  +  +      + E  V+    +  IV  L+   ++ + L++V+ F+ GG
Sbjct: 535 VGDKVAIKQMILSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGG 594

Query: 466 ELFYHLQREGRFDLSRS-------RFYTAELLCALEALHDFDIIYRDLKPENILLDYQGH 518
            L   ++       S S        +   E    L+ LHD  II+RD+K +N+LLD    
Sbjct: 595 SLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNNAR 654

Query: 519 IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLP 578
           + + DFG C      + K  T  GTP ++APE++  + Y + VD W+LG++  EML   P
Sbjct: 655 VKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLESEP 714

Query: 579 PYYDEDVPKMYKKILQD---PLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHP 635
           PY +ED  K    I  +    L+ P+    + K  L   LC D + R     ++E+  H 
Sbjct: 715 PYLNEDPLKALYLIATNGTPKLKNPESLSLEIKRFLSVCLCVDVRYRA---STEELLHHG 771

Query: 636 FFN 638
           FF+
Sbjct: 772 FFD 774

>Kwal_23.5290
          Length = 819

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 102/204 (50%), Gaps = 13/204 (6%)

Query: 445 LKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRS-------RFYTAELLCALEALH 497
           L+   ++ + L++V+ ++ GG L   ++       S S        +   E    L+ LH
Sbjct: 603 LEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH 662

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
           D  II+RD+K +N+LLD +  + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 663 DKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 722

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD---PLRFPDDFDKDAKDLLIGL 614
            + VD W+LG++  EML G PPY +ED  K    I  +    L+ P+      K  L   
Sbjct: 723 DEKVDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKQPEVLSLKIKRFLSVC 782

Query: 615 LCRDPKRRLGYHGSDEIKSHPFFN 638
           LC D K R     ++E+  H FF+
Sbjct: 783 LCVDVKYRA---STEELLHHSFFD 803

>Kwal_27.9773
          Length = 406

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 134/285 (47%), Gaps = 45/285 (15%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           +++ +L+ IG+GSFG V +V    TN++   K I+  ++ SK E    ++E  +L+++ +
Sbjct: 17  NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSK-ERQQLISECAILSQLKH 75

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGEL---FYHLQREGRFDLSR-------------SR 483
             IV         + LY  + + + G+L     H ++E ++   R              R
Sbjct: 76  ENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYR 135

Query: 484 FYTAELLCALEALHDFD---------IIYRDLKPENILL---------------DYQG-H 518
            +    L  LE ++D           +I+RDLKP NI L               DY    
Sbjct: 136 CHYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKIS 195

Query: 519 IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLP 578
           + L DFGL K      E  TT+ GTP Y++PE+L+ Q Y+ + D W+LG ++YEM T  P
Sbjct: 196 VKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 579 PYYDEDVPKMYKKILQDPL-RFPDDFDKDAKDLLIGLLCRDPKRR 622
           P+  +   ++ ++I      R PD +  + + L+    C DP  R
Sbjct: 256 PFQAKTYTELQRRIKTAKFDRIPDYYSDELQMLIES--CIDPNLR 298

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 139/313 (44%), Gaps = 57/313 (18%)

Query: 365 LSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEV 424
           L+ +YK    K +S  D D+     +    +  + ++ +TN++ + + + K   + K+  
Sbjct: 178 LARNYKQVAVKVISKHDLDVSNKEQQAKDKRAGRDKQNNTNRMSSREQVMKEVRIHKAVA 237

Query: 425 THTLAERTVLARVDNPFIVPLKFSFQSSEKLY-LVLAFINGGELFYHLQREGRFDLSRSR 483
                          P+IV     FQ ++  Y L+   ++GGE+F  + R        SR
Sbjct: 238 AGC------------PYIVGF-IDFQETKHYYYLIQELLDGGEIFNEIVRLTYLSEDLSR 284

Query: 484 FYTAELLCALEALHDFDIIYRDLKPENIL---LDY------------------------- 515
               ++  A+  +H   I++RD+KPEN+L   ++Y                         
Sbjct: 285 HVIKQVALAVRHMHSLGIVHRDIKPENLLFKSIEYIPSKKRTFRKSDDPATKADEGVFIP 344

Query: 516 ------QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVL 569
                  G + L DFGL K     Q+ T T CGT  Y APE++  + Y+  VD W +G +
Sbjct: 345 TIGGGGIGIVKLADFGLSKQIF--QKNTKTPCGTIGYTAPEVVKDEKYSMQVDMWGIGCV 402

Query: 570 LYEMLTGLPPYYDEDVPKMYKKILQDPLRF--P--DDFDKDAKDLLIGLLCRDPKRRLGY 625
           LY ML G PP+YDE +  + +KI +    F  P  D+    AK  +  LL  DP++R   
Sbjct: 403 LYTMLCGFPPFYDEKIDVLTEKISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRKR--- 459

Query: 626 HGSDEIKSHPFFN 638
           +  DE  + P+ N
Sbjct: 460 YTIDEFLADPWLN 472

>Scas_675.2
          Length = 527

 Score =  101 bits (252), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 144/277 (51%), Gaps = 22/277 (7%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVR-KRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL--A 435
           I D  L   IG+GSFG VM      D + I A+K +       K+ +T     R VL  +
Sbjct: 12  IKDVVLGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIP-TCKKNGLTEKDISREVLLHS 70

Query: 436 RVD-NPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALE 494
           R   NP ++ L     + + +++++   +GG+LF  ++ +   D   ++FY  +L+ A+ 
Sbjct: 71  RCSKNPNVLRLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAIS 130

Query: 495 ALHD-FDIIYRDLKPENILLDYQGHIALCDFGL-CKLNMKDQ--EKTTTFCGTPEYLAPE 550
            LH+   + +RD+KPENILLD  G++ L DFGL  +   KD     +T   G+P Y+APE
Sbjct: 131 YLHEECGVAHRDIKPENILLDKNGNLKLADFGLSSQYRRKDGTLRISTDQRGSPPYMAPE 190

Query: 551 LLLGQG-YTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKM-YKKILQDPLRFPDDFDKDAK 608
           +L  +G Y    D W++G+LL+ +LTG  P+    + ++ +   LQ+      +    AK
Sbjct: 191 ILHSRGYYAHSTDIWSIGILLFVLLTGETPWELPVIEELNFASFLQNNGNL--NLGPWAK 248

Query: 609 ------DLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
                 +LL  +L  DPK+R        ++SHP+F +
Sbjct: 249 IEFFHLNLLRKILQPDPKKRATLK---ILRSHPWFTK 282

>Kwal_23.6325
          Length = 1542

 Score =  102 bits (255), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 120/256 (46%), Gaps = 19/256 (7%)

Query: 386  KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER-TVLARVDNPFIVP 444
            + +G G+FG V      DT +I A+K I+     S  +V   + E  +VL  +++P +V 
Sbjct: 1253 QFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHPNVVQ 1312

Query: 445  LKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYR 504
                    +K+ L + +  GG L   L+     D   ++ Y  ++L  L  LH   +++R
Sbjct: 1313 YYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHR 1372

Query: 505  DLKPENILLDYQGHIALCDFGLCKLNMKDQEKT------------TTFCGTPEYLAPELL 552
            D+KPENILLD+ G I   DFG  +    +  K              +  GTP Y++PE +
Sbjct: 1373 DIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESI 1432

Query: 553  LG--QGYTKVVDWWTLGVLLYEMLTGLPPYY--DEDVPKMYKKILQDPLRFP--DDFDKD 606
             G  +G     D W+LG ++ EM+TG  P++  D +   MY        + P  ++    
Sbjct: 1433 TGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSPQ 1492

Query: 607  AKDLLIGLLCRDPKRR 622
              D L+  L +DP +R
Sbjct: 1493 GIDFLLRCLKQDPNKR 1508

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score =  102 bits (254), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 106/205 (51%), Gaps = 13/205 (6%)

Query: 383 DLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFI 442
           DL+K IG+G+ G V      ++    A+K +       K  +   L E  V+    +  I
Sbjct: 622 DLIK-IGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKELI---LNEILVMRESKHSNI 677

Query: 443 VPLKFSFQSSEKLYLVLAFINGGELF----YHLQREGRFDLSRSRFYTAELLCALEALHD 498
           V    S+ +   L++V+ ++ GG L     + L  EG+           E L  L+ LH 
Sbjct: 678 VNFIDSYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQIGA-----VCRETLKGLQFLHS 732

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT 558
             +++RD+K +NILL  +G+I L DFG C    ++  K TT  GTP ++APE++  + Y 
Sbjct: 733 KGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYG 792

Query: 559 KVVDWWTLGVLLYEMLTGLPPYYDE 583
             VD W+LG+++ EM+ G PPY +E
Sbjct: 793 PKVDIWSLGIMIIEMIEGEPPYLNE 817

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 104/207 (50%), Gaps = 10/207 (4%)

Query: 380 DDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDN 439
           +  D L ++G+G+ G V + + R+ +KI+ALK I  + I +         E        +
Sbjct: 177 EQIDTLGILGEGTGGSVTKCKLRNGSKIFALKTI--ATIENDGSEKQIFRELQFNKSCKS 234

Query: 440 PFIVPL--KFSFQSSEKLYLVLAFINGGEL---FYHL-QREGRFDLSRSRFYTAELLCAL 493
            FIV     F+ + +  +++ + ++ G  L   + HL  + GR            +L  L
Sbjct: 235 DFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGL 294

Query: 494 EALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLL 553
             LH+  II+RD+KP+NIL +  G I LCDFG+    +      TTF GT  Y+APE + 
Sbjct: 295 FYLHERKIIHRDIKPQNILFNEIGQIKLCDFGVSGEAVNSL--ATTFTGTSYYMAPERIQ 352

Query: 554 GQGYTKVVDWWTLGVLLYEMLTGLPPY 580
           GQ Y+   D W+LG+ L E+  G  P+
Sbjct: 353 GQPYSVTSDVWSLGLTLLEVAQGHSPF 379

>Scas_668.22
          Length = 893

 Score =  101 bits (252), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 118/242 (48%), Gaps = 15/242 (6%)

Query: 388 IGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKF 447
           IG+G+ G V    +  +N+  A+K +       K  +   + E  V+    +P IV    
Sbjct: 617 IGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKELI---INEILVMKGSRHPNIVNFID 673

Query: 448 SFQSSEKLYLVLAFINGGELF----YHLQREGRFDLSRSRFYTAELLCALEALHDFDIIY 503
           S+     L++++ ++ GG L     + +  EG+           E L  L+ LH   +++
Sbjct: 674 SYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGA-----VCRETLSGLQFLHSKGVLH 728

Query: 504 RDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDW 563
           RD+K +NILL   G I L DFG C    +   K TT  GTP ++APE++  + Y   VD 
Sbjct: 729 RDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDI 788

Query: 564 WTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD---PLRFPDDFDKDAKDLLIGLLCRDPK 620
           W+LG+++ EM+ G PPY +E   +    I  +    L+ P++     ++ L   L  DP+
Sbjct: 789 WSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPE 848

Query: 621 RR 622
           +R
Sbjct: 849 QR 850

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 88/330 (26%), Positives = 143/330 (43%), Gaps = 74/330 (22%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQVRKRDTN-------------KIYALKAIRKSYI--- 418
           +   + D+ L++ IG+G+F KV +     +N             K  A+K I K  +   
Sbjct: 113 EQTELKDYTLIQKIGEGAFSKVYRGIPSTSNCSNGASSVIAQQYKEVAIKVIIKQQLPNT 172

Query: 419 -----------VSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLA-FINGGE 466
                       +  +V   +A   +++  +N  IV     FQ SEK Y ++   + GGE
Sbjct: 173 NKKGDEKNGKTSTAEQVLKEIAIHKIVSSGEN--IVSF-IDFQESEKYYYIIQELLAGGE 229

Query: 467 LFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLD------------ 514
           +F  + +   F    SR    +L  A++ +H   I++RD+KPEN+L +            
Sbjct: 230 IFGEIVKYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIKPENLLFEPIDFIPNPKPKL 289

Query: 515 ----------------------YQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELL 552
                                   G + L DFGL K     Q  T T CGT  Y APE++
Sbjct: 290 RSSDDPSTKLDEGVFRPGIGGGGIGVVKLADFGLSKQIY--QTNTKTPCGTVGYTAPEVV 347

Query: 553 LGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRF--P--DDFDKDAK 608
             + Y+  VD W +G +LY +L G PP++DE +  + +KI +    F  P  D     AK
Sbjct: 348 KDERYSMQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKISRGEYTFLRPWWDQISDGAK 407

Query: 609 DLLIGLLCRDPKRRLGYHGSDEIKSHPFFN 638
           + +  LL  DP +R   + S+++   P+ N
Sbjct: 408 NCVRKLLEVDPAKR---YTSEQLLQDPWLN 434

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score =  101 bits (251), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 131/266 (49%), Gaps = 20/266 (7%)

Query: 386  KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVT-----HTLAERTVLARVDNP 440
            ++IGKGSFG V       T ++ A+K +      S+ E T       ++E + L  +D+ 
Sbjct: 1128 EMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHL 1187

Query: 441  FIVPLKFSFQSSEKLY-LVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
             IV     F++   +Y L L ++ GG +   ++  G FD    RF T ++L  L  LH  
Sbjct: 1188 NIVQY-LGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFDEQLIRFLTTQVLEGLAYLHLR 1246

Query: 500  DIIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQEKTTTFCGTPEYLAPELL-LGQGY 557
             I++RD+K +N+LLD  G   + DFG+  K N        T  GT  ++APE++   QGY
Sbjct: 1247 GILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGY 1306

Query: 558  TKVVDWWTLGVLLYEMLTGLPPYYD-EDVPKMYK--KILQDPLRFPDD----FDKDAKDL 610
            +  VD W+LG ++ EM  G  P+ + E V  M++  K    P   P+D      +D +  
Sbjct: 1307 SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPP-IPEDTLPHISQDGRAF 1365

Query: 611  LIGLLCRDPKRRLGYHGSDEIKSHPF 636
            L      DP+ R     +D + SHPF
Sbjct: 1366 LDDCFMIDPEER---PTADTLLSHPF 1388

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 99.4 bits (246), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 112/225 (49%), Gaps = 29/225 (12%)

Query: 386 KVIGKGSFGKVMQVRKRDTN--KIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIV 443
           +++G G+FG V+   K D N  +  A K +  +  V  +  T  + E T+L ++++P I+
Sbjct: 143 RIVGSGTFGHVLVAEKVDHNMKRQVAKKTVSYAVKVINTAKTRMVKEATILEKLNHPNII 202

Query: 444 PLKFSFQSS-EKLYLVLAFINGGELFYHLQREGRF---DLSRSRFYTAELLCALEALHDF 499
            +  S   +   +Y+    I+GG+LF +L +         + S     ++L AL+ LH  
Sbjct: 203 RIHQSCVDALGNVYIFQDLISGGDLFSYLAKGDCLVPISETESLIIIYQILLALKFLHSN 262

Query: 500 DIIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDQEKTTTFCGTPEYLAPELLL-- 553
            I++RDLK +NILL   +    + L DFG+ K L+   +E+  T  GTPEY APE+    
Sbjct: 263 GIVHRDLKLDNILLHTPEPCTKVVLADFGIAKELSQNTKERMHTVVGTPEYCAPEVGFKA 322

Query: 554 -----------------GQGYTKVVDWWTLGVLLYEMLTGLPPYY 581
                              GY    D W+LGV+ + MLTG+ P+Y
Sbjct: 323 DRNIYRSFSRTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPFY 367

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 105/214 (49%), Gaps = 10/214 (4%)

Query: 373 THKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT 432
           TH HL  D  + L V+G+G+ G V + + R  +KI+ALK I  +    +        E  
Sbjct: 228 THVHLK-DQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTI-TTLTTDQESQKQIFRELQ 285

Query: 433 VLARVDNPFIVPLKFSFQSSE--KLYLVLAFINGGEL---FYHLQREGRFDLSRSRFYTA 487
                 + +IV     F   E   +Y+ + ++ G  L   + HL + G     +     A
Sbjct: 286 FNKSCKSDYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKIA 345

Query: 488 E-LLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEY 546
           E +L  L  LH   II+RD+KP+NILL+  G + LCDFG+    +      TTF GT  Y
Sbjct: 346 ESVLRGLSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAVNSL--ATTFTGTSYY 403

Query: 547 LAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580
           +APE + GQ Y+   D W+LG+ L E+     P+
Sbjct: 404 MAPERIQGQPYSVTSDVWSLGLTLLEVAQAHFPF 437

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 135/267 (50%), Gaps = 22/267 (8%)

Query: 386  KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSE-----VTHTLAERTVLARVDNP 440
            ++IGKGSFG V       T ++ A+K +      S++E     V    +E + L  +D+ 
Sbjct: 1179 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHL 1238

Query: 441  FIVPLKFSFQSSEKLY-LVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
             IV     F++   +Y L L ++ GG +   ++  GRFD    +  T ++L  L  LH  
Sbjct: 1239 NIVQY-LGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSK 1297

Query: 500  DIIYRDLKPENILLDYQGHIALCDFGLCKLNMKD--QEKTTTFCGTPEYLAPELL-LGQG 556
             I++RD+K +N+LLD  G   + DFG+ + + KD       T  GT  ++APE++   QG
Sbjct: 1298 GILHRDMKADNLLLDQDGICKISDFGISRKS-KDIYSNSDMTMRGTVFWMAPEMVDTKQG 1356

Query: 557  YTKVVDWWTLGVLLYEMLTGLPPYYD-EDVPKMYK--KILQDPLRFPDD----FDKDAKD 609
            Y+  VD W+LG ++ EM  G  P+ + E V  M+K  K    P   P+D      +  ++
Sbjct: 1357 YSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAP-PIPEDTLPLISQIGRN 1415

Query: 610  LLIGLLCRDPKRRLGYHGSDEIKSHPF 636
             L      +P++R     ++E+ SHPF
Sbjct: 1416 FLDACFEINPEKR---PTANELLSHPF 1439

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 88/318 (27%), Positives = 141/318 (44%), Gaps = 58/318 (18%)

Query: 361 GKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVS 420
           G   L     P    H   ++F +L+ IG+GSFG V +V    T+K+   K I+  ++ S
Sbjct: 6   GIRRLQTSSYPQKLGHSQPNEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEIKYGHMNS 65

Query: 421 KSEVTHTLAERTVLARVDNPFIVPL------------KFSFQSSEKLYLVLAFINGGEL- 467
           K E    +AE T+LA + +  IV                 + + E LYL + + + G+L 
Sbjct: 66  K-ERQQLIAECTILAGLRHENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLS 124

Query: 468 --FYHLQREGRFDLSRSRFYTA-ELLCALEALHD----------FD-------------- 500
               H +   ++   R  +  A +LL AL   H           +D              
Sbjct: 125 QMIKHYKGMRKYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKV 184

Query: 501 --IIYRDLKPENILLDYQG------------HIALCDFGLCKLNMKDQEKTTTFCGTPEY 546
             +I+RDLKP NI L   G             + L DFGL K      E  TT+ GTP Y
Sbjct: 185 TSVIHRDLKPGNIFLTGDGVGGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATTYVGTPYY 244

Query: 547 LAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ-DPLRFPDDFDK 605
           ++PE+L+ Q Y+ + D W+LG ++YE+     P+   +  ++ + I + D    PD + K
Sbjct: 245 MSPEVLMDQPYSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQPLPDYYSK 304

Query: 606 DAKDLLIGLLCRDPKRRL 623
           + + L+I   C +P  +L
Sbjct: 305 ELQQLVIS--CINPNEKL 320

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 106/211 (50%), Gaps = 25/211 (11%)

Query: 383 DLLKVIGKGSFGKVMQVRKRDTNKIYALKAI------RKSYIVSKSEVTHTLAERTVLAR 436
           +L+K IG+G+ G V    +  TN   A+K +      +K  IV++  V        ++  
Sbjct: 700 NLIK-IGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKELIVNEILVMKGSKHNNIVNF 758

Query: 437 VDNPFIVPLKFSFQSSEKLYLVLAFINGGELF----YHLQREGRFDLSRSRFYTAELLCA 492
           +D         S+     L++V+ ++ GG L     + +  EG+         + E L  
Sbjct: 759 ID---------SYLFRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGA-----VSRETLKG 804

Query: 493 LEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELL 552
           L+ LH   +I+RD+K +NILL   G I L DFG C    +   K TT  GTP ++APE++
Sbjct: 805 LQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVV 864

Query: 553 LGQGYTKVVDWWTLGVLLYEMLTGLPPYYDE 583
             + Y   VD W+LG+++ EM+ G PPY +E
Sbjct: 865 SRKEYGPKVDIWSLGIMIIEMIEGEPPYLNE 895

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 97.4 bits (241), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 81/303 (26%), Positives = 140/303 (46%), Gaps = 54/303 (17%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVT-HTLAERTVLARVDNP 440
           F+L+K IG G++G V   R  + ++   +   + + I SK+ +   +L E  +L      
Sbjct: 21  FELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGH 80

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRS---------RFYTAELLC 491
             +   +     + ++     ING  L+  L       + +S         + +T ++LC
Sbjct: 81  KNITCLYDM---DIVFYPDGSINGLYLYEELMECDMHQIIKSGQALTDAHYQSFTYQILC 137

Query: 492 ALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKT----TTFCGTPEYL 547
            L+ +H  D+++RDLKP N+L++    + +CDFGL +   ++ E+     T +  T  Y 
Sbjct: 138 GLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLTEYVATRWYR 197

Query: 548 APELLLG-QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ-------DPLR- 598
           APE++L  QGYTK +D W+ G +L E L G P +  +D      +ILQ       + LR 
Sbjct: 198 APEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLGTPPDETLRR 257

Query: 599 ------------------------FPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSH 634
                                   FP+  ++DA DLL G+L  DP++R+     D+   H
Sbjct: 258 VGSKNVQDYIHQLGYIQKIPFSELFPNA-NEDALDLLEGMLAFDPQKRITV---DKALEH 313

Query: 635 PFF 637
           P+ 
Sbjct: 314 PYL 316

>Kwal_26.7861
          Length = 955

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 104/205 (50%), Gaps = 13/205 (6%)

Query: 383 DLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFI 442
           +L+K IG+G+ G V    +  TN   A+K +       K  +   + E  V+    +  I
Sbjct: 669 NLIK-IGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELI---INEILVMKASKHANI 724

Query: 443 VPLKFSFQSSEKLYLVLAFINGGELF----YHLQREGRFDLSRSRFYTAELLCALEALHD 498
           V    S+     L++V+ ++ GG L     + +  EG+         + E L  L+ LH 
Sbjct: 725 VNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGA-----VSRETLKGLQFLHS 779

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT 558
             +I+RD+K +N+LL   G I L DFG C    +   K TT  GTP ++APE++  + Y 
Sbjct: 780 KGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYG 839

Query: 559 KVVDWWTLGVLLYEMLTGLPPYYDE 583
             VD W+LG+++ EM+ G PPY +E
Sbjct: 840 PKVDIWSLGIMIIEMIEGEPPYLNE 864

>Kwal_26.8703
          Length = 444

 Score = 96.7 bits (239), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 107/205 (52%), Gaps = 9/205 (4%)

Query: 387 VIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPL- 445
           V+G+G+ G V + + +  + ++ALK I  +    +++    L E        + +IV   
Sbjct: 162 VLGEGAGGSVTKCKLKGGSMVFALKTITTANSDPETQ-KQVLRELQFNRSCSSEYIVRYY 220

Query: 446 -KFSFQSSEKLYLVLAFINGGEL---FYHL-QREGRFDLSRSRFYTAELLCALEALHDFD 500
             F+ +S+  +Y+ + ++ G  L   + HL +R GR            +L  L  L +  
Sbjct: 221 GMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQERK 280

Query: 501 IIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKV 560
           II+RD+KP+NILL+  G + LCDFG+  + +      TTF GT  Y+APE + GQ Y+  
Sbjct: 281 IIHRDIKPQNILLNEAGQVKLCDFGVSGVAVNSL--ATTFTGTSFYMAPERIQGQPYSVT 338

Query: 561 VDWWTLGVLLYEMLTGLPPYYDEDV 585
            D W+LG+ L E+  G  P+  +++
Sbjct: 339 SDVWSLGLTLLEVAQGQFPFGSDNM 363

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 98.2 bits (243), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 105/400 (26%), Positives = 177/400 (44%), Gaps = 44/400 (11%)

Query: 265  LNRPIFNKISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQI--SNNDILGDYVKKIR 322
            L++P+  ++       + P  K    ARI SIL    N  E  +   NND   + +K+ +
Sbjct: 1032 LDKPVVEELHN----SKSPVSKTSDKARINSILEQHSNISEKGVKSQNND---NVIKEKK 1084

Query: 323  NNSD----------IHLDSFHLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPS 372
            +N+           I  ++     N      SN +++    +E+  K      +++   S
Sbjct: 1085 SNTSLPRRTRTIRAIAHEAGEARRNSMKVKRSNTKMWGTKIVEITDKN-----TIEINKS 1139

Query: 373  THKHLSIDDFDLLK--VIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAE 430
             +      +F  +K  +IGKGSFG V       T ++ A+K +      +++E+   + E
Sbjct: 1140 KNARGEYKEFAWMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVE 1199

Query: 431  R-----TVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFY 485
                    L  +D+  IV    S        L L ++ GG +   ++  GRFD    R  
Sbjct: 1200 ALKSEVATLKDLDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHL 1259

Query: 486  TAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKT-TTFCGTP 544
              ++L  L+ LH   I++RD+K +N+LLD  G   + DFG+ K +      +  T  GT 
Sbjct: 1260 NTQVLSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSDMTMRGTV 1319

Query: 545  EYLAPELL-LGQGYTKVVDWWTLGVLLYEMLTGLPPYYD-EDVPKMYK--KILQDPLRFP 600
             ++APE++   QGY+  VD W+LG ++ EM  G  P+ + E V  M++  K    P   P
Sbjct: 1320 FWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPP-IP 1378

Query: 601  DD----FDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPF 636
            DD         KD L      DP++R     +D++  H F
Sbjct: 1379 DDTIQLISSKGKDFLSKCFEIDPEKR---PTADDLLEHSF 1415

>Scas_618.15
          Length = 620

 Score = 97.4 bits (241), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 89/348 (25%), Positives = 141/348 (40%), Gaps = 80/348 (22%)

Query: 382 FDLLKVIGKGSFGKVMQVR-----------KRDTNKIYALKAIRK--------------S 416
           + LL  IGKG+F  V +             K   N++ A+K I+K              S
Sbjct: 156 YKLLNKIGKGAFAVVYRAIPDPQNGKSSYFKEVCNEV-AIKIIKKVDLSEDLKDHERDTS 214

Query: 417 YIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGR 476
           ++ S+ +V        V +   +  +  + F  ++    Y+V  +++GGE++  + R   
Sbjct: 215 HVSSREQVLKEACLHKVASSECSEVVGFIDF-VETKSYYYIVQEYLHGGEIYDQIVRLTY 273

Query: 477 FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHI----------------- 519
           F    +R    +L  A++ LH   II+RD+KPEN+L +   HI                 
Sbjct: 274 FSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEPIQHIPSTHVKLRKTDNPFTKV 333

Query: 520 -----------------ALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVD 562
                             L DFGL K      E T T CGT  Y APEL+    Y   +D
Sbjct: 334 DEGMFRPAIGGGGIGAVKLTDFGLSK--QLSTETTNTPCGTISYAAPELIRNHQYDNKID 391

Query: 563 WWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRF--P--DDFDKDAKDLLIGLLCRD 618
            W +G +LY +L G PP+Y +    + +KI      F  P  D+    AK+ +  LL  D
Sbjct: 392 LWGIGCVLYTLLCGFPPFYADQHKSVTRKIRHGEYHFLSPWWDEISSGAKNCVKHLLEVD 451

Query: 619 PKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSN 666
             +R   +  D++ + P+ N  S           P  PP+      +N
Sbjct: 452 VSKR---YNIDDLLADPWLNMNS----------SPVNPPIKSIFSHTN 486

>Scas_707.34
          Length = 905

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 143/312 (45%), Gaps = 67/312 (21%)

Query: 380 DDFDLLKVIGKGSFGKVMQVR------------KRDTNKI-----YALKAIRKSYIVSKS 422
           D + + K IGKGSF  V +                D++ I     +A+K + +S + +K 
Sbjct: 36  DRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLKNKK 95

Query: 423 EVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQRE-------- 474
            + +   E  +L ++ +P IV L    ++S+  YL++ + + G+L + +++         
Sbjct: 96  LLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIKNHP 155

Query: 475 ------GRFDLSRSRF----------YTAELLCALEALHDFDIIYRDLKPENILL----- 513
                  ++     ++          Y  +L  AL+ L   ++++RD+KP+N+LL     
Sbjct: 156 LLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSAPLI 215

Query: 514 DYQGH----------------IALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY 557
           +Y                   + + DFG  +  + +     T CG+P Y+APE+L  Q Y
Sbjct: 216 NYNDPKSFHDLGFVGIYNLPILKIADFGFARF-LPNTSMAETLCGSPLYMAPEILNYQKY 274

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI--LQDPLRFPD--DFDKDAKDLLIG 613
               D W++G +LYEM  G PP+   +  ++YKKI    D + FP   + D + K L+  
Sbjct: 275 NAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFPTYIEIDNNLKSLISK 334

Query: 614 LLCRDPKRRLGY 625
           LL  DP+ R+ +
Sbjct: 335 LLTFDPQERIEF 346

>Kwal_47.17263
          Length = 1127

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 151/331 (45%), Gaps = 64/331 (19%)

Query: 365 LSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAI--------RKS 416
           +S++Y P + + + ++ ++++  +G+G  GKV   R   T ++ A+K +        R S
Sbjct: 89  ISLEYDPISKRKV-LNTYEIIGELGQGQHGKVKLARDLVTKQLVAIKIVDRNGGKSNRFS 147

Query: 417 YIVSKSEVTHTLAERTVLARVDNPFIVPLK--FSFQSSEKLYLVLAFINGGELFY----H 470
           +  + +       E  ++ +  +  +V L       +S K+YLVL + + GE+ +     
Sbjct: 148 FKKNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGDQ 207

Query: 471 LQREGR----FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGL 526
           L+ E R        R+R     ++  LE LH   II+RD+KP N+L+   G + + DFG+
Sbjct: 208 LETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFGV 267

Query: 527 CKLNMK--------DQEKTTTFCGTPEYLAPELLLGQGYTKV-----------------V 561
                K        D+ +     GTP + APE+ LG   ++                  +
Sbjct: 268 SFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIISYNI 327

Query: 562 DWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFP----------------DDFDK 605
           D W +GV L+ +L G+ P++ E   +++ KI+   L                   ++++ 
Sbjct: 328 DIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISKISNQEEYEA 387

Query: 606 DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPF 636
            AKDLL  LL ++P +R+      EIK HPF
Sbjct: 388 -AKDLLGRLLTKNPFKRIKIA---EIKKHPF 414

>Scas_713.21
          Length = 641

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 169/382 (44%), Gaps = 77/382 (20%)

Query: 298 LPSQNWQETQISN-------NDILGDYVKKIRNNSDIHLDSFHLPLNLKIDSASNIRLYN 350
           +P+ N Q   IS        + ++ DY  KI+N     +     P+   + S +N  L +
Sbjct: 253 MPTANEQAKLISKKLVSERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQSVPSQAN--LMS 310

Query: 351 HHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYAL 410
             W                       ++ ++  +++++GKG   KV +V+ R T K YAL
Sbjct: 311 KQW---------------------SRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYAL 348

Query: 411 KAIRKSYIVSKSEVTHTLAERTV--LARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELF 468
           K I    +    E   T  ER +  L R+     V     ++  +++  VL      +L 
Sbjct: 349 KQI---LLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLS 405

Query: 469 YHL-QREGR-FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGL 526
           + L +R  R FD++  R  + E++  ++A+HD DI++ DLKP N +   +G + L DFG+
Sbjct: 406 HVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGI 464

Query: 527 CK------LNMKDQEKTTTFCGTPEYLAPELLLGQGYT-----------KVVDWWTLGVL 569
                   LN+       T  GTP Y+APE L+ Q Y+           K  D W+ G +
Sbjct: 465 ANKIADNTLNV----YRNTQMGTPNYMAPETLISQNYSNNNNNLLWKIGKPSDIWSYGCI 520

Query: 570 LYEMLTGLPPY-----YDEDVPKMYKKILQDPLRFPDD--FDKDAKDLLIGLL--C--RD 618
           LY+M  G PPY     +D  +  M   I  D   +P++    K     L+ L+  C  RD
Sbjct: 521 LYQMTYGHPPYSSFLGHDRLLAIMNPNIQID---YPNESPCGKKVPQSLVALIKTCLNRD 577

Query: 619 PKRRLGYHGSDEIKSHPFFNQL 640
           P+ R     +DEI+   FFN +
Sbjct: 578 PQLRA---TTDEIQHCSFFNPM 596

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 138/324 (42%), Gaps = 72/324 (22%)

Query: 382 FDLLKVIGKGSFGKVMQ-VRKRDTNKIY--------ALKAIRKSYIVSKSEVT------- 425
           + LL  IG+G+F +V + V  +D    Y        A+K I K  + + +  T       
Sbjct: 91  YKLLGKIGEGAFSEVYRAVPLKDGPNAYLSSRYKQVAVKVISKKRLSTTASTTGRRRDKR 150

Query: 426 ------------HTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLA-FINGGELFYHLQ 472
                         L E T+   V +   +     FQ +E  Y ++   + GGE+F  + 
Sbjct: 151 EEAGENKATSREQVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIV 210

Query: 473 REGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENIL---LDY-------------- 515
           R   F    SR    +L  A++ +H   I++RD+KPEN+L   +D+              
Sbjct: 211 RLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPIDFIPSKRQQLRQSDDP 270

Query: 516 -----------------QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT 558
                             G I L DFGL K        TTT CGT  Y APE++  + Y+
Sbjct: 271 KTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYATN--TTTPCGTVGYTAPEVVKDERYS 328

Query: 559 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRF--P--DDFDKDAKDLLIGL 614
             VD W +G +LY +L G PP+YDE +  + + I +    F  P  D+    AK+ +  L
Sbjct: 329 MKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAVRRL 388

Query: 615 LCRDPKRRLGYHGSDEIKSHPFFN 638
           L  DP +R   +  DE  + P+ N
Sbjct: 389 LEVDPDKR---YDIDEFLADPWLN 409

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 115/213 (53%), Gaps = 13/213 (6%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVR-KRDTNKIYALKAIR----KSYIVSKSEVTHTLAERTV 433
           I D  L   +G+G+F  V     + D + I A+K I     K   +S  ++T  +  ++ 
Sbjct: 12  IKDVVLGDTVGQGAFACVKNAHLQMDPSIILAVKFIHVPTCKKMGLSDKDITKEVVLQSK 71

Query: 434 LARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCAL 493
            ++  +P ++ L     S E ++++L   +GG+LF  ++ +   D   ++FY  +L+ A+
Sbjct: 72  CSK--HPNVLRLIDCNVSKEYMWIILEMADGGDLFDKIEPDVGVDSDVAQFYFQQLVSAI 129

Query: 494 EALH-DFDIIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQEKTTTF--CGTPEYLAP 549
             LH +  + +RD+KPENILLD  G++ L DFGL  +   KD     +    G+P Y+AP
Sbjct: 130 NYLHVECGVAHRDIKPENILLDKNGNLKLADFGLASQFRRKDGTLRVSMDQRGSPPYMAP 189

Query: 550 ELLLGQG--YTKVVDWWTLGVLLYEMLTGLPPY 580
           E+L  +   Y    D W++G+LL+ +LTG  P+
Sbjct: 190 EVLYSEEGYYADRTDIWSIGILLFVLLTGQTPW 222

>Scas_720.94
          Length = 1683

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 121/268 (45%), Gaps = 33/268 (12%)

Query: 388  IGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER-TVLARVDNPFIVPLK 446
            IG G+FG V      D  +I A+K I+     +  ++   + E  TVL  +++P IV   
Sbjct: 1367 IGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNHPNIVQYY 1426

Query: 447  FSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDL 506
                  +K+ + + +  GG +   L+     D   ++ YT ELL  L  LH   +++RD+
Sbjct: 1427 GVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDI 1486

Query: 507  KPENILLDYQGHIALCDFGLCKLNMKDQEKTTT-------------------------FC 541
            KPENILLD+ G I   DFG  +   K+  K T                            
Sbjct: 1487 KPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHDML 1546

Query: 542  GTPEYLAPELLLG-QGYTKVV--DWWTLGVLLYEMLTGLPPY--YDEDVPKMYKKIL-QD 595
            GTP Y+APE + G +  TK    D W+ G ++ EM+TG  P+   D +   +Y     Q 
Sbjct: 1547 GTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANLDNEWAIIYHVAAGQT 1606

Query: 596  P-LRFPDDFDKDAKDLLIGLLCRDPKRR 622
            P L +P++     +  L   L +DP +R
Sbjct: 1607 PQLPYPNEVSPAGRRFLQRCLVQDPIKR 1634

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 100/200 (50%), Gaps = 12/200 (6%)

Query: 388 IGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKF 447
           IG+G+ G V    +  TN   A+K +       K  +   + E  V+    +  IV    
Sbjct: 689 IGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKELI---INEILVMKGSRHNNIVNFID 745

Query: 448 SFQSSEKLYLVLAFINGGELF----YHLQREGRFDLSRSRFYTAELLCALEALHDFDIIY 503
           S+     L++++ ++ GG L     + +  EG+         + E L  L  LH   +I+
Sbjct: 746 SYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIAA-----VSRETLRGLHFLHSKGVIH 800

Query: 504 RDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDW 563
           RD+K +NILL   G+I L DFG C    +   K TT  GTP ++APE++  + Y   VD 
Sbjct: 801 RDIKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEYGPKVDI 860

Query: 564 WTLGVLLYEMLTGLPPYYDE 583
           W+LG+++ EM+ G PPY +E
Sbjct: 861 WSLGIMIIEMIEGEPPYLNE 880

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/261 (29%), Positives = 118/261 (45%), Gaps = 28/261 (10%)

Query: 388  IGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER-TVLARVDNPFIVPLK 446
            IG G+FG+V      +  +I A+K I+     +  ++   + E  TVL  +++P IV   
Sbjct: 1040 IGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYY 1099

Query: 447  FSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDL 506
                  +K+ + + +  GG L   L      D   ++ YT ELL  L  LH   +++RD+
Sbjct: 1100 GVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDI 1159

Query: 507  KPENILLDYQGHIALCDFGLCKLNMKDQEKTT----------------TFCGTPEYLAPE 550
            KPENILLD+ G I   DFG  +  +  + +T                    GTP Y+APE
Sbjct: 1160 KPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPE 1219

Query: 551  LLLG---QGYTKVVDWWTLGVLLYEMLTGLPPY--YDEDVPKMYK----KILQDPLRFPD 601
             + G   +G     D W LG ++ EM TG  P+   D +   MY     +I Q P R  D
Sbjct: 1220 TISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNR--D 1277

Query: 602  DFDKDAKDLLIGLLCRDPKRR 622
            +     +  L   L +DP  R
Sbjct: 1278 EMTAAGRAFLERCLVQDPTMR 1298

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score = 94.4 bits (233), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 92/337 (27%), Positives = 149/337 (44%), Gaps = 73/337 (21%)

Query: 385 LKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 439
           L  +G G+FG V       TN+  A+K I K +       T  LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPF------ATAVLAKRTYRELKLLKHLRH 79

Query: 440 PFIVPLKFSFQSS-EKLYLVLAFINGGELFYHLQR---EGRFDLSRSRFYTAELLCALEA 495
             ++ L+  F S  E +Y V   + G +L   LQ    E +F     +++  ++L  L+ 
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFHYQILRGLKY 134

Query: 496 LHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG- 554
           +H   +++RDLKP NIL++    + +CDFGL ++      + T +  T  Y APE++L  
Sbjct: 135 VHSAGVVHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTW 191

Query: 555 QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--------------------- 593
           Q Y   VD W+ G +  EM+ G P +  +D    +  I                      
Sbjct: 192 QKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTLK 251

Query: 594 -------QDPLRFPDDF---DKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
                  +DP+ F + F   + DA DLL  +L  DPK+R+    +D + +HP        
Sbjct: 252 FVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRIT--AADAL-AHP-------- 300

Query: 644 RLKMKGYIPPYKPPVMGAMDTSNFDQEFT-REQPVDS 679
                 Y+ PY  P    +  + FD  F   + PVD+
Sbjct: 301 ------YLAPYHDPTDEPVAEAKFDWHFNDADLPVDT 331

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 115/214 (53%), Gaps = 16/214 (7%)

Query: 379 IDDFDLLKVIGKGSFGKVMQVR-KRDTNKIYALKAIR----KSYIVSKSEVTHTLAERTV 433
           ID   L + IGKGSF  V +   + D + + A+K I     +   +S+ +V   L E  +
Sbjct: 12  IDGLQLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDV---LREVKL 68

Query: 434 LARVDNPFIVPLKF--SFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLC 491
            +R  N F+  LK      S   L++ +    GG+LF  ++ +   D   ++FY  +L+ 
Sbjct: 69  HSRCSN-FVNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIK 127

Query: 492 ALEALHD-FDIIYRDLKPENILLDYQGHIALCDFGLCKL-NMKDQEKTTTF--CGTPEYL 547
           A+  LHD   + +RD+KPENILLD  G++ L DFGL  L   KD  K  +    G+  Y+
Sbjct: 128 AISYLHDTCGVAHRDIKPENILLDKDGNLKLADFGLASLFKRKDGSKRISRDQRGSLPYM 187

Query: 548 APELLLGQG-YTKVVDWWTLGVLLYEMLTGLPPY 580
           APE++   G Y  + D W++GVLL+ +LTG  P+
Sbjct: 188 APEIIYCDGYYADMTDIWSIGVLLFVLLTGETPW 221

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 105/214 (49%), Gaps = 11/214 (5%)

Query: 374 HKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTV 433
           H    + + +   V+G+G+ G V + + R   K++ALK I  + +    E    L     
Sbjct: 172 HSKNLLAEIETQGVLGEGAGGSVAKCKLRTGKKVFALKTI--NILNGDPEFQKQLLRELQ 229

Query: 434 LAR-VDNPFIVPL--KFSFQSSEKLYLVLAFINGG--ELFYH--LQREGRFDLSRSRFYT 486
             +   + +IV     F+ + +  +Y+ + ++ G   E  Y   L R GR         +
Sbjct: 230 FNKSFKSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKIS 289

Query: 487 AELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEY 546
             +L  L  LH+  +I+RD+KP+NILL+  G + LCDFG+    +      TTF GT  Y
Sbjct: 290 EAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGEAVNSL--ATTFTGTSYY 347

Query: 547 LAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580
           +APE + GQ Y+   D W+LG+ + E+  G  P+
Sbjct: 348 MAPERIQGQPYSVTCDVWSLGLTILEVAQGHFPF 381

>Kwal_56.23841
          Length = 432

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 93/337 (27%), Positives = 148/337 (43%), Gaps = 73/337 (21%)

Query: 385 LKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 439
           L  +G G+FG V       TN+  A+K I K +       T  LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 440 PFIVPLKFSFQSS-EKLYLVLAFINGGELFYHLQR---EGRFDLSRSRFYTAELLCALEA 495
             ++ L+  F S  E +Y V   + G +L   LQ    E +F     +++  ++L  L+ 
Sbjct: 80  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 134

Query: 496 LHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG- 554
           +H   +I+RDLKP NIL++    + +CDFGL ++      + T +  T  Y APE++L  
Sbjct: 135 VHSAGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTW 191

Query: 555 QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--------------------- 593
           Q Y   VD W+ G +  EM+ G P +  +D    +  I                      
Sbjct: 192 QKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTLK 251

Query: 594 -------QDPLRFPDDF---DKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
                  +DP+ F + F   + DA DLL  +L  DP +R+    +D + SHP        
Sbjct: 252 FVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRIT--AADAL-SHP-------- 300

Query: 644 RLKMKGYIPPYKPPVMGAMDTSNFDQEFT-REQPVDS 679
                 Y+ PY  P    +  + FD  F   + PVD+
Sbjct: 301 ------YLAPYHDPTDEPVADAKFDWHFNDADLPVDT 331

>Kwal_55.20326
          Length = 750

 Score = 94.7 bits (234), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 111/229 (48%), Gaps = 10/229 (4%)

Query: 401 KRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLA 460
           K+  N+     A++ S  V +  V     E  +L  + +  IV    S Q    L + L 
Sbjct: 508 KKQYNQNANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYGSSQEGGNLNIFLE 567

Query: 461 FINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIA 520
           ++ GG +   L   G F+    R +T ++L  L  LH  DII+RD+K  NIL+D +G + 
Sbjct: 568 YVPGGSVSSMLNSYGPFEEPLIRNFTRQILIGLSYLHRKDIIHRDIKGANILIDIKGCVK 627

Query: 521 LCDFGLCK----LNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTG 576
           + DFG+ K    LN + Q K  +  G+  ++APE++     TK  D W++G ++ EM TG
Sbjct: 628 ITDFGISKKLSPLNQQ-QNKRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTG 686

Query: 577 LPPYYDEDVPKMYKKILQDPLRFPDD---FDKDAKDLLIGLLCRDPKRR 622
             P+ D    +   KI  +   FPD       +AKD L+     D ++R
Sbjct: 687 KHPFPDFSQMQAIFKIGTNT--FPDSPSWSSNEAKDFLLKTFELDYRKR 733

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 95.1 bits (235), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 125/267 (46%), Gaps = 22/267 (8%)

Query: 386  KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAER-----TVLARVDNP 440
            ++IGKGSFG V       T ++ A+K +      S+ E   ++ E      + L  +++ 
Sbjct: 1042 EIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNHV 1101

Query: 441  FIVPLKFSFQSSEKLY-LVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDF 499
             IV     F+    +Y L L ++ GG +   ++  GRFD    R  T ++L  L  LH  
Sbjct: 1102 NIVQY-LGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRFDDQLIRHLTKQVLEGLAYLHSK 1160

Query: 500  DIIYRDLKPENILLDYQGHIALCDFGLC-KLNMKDQEKTTTFCGTPEYLAPELL-LGQGY 557
             I++RD+K +N+LLD  G   + DFG+  K N        T  GT  ++APE++    GY
Sbjct: 1161 GILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSDMTMRGTVFWMAPEMVDTAHGY 1220

Query: 558  TKVVDWWTLGVLLYEMLTGLPPYYD-EDVPKMY---KKILQDPLRFPDD----FDKDAKD 609
            +  VD W+LG ++ EM  G  P+ + E V  M+   K     P+  PDD         + 
Sbjct: 1221 SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPPI--PDDTKDLVSPAGQS 1278

Query: 610  LLIGLLCRDPKRRLGYHGSDEIKSHPF 636
             L      DP+ R     +D +  HPF
Sbjct: 1279 FLDQCFEIDPEMR---PTADSLVGHPF 1302

>CAGL0I04422g 394159..395427 some similarities with sp|P22209
           Saccharomyces cerevisiae YAR018c KIN3 ser/thr protein
           kinase, hypothetical start
          Length = 422

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 130/283 (45%), Gaps = 67/283 (23%)

Query: 375 KHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVL 434
           +H +  D+ ++K IG+GSFG V +V    T ++   K I+  ++ SK E    +AE T+L
Sbjct: 7   QHYARSDYQVVKEIGRGSFGSVHKVIHVPTQQVLVRKDIKYGHMNSK-ERQQLIAECTIL 65

Query: 435 ARVDNPFIVPLKFSF---QSSEKLYLVLAFINGGEL---FYHLQREGRFDLSRSRF-YTA 487
           +++ +  IV   +S+   +  E LYL + + + G+L     H ++E ++   +  +   A
Sbjct: 66  SQLKHENIVEF-YSWDFNEQQEVLYLYMEYCSRGDLSGMIKHYKQEHKYIPEKVVWGILA 124

Query: 488 ELLCALEALHDFD---------------------IIYRDLKPENILLDY----------- 515
           ++L AL   H  +                     +I+RDLKP NI L Y           
Sbjct: 125 QMLTALYKCHYGEELPSLTTIYDRMKPPSKGRNIVIHRDLKPGNIFLSYDDNSSDSTDKA 184

Query: 516 --------------------------QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAP 549
                                     Q  + + DFGL K      +  TT+ GTP Y++P
Sbjct: 185 DIAQSNWYRKPNNRGGDESKLTTDYSQVVVKVGDFGLAKSLATSVDFATTYVGTPYYMSP 244

Query: 550 ELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 592
           E+L+ Q Y+ + D W+LG ++YEM +  PP+  ++  ++  KI
Sbjct: 245 EVLMDQPYSPLSDIWSLGCVIYEMCSLHPPFLAKNYLELQTKI 287

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 91/367 (24%), Positives = 156/367 (42%), Gaps = 87/367 (23%)

Query: 365 LSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRK--------- 415
           +S++Y P + + + ++ +++++ +G G  GKV       T +  A+K + +         
Sbjct: 91  ISLEYDPISKRKV-LNTYEIIRELGSGQHGKVKLALDLVTKQHVAIKIVDRHGKKKSSWK 149

Query: 416 -SYIVSKSEVTHTLAERTVLARVDNPFIVPL--KFSFQSSEKLYLVLAFINGGELFY--- 469
                 + E      E  ++ + D+  +V L        S K+YLVL + + GE+ +   
Sbjct: 150 LKKTPVREESEKIRREIAIMKKCDHEHVVKLIEVLDDMKSRKIYLVLEYCSKGEVKWCPG 209

Query: 470 -HLQREGR----FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDF 524
             L+   R        R+R     ++  LE LH   II+RD+KP N+LL     + + DF
Sbjct: 210 DQLEAAARGPPLLTFQRTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSEHDIVKISDF 269

Query: 525 GLCKLNMK-----------------------DQEKTTTFCGTPEYLAPELLLGQ-GYTK- 559
           G+   +                         D  +     GTP + APE+ LG   Y K 
Sbjct: 270 GVSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKL 329

Query: 560 ----------------VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPD-D 602
                           ++D W LGV LY +L G  P+  E   ++++KI+ DPL FP  +
Sbjct: 330 NIDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRLE 389

Query: 603 FDK--------------DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPF-------FNQLS 641
           F +               A+DLL  LL ++P +R+      +IK+HPF        + LS
Sbjct: 390 FMQSNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIV---DIKAHPFVCWDFDHVDGLS 446

Query: 642 WKRLKMK 648
            +R+ M+
Sbjct: 447 GQRISMR 453

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/313 (26%), Positives = 138/313 (44%), Gaps = 40/313 (12%)

Query: 361 GKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVS 420
           G  +L V     TH H     +  +  +G+G++GKV + R   TNK+ ALK +R      
Sbjct: 101 GPASLRVPATIITHTHSVESSYQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLETERD 160

Query: 421 KSEVTHTLAERTVLARVDNPFIVPL-KFSFQSSEKLYLVLAFINGGELFYHLQREGRFDL 479
              +T ++ E  +L    +  +  + +   ++ + +Y++  + +       + +E  F  
Sbjct: 161 GFPIT-SIREIKLLQHCQHENVSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFSD 219

Query: 480 SRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTT 539
           +  +    +LL  +E LH+  I++RD+K  NIL+D +G++ + DFGL +  MK +   T 
Sbjct: 220 ANCKHLFRQLLKGMEYLHECRILHRDIKGSNILIDNRGNLKITDFGLAR-KMKQEPDYTN 278

Query: 540 FCGTPEYLAPELLLGQG-YTKVVDWWTLGVLLYEM---------------------LTGL 577
              T  Y  PELLLG   Y   VD W  G LL E+                     + G 
Sbjct: 279 RVITLWYRPPELLLGTTRYGTEVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQVLGT 338

Query: 578 PPYYDE----DVPKMYKKILQDPLRFPDDFD---------KDAKDLLIGLLCRDPKRRLG 624
           P         D+P  +  I Q    +P  FD         +  +DL  GLL  D K+R  
Sbjct: 339 PTIEQWPGLFDMPWWFMMIPQQKENYPSRFDEKVSGVLPTQSCRDLARGLLLYDQKKR-- 396

Query: 625 YHGSDEIKSHPFF 637
           +  S+ +KS  F+
Sbjct: 397 FSASEALKSAYFY 409

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 121/260 (46%), Gaps = 29/260 (11%)

Query: 369 YKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAI-----RKSYIVS-KS 422
           Y P T + + +++F++L  +G G +GKV   R   T  + A+K +     R  Y +  K 
Sbjct: 38  YNPLTKRQI-LNNFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKV 96

Query: 423 EVTHTLAERTVLARVDNPFIVPLK--FSFQSSEKLYLVLAFINGGELFYHLQREGR---- 476
           E      E  V+ R  +  +V L    +   S K+YLVL + + G + +  + +      
Sbjct: 97  ENPRVNQEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAV 156

Query: 477 ----FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLC----- 527
                   +SR    +++  LE LH   I +RD+KP N+L+   G + + DFG+      
Sbjct: 157 GPSILTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTAT 216

Query: 528 -KLNMK---DQEKTTTFCGTPEYLAPELLLGQ---GYTKVVDWWTLGVLLYEMLTGLPPY 580
              N++   +Q   +   GTP + APEL   +     +  +D W+LGV +Y +L G  P+
Sbjct: 217 GSTNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPF 276

Query: 581 YDEDVPKMYKKILQDPLRFP 600
                 +++  I+  PL FP
Sbjct: 277 NANSGLELFDSIINKPLEFP 296

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 154/342 (45%), Gaps = 72/342 (21%)

Query: 365 LSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAI-------RKSY 417
           +S+ Y P + + + ++ ++++K +G G  GKV   R   + ++ A+K +       RK +
Sbjct: 117 ISLTYDPVSKRKV-LNTYEIIKELGHGQHGKVKLARDILSKQLVAIKIVDRHEKKQRKFF 175

Query: 418 IVSKS----EVTHTLAERTVLARVDNPFIVPLKFSFQ--SSEKLYLVLAFINGGELFYH- 470
              KS    E      E  ++ +  +  +V L        S K+YLVL + + GE+ +  
Sbjct: 176 TFIKSSKISENDKIKREIAIMKKCHHKHVVQLIEVLDDLKSRKIYLVLEYCSRGEVKWCP 235

Query: 471 ---LQREGR----FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCD 523
              ++ + +         +R     ++  LE LH   II+RD+KP N+L+   G + + D
Sbjct: 236 PDCMESDAKGPSLLSFQETREILRGVVLGLEYLHYQGIIHRDIKPANLLISGDGTVKISD 295

Query: 524 FGLC----------KLNMKDQEKTTTFCGTPEYLAPELLLGQ-GYTK------------- 559
           FG+                D+ +     GTP + APE+ LG+  +T+             
Sbjct: 296 FGVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSC 355

Query: 560 ---VVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLC 616
              ++D W +GV LY +L G+ P++ +   K+++KI+ DPL+FP  F +   + +  + C
Sbjct: 356 ISFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFP-TFKEIQSNKVSKVSC 414

Query: 617 RD----------------PKRRLGYHGSDEIKSHPFFNQLSW 642
            +                P++R+       IK HPF   +SW
Sbjct: 415 EEEYEMAKDLLLKLLEKNPQKRMTIPA---IKKHPF---VSW 450

>Kwal_55.22001
          Length = 363

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 132/304 (43%), Gaps = 53/304 (17%)

Query: 386 KVIGKGSFGKVMQV-RKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 444
           K IG G+FG V+Q     D NK Y   AI+K      ++  +   E  +L   D+P +V 
Sbjct: 30  KKIGHGAFGTVVQAFLTPDNNKWYGPFAIKKV----PAQTEYKSRELEILRIADHPNVVK 85

Query: 445 LKFSFQSSE----KLYLVLAF-----INGGELFYHLQREGRFDLSRSRFYTAELLCALEA 495
           L++ F  +     KLY  LA          E+  +   +    L  ++ YT ++   +  
Sbjct: 86  LEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPLKHTKLYTYQIARGMLY 145

Query: 496 LHDFDIIYRDLKPENILLDYQ-GHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG 554
           LH   I +RD+KP N+L+D   G + +CDFG  K   ++Q   +  C    Y APEL++G
Sbjct: 146 LHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQNQPSISYICSR-FYRAPELIVG 204

Query: 555 -QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDV-----------------------PKMYK 590
              YT  +D W LG ++ EML G   +  ++                        P    
Sbjct: 205 CTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLGPPDKKFLFFSNPSYDG 264

Query: 591 KILQDPL-------RFPDDFDK---DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQL 640
            +   PL       RF   F +   +  DLL+ +L  +P+RRL       I +HPFF  L
Sbjct: 265 PLFSKPLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEPERRL---SPRRILAHPFFEDL 321

Query: 641 SWKR 644
             +R
Sbjct: 322 KKER 325

>Scas_640.16
          Length = 505

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 125/285 (43%), Gaps = 24/285 (8%)

Query: 385 LKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 444
           L V+G+G+ G V + + +   K++ALK +  +             E        + +IV 
Sbjct: 213 LGVLGEGAGGSVEKCKLKHGKKVFALKIVN-TLNTDPEFQKQIFRELQFNKSFKSDYIVR 271

Query: 445 LKFSFQ--SSEKLYLVLAFINGG--ELFYH--LQREGRFDLSRSRFYTAELLCALEALHD 498
               F   +S  +Y+ + ++ G   E  Y   L R GR         +  +L  L  LH+
Sbjct: 272 YYGMFNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLHE 331

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT 558
             +I+RD+KP+NIL + +G + LCDFG+    +      TTF GT  Y+APE + GQ Y+
Sbjct: 332 QKVIHRDIKPQNILFNEKGQVKLCDFGVSGEAVNSL--ATTFTGTSFYMAPERIQGQPYS 389

Query: 559 KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI------------LQDPLRFPDDFDKD 606
              D W+LG+ + E+  G  P+  + +      I            L+D       + K 
Sbjct: 390 VTCDIWSLGLTILEVAQGRFPFGSDKITATIAPIELLVLILTFNPELKDEPELNITWSKA 449

Query: 607 AKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLKMKGYI 651
            K  +   L +DP  R       ++  HP+      K++ M+ +I
Sbjct: 450 FKSFIHFCLKKDPHER---PSPRQMIDHPWIQGQMKKKVNMENFI 491

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 122/242 (50%), Gaps = 43/242 (17%)

Query: 378 SIDDFDLLK-VIGKGSFGKVM-----------QVRKRDTNKIYALKAIRKSYIVSKSEVT 425
           ++D++++   V+G G+FG V+           +  ++ T K YA+K +       K +++
Sbjct: 148 NVDNWNISNIVVGNGTFGYVLIAYMGIGAHSGKSSQKITPKCYAVKIV-------KMKLS 200

Query: 426 HTLAERTVLARVDNPFIVPL-KFSFQSSEKLYLVLAFINGGELFYHLQR-EGRFDLSRSR 483
               E  +L ++++P I+ + K     S  LY+    I GG+LF +L + +    +S++ 
Sbjct: 201 KLDKEAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYLAKGDCLMPISQTE 260

Query: 484 --FYTAELLCALEALHDFDIIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDQEKTT 538
              +  ++L AL+ LH   I++RDLK +NILL   +    I L DFG+ +     + +  
Sbjct: 261 ALVFVYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFGIARTVTTMKSRMF 320

Query: 539 TFCGTPEYLAPEL-----------------LLGQGYTKVVDWWTLGVLLYEMLTGLPPYY 581
           T  GTPEY APE+                 L  QGY    D W+LGV+ + MLTG+ P+Y
Sbjct: 321 TVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSKCDLWSLGVITHIMLTGISPFY 380

Query: 582 DE 583
            +
Sbjct: 381 GD 382

>Scas_713.38
          Length = 432

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 92/337 (27%), Positives = 147/337 (43%), Gaps = 73/337 (21%)

Query: 385 LKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 439
           L  +G G+FG V       T++  A+K I K +       T  LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 79

Query: 440 PFIVPLKFSFQSS-EKLYLVLAFINGGELFYHLQR---EGRFDLSRSRFYTAELLCALEA 495
             ++ L+  F S  E +Y V   + G +L   LQ    E +F     +++  ++L  L+ 
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 134

Query: 496 LHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG- 554
           +H   +I+RDLKP NIL++    + +CDFGL ++      + T +  T  Y APE++L  
Sbjct: 135 VHSVGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTW 191

Query: 555 QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL--------------------- 593
           Q Y   VD W+ G +  EM+ G P +  +D    +  I                      
Sbjct: 192 QKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTLK 251

Query: 594 -------QDPLRFPDDF---DKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWK 643
                  +DP+ F + F   + DA DLL  +L  DPK+R+    + E  +HP        
Sbjct: 252 FVTSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRV---TAAEALAHP-------- 300

Query: 644 RLKMKGYIPPYKPPVMGAMDTSNFDQEFT-REQPVDS 679
                 Y+ PY  P    +    FD  F   + PVD+
Sbjct: 301 ------YLAPYHDPTDEPVADCKFDWHFNDADLPVDT 331

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 112/228 (49%), Gaps = 40/228 (17%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSE-VTHTLAERTVLARVDNP 440
           + L+ ++G+G++G V     + TN   A+K I+     S+S  VT TL E  +L      
Sbjct: 13  YQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKIQP---FSRSMFVTRTLRELKLL------ 63

Query: 441 FIVPLKFSFQSSEKLYLVLAFI-----NGGELFYHLQREGRFDLSRS-----------RF 484
                KF F S E +  VL  +     +  E  Y +Q     DL +            ++
Sbjct: 64  -----KF-FHSHENIISVLDIVRPTSWHKFEAVYLVQELMETDLQKIINQQNLSEDHIQY 117

Query: 485 YTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQEK------T 537
           +  ++L AL++LH   +I+RDLKP N+LL+    + +CDFGL + L   DQ +       
Sbjct: 118 FVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFM 177

Query: 538 TTFCGTPEYLAPELLLG-QGYTKVVDWWTLGVLLYEMLTGLPPYYDED 584
           T +  T  Y APE++L  Q YT  +D W+ G +L EM+ G P +  +D
Sbjct: 178 TEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKPLFPGKD 225

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 115/238 (48%), Gaps = 41/238 (17%)

Query: 386 KVIGKGSFGKVMQVRKRDTNKI-----YALKAIR---------KSYIVSKSEVT--HTLA 429
           +V+G G+FG+V+   ++  +       YA+K IR          S +V  + V+   T  
Sbjct: 147 QVVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKREALAKEASILVRLNHVSGIETTG 206

Query: 430 ERTVLARVDNPFIVPLKFSF-QSSEKLYLVLAFINGGELFYHLQRE---GRFDLSRSRFY 485
           E  VL R   P ++ +  +F   ++ +Y+    + GG+LF +L ++        + +   
Sbjct: 207 EEHVLTR-GQPNVIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCLAPISETEALVI 265

Query: 486 TAELLCALEALHDFDIIYRDLKPENILL---DYQGHIALCDFGLCKLNMKDQEKTTTFCG 542
             ++L AL+ LH   I++RDLK +NILL   +    I L DFG+ K     + +  T  G
Sbjct: 266 VYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPSTRVRMHTIVG 325

Query: 543 TPEYLAPEL-----------------LLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDE 583
           TPEY APE+                 +  QGY    D W+LGV+ + MLTG+ P+Y +
Sbjct: 326 TPEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGD 383

>Scas_633.29
          Length = 789

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 132/292 (45%), Gaps = 46/292 (15%)

Query: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440
           +++ ++++G+G   +V +V K   NK++ALK +        S V     E  +L ++ N 
Sbjct: 299 EYEKIELLGRGGSSRVYKV-KNSQNKVFALKRVSFDEF-DDSSVDGFKGEIELLEKLSNE 356

Query: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGR--FDLSRSRFYTAELLCALEALHD 498
             V   F +Q    +  ++      +L   L +      D+   R++  E++  ++ +HD
Sbjct: 357 SRVVKLFDYQMDSGVLFLIMECGDHDLSQILSQRSDMPLDMDFVRYHAREVVRCIKIVHD 416

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCK------LNMKDQEKTTTFCGTPEYLAPELL 552
             I++ DLKP N +   +G + + DFG+        +N+  + +     GTP Y+APE L
Sbjct: 417 AGIVHSDLKPANFVF-VKGILKIIDFGIANAIPDHTVNIYRENQ----IGTPNYMAPEAL 471

Query: 553 LGQGYT------------KVVDWWTLGVLLYEMLTGLPPY------------YDEDVPKM 588
           +   YT            K  D W+ G ++Y+M+ G PPY             + DV  +
Sbjct: 472 VAMNYTNENDGGNKWKVGKPSDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVI 531

Query: 589 YKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQL 640
           + +   +    P    +   DL+ G L RDP++R      D++   PFFN +
Sbjct: 532 FSEKTANNESIP----RSLIDLMKGCLTRDPEKRWSV---DQVLESPFFNPI 576

>Scas_619.5*
          Length = 510

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 144/297 (48%), Gaps = 55/297 (18%)

Query: 386 KVIGKGSFGKVMQVRKRD--------TNKIYALKAIR-KSYIVSKSEVTHTLAERTVLAR 436
           ++IG G+FG V+   K+         +   +A+K I+ + Y V K        E  +L +
Sbjct: 172 RIIGNGTFGNVLVAFKKSEIVASDVYSRPNFAVKVIKLRKYKVDK--------EAKILLK 223

Query: 437 VDNPFIVPLKFSFQS--SEKLYLVLAFINGGELFYHLQR-EGRFDLSRSR--FYTAELLC 491
           +++  I+ + ++F    +  LY+    I GG+LF +L + E    +S +       ++L 
Sbjct: 224 LNHANIIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILK 283

Query: 492 ALEALHDFDIIYRDLKPENILL---DYQGHIALCDFGLCK-LNMKDQEKTTTFCGTPEYL 547
           AL  +H   I++RDLK +NILL   +    I L DFG+ K L++K+  +  T  GTPEY 
Sbjct: 284 ALHYIHGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDLSLKNT-RMNTIVGTPEYC 342

Query: 548 APEL-------LLGQ-------------GYTKVVDWWTLGVLLYEMLTGLPPYY-DEDVP 586
           APE+       ++ Q             GY    D W+LGV+ + MLTG+ P+Y D    
Sbjct: 343 APEVGFKATRSIIDQSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDGSEN 402

Query: 587 KMYKKILQDPLRFP----DDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQ 639
            + + + +  L F     ++ + +AK  +  LL  D  +RL    S +   HP+ ++
Sbjct: 403 SIIQNVKRGKLDFSMKPWNNVNHNAKQFVEKLLEIDADKRLDSKQSFQ---HPWISR 456

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 105/224 (46%), Gaps = 29/224 (12%)

Query: 388 IGKGSFGKVMQVRKRDTNKIYALKAIR-KSYIVSKSE--VTHTLAERTV----------- 433
           IG GSFG V       T ++ A+K +  K  I + ++  V    AE+ V           
Sbjct: 395 IGSGSFGTVYLGMNAQTGELMAVKQVEIKPAIAATADANVEDKNAEKNVAKAPSTNLHRK 454

Query: 434 -----------LARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRS 482
                      L  + +  IV    S Q    L + L ++ GG +   L   G F+    
Sbjct: 455 MIDALQHEMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLI 514

Query: 483 RFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCK----LNMKDQEKTT 538
             +T ++L  +  LH  +II+RD+K  NIL+D +G + + DFG+ K    LN ++Q+K T
Sbjct: 515 VNFTRQILIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQENQDKRT 574

Query: 539 TFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYD 582
           +  G+  +++PE++     T   D W+ G ++ EM TG  PY D
Sbjct: 575 SLQGSVYWMSPEVVKQTATTSKADIWSTGCVVIEMFTGKHPYPD 618

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 90/334 (26%), Positives = 146/334 (43%), Gaps = 67/334 (20%)

Query: 385 LKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 439
           L  +G G+FG V       T++  A+K I K +       T  LA+RT     +L  + +
Sbjct: 25  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPF------STSVLAKRTYRELKLLKHLRH 78

Query: 440 PFIVPLKFSFQSS-EKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHD 498
             ++ L+  F S  E +Y V   + G +L   LQ     +    +++  ++L  L+ +H 
Sbjct: 79  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRP-LEKQFVQYFLYQILRGLKYVHS 136

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG-QGY 557
             +I+RDLKP NIL++    + +CDFGL ++      + T +  T  Y APE++L  Q Y
Sbjct: 137 AGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTWQKY 193

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL------------------------ 593
              VD W+ G +  EM+ G P +  +D    +  I                         
Sbjct: 194 NVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVT 253

Query: 594 ----QDPLRFPDDF---DKDAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLK 646
               +DP+ F   F   + DA DLL  +L  DPK+R+    +D + +HP           
Sbjct: 254 SLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRIT--AADAL-AHP----------- 299

Query: 647 MKGYIPPYKPPVMGAMDTSNFDQEFT-REQPVDS 679
              Y+ PY  P    +  + FD  F   + PVD+
Sbjct: 300 ---YLSPYHDPTDEPIAEAKFDWNFNDADLPVDT 330

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 104/230 (45%), Gaps = 36/230 (15%)

Query: 388 IGKGSFGKVMQVRKRDTNKIYALK-------------------------------AIRKS 416
           IG GSFG V      +T ++ A+K                               A++ +
Sbjct: 445 IGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHSPGGGNTAVKNT 504

Query: 417 YIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGR 476
             + +  +     E  +L  + +  IV    S Q    L + L ++ GG +   L   G 
Sbjct: 505 SQIHRKMIDALQHEMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNNYGP 564

Query: 477 FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCK----LNMK 532
           FD    + +T ++L  L  LH  +II+RD+K  NIL+D +G + + DFG+ K    LN K
Sbjct: 565 FDEPLVKNFTRQILIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGISKKLSPLN-K 623

Query: 533 DQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYD 582
            Q K  +  G+  ++APE++     T+  D W++G ++ EM TG  P+ D
Sbjct: 624 QQNKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVIVEMFTGKHPFPD 673

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 138/305 (45%), Gaps = 65/305 (21%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           + LL+ IG+GSFG V +V +   NK+   K +R  ++ +K E    ++E  +L+++ +  
Sbjct: 10  YRLLEEIGRGSFGSVRKVVREADNKVMVRKEVRYGHMNAK-ERQQLISECAILSQLKHDN 68

Query: 442 IVPLKFSFQSSEK---LYLVLAFINGGEL-----FYHLQREG-----------RFDLSRS 482
           IV   F +    K   L+L + + + G+L     +Y  QR+            +  ++  
Sbjct: 69  IVEF-FHWDHDAKSNTLFLYMEYCSKGDLSQMIRYYKHQRKYVPEEYVWRIMVQILMALF 127

Query: 483 RFYTAELLCALEALHD----------FDIIYRDLKPENILL--------------DYQGH 518
           + +    L  L+ ++D          + +I+RDLKP NI L              DY   
Sbjct: 128 KCHYGRDLSKLQTIYDAMEEPLKSKGYVVIHRDLKPGNIFLTGYDDEFNQNASDVDYSKV 187

Query: 519 I-ALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGL 577
           I  L DFGL K      E  TT+ GTP Y++PE+L  Q Y+ + D W+LG +LYE+ +  
Sbjct: 188 IIKLGDFGLAKSLQASIEFATTYVGTPYYMSPEVLRDQPYSPLSDIWSLGCILYELCSLH 247

Query: 578 PPY---------------YDEDVPKMYKKILQDPLR--FPDDFDKDAK--DLLIGLLCRD 618
            P+               Y E +P  Y K LQD +      DF K      LL  + CR 
Sbjct: 248 VPFQAKTYTELQGKVKAGYFEPLPHFYSKNLQDIITRCIQVDFTKRPSTWSLLNDIQCRI 307

Query: 619 PKRRL 623
            ++ L
Sbjct: 308 CRKAL 312

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 121/237 (51%), Gaps = 21/237 (8%)

Query: 386 KVIGKGSFGKVMQVRKRDTNKIYALKAIRKSY-----IVSKSEVTHTLAERTVLARVD-N 439
           ++I  GSF  V   +   T +  ALK +RK +     +   + + H   E  +L R+  +
Sbjct: 11  RLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHN--EYAILRRLGTH 68

Query: 440 PFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTA--ELLCALEALH 497
             I  L   ++ ++    VL +   G+L+  ++        R  F++   +L  A+   H
Sbjct: 69  RNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIRERPTMRINFHSFLFQLCSAISYCH 128

Query: 498 DFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFC-GTPEYLAPELLLGQG 556
             D+ +RD+KPEN+L+D +G + L DFGL ++    ++    +C GT +YLAPE  L + 
Sbjct: 129 SKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKD----YCIGTEKYLAPETFLREY 184

Query: 557 Y-TKVVDWWTLGVLLYEMLTGLPPY--YDEDVPKM---YKKILQDPLRFPDDFDKDA 607
           + T   D+W+LG+ ++ ++ G  P+     D PK    +++ ++DP RF + +  DA
Sbjct: 185 HNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRFIRDPHRFVESYYLDA 241

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 106/223 (47%), Gaps = 40/223 (17%)

Query: 382 FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 441
           + L+ +IG+G++G V     + T    A+K I+         VT TL E  +L       
Sbjct: 13  YKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQP--FTRPMFVTRTLRELKLL------- 63

Query: 442 IVPLKFSFQSSEKLYLVLAFINGG-----ELFYHLQREGRFDLSRS-------------R 483
               KF F S E +  VL  +        E  Y +Q     DL R              +
Sbjct: 64  ----KF-FHSHENIISVLDIVRPTSYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQ 118

Query: 484 FYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCK-LNMKDQEK------ 536
           ++T ++L AL++LH   +I+RDLKP N+LL+    + LCDFGL + L   D+ +      
Sbjct: 119 YFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGF 178

Query: 537 TTTFCGTPEYLAPELLLG-QGYTKVVDWWTLGVLLYEMLTGLP 578
            T +  T  Y APE++L  Q YT  +D W+ G +L EM++G P
Sbjct: 179 MTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKP 221

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 143/313 (45%), Gaps = 51/313 (16%)

Query: 370 KPST-----HKHLSIDDFDLLKV--IGKGSFGKVMQVRKRDTNKIYALK--------AIR 414
           KP+T     H   + D  DL+++  +G G+ G VM+V    ++++ A K        AI 
Sbjct: 85  KPATLAVDGHSGCNYDLRDLVQLGKLGSGNSGTVMKVLHVPSSRVIAKKTIVIEQNNAIV 144

Query: 415 KSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGEL------F 468
           K  I  +  +  ++AE   +        +    S   S  + +++ ++N G L      +
Sbjct: 145 KQQIYRELTIMRSVAEHRNIVEFYGAHNLS-SDSINGSNDVVILMEYMNCGSLDTITRTY 203

Query: 469 YHLQREGRFDLSRS-------------RFYTAELLCALEALHD-FDIIYRDLKPENILLD 514
             LQR G    +RS                   +L  L  L++ + II+RD+KP N+L++
Sbjct: 204 KSLQRRGILAANRSYPVQEWFSKPVIISRIAYSVLNGLSYLYENYKIIHRDIKPSNVLIN 263

Query: 515 YQGHIALCDFGLC-KLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEM 573
            +G I LCDFG+  KLN        TF GT  Y++PE + G  YT   D W+LG++L E+
Sbjct: 264 SKGRIKLCDFGVSRKLN---NSIADTFVGTSTYMSPERIQGNKYTTKGDVWSLGLMLIEL 320

Query: 574 LTG-LPPYYDEDVP----KMYKKILQDPL-RFPDDFDKD-AKDLL--IGLLCRDPKRRLG 624
           LTG  P     D P     + ++I+ +P  + P    K    D++  I L C   ++  G
Sbjct: 321 LTGEFPLGGHNDTPDGILDLLQRIVNEPAPKLPSSVIKVLPPDMVNFIDLCCVKVEKDRG 380

Query: 625 YHGSDEIKSHPFF 637
                E+  HPF 
Sbjct: 381 --SLQELLKHPFI 391

>CAGL0K01617g complement(142479..144803) similar to sp|P54199
           Saccharomyces cerevisiae YDL028c Serine/threonine
           protein kinase, start by similarity
          Length = 774

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 136/307 (44%), Gaps = 49/307 (15%)

Query: 371 PSTHKHLSID--DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTL 428
           PS    +S++  +++ ++++G+G    V +VR    N++YALK +       +S V    
Sbjct: 434 PSRKNVVSVNGTEYERVELLGRGGSSNVYKVRGL-KNRVYALKKVSFDEF-DESSVEGFK 491

Query: 429 AERTVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGEL--FYHLQREGRFDLSRSRFYT 486
            E ++L ++ N   V   + F+    +  +L      +L    H +    FD+   R++ 
Sbjct: 492 GEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQVLHQRANQPFDMEFIRYHA 551

Query: 487 AELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTF----CG 542
            E++  ++ +HD  I++ DLKP N +   +G + + DFG+   N         +     G
Sbjct: 552 REMVTCVKVVHDAGIVHSDLKPANFVF-VKGILKIIDFGIA--NAVPDHTVNIYRDMQIG 608

Query: 543 TPEYLAPELLLGQGYT-----------------KVVDWWTLGVLLYEMLTGLPPY----- 580
           TP Y+APE L+   YT                 K  D W+ G ++Y+M+ G PPY     
Sbjct: 609 TPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGCIIYQMIYGKPPYAKYQG 668

Query: 581 -------YDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIKS 633
                   D +V   YK++L D    P      A +L+   L R+P+ R     + +I  
Sbjct: 669 QERLLSIMDPNVKIEYKEVLPDKTVIP----SLALELMQYCLMRNPEERW---SALQILD 721

Query: 634 HPFFNQL 640
            PF N L
Sbjct: 722 SPFLNPL 728

>ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -
           SH] (398519..399607) [1089 bp, 362 aa]
          Length = 362

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 128/304 (42%), Gaps = 53/304 (17%)

Query: 386 KVIGKGSFGKVMQVR-KRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVP 444
           K IG G+FG V+Q     D  K Y   AI+K      ++  +   E  +L   D+P +V 
Sbjct: 29  KRIGHGAFGTVVQAYLTPDNEKWYGPFAIKKV----PAQTEYKSRELAILRIADHPNVVK 84

Query: 445 LKFSFQ----SSEKLYLVLAFINGGELFYH-----LQREGRFDLSRSRFYTAELLCALEA 495
           L++ F     S  K+Y  LA     E   H      Q +    L   + YT ++   +  
Sbjct: 85  LEYFFTHVSPSDGKVYQHLAMECLPETLQHEILRYTQNKLELPLKHIKMYTYQIARGMLY 144

Query: 496 LHDFDIIYRDLKPENILLDYQ-GHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG 554
           LH   I +RD+KP NIL+D + G + +CDFG  K   ++Q   +  C    Y APEL++G
Sbjct: 145 LHALGICHRDIKPSNILVDPKSGVLKICDFGSAKKLEQNQPSISYICSR-FYRAPELIVG 203

Query: 555 -QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDV-----------------------PKMYK 590
              YT  +D W LG ++ EML G   +  ++                        P    
Sbjct: 204 CTQYTTQIDIWGLGCVIGEMLIGKAVFQGQEPLLQLHEIAKLLGPPDKKFIFFSNPSYGG 263

Query: 591 KILQDPL-------RFPDDFDK---DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQL 640
            +   PL       RF   F     +  DLL+ +LC  P+RRL       +  H F ++L
Sbjct: 264 PLFSKPLFNGTPQQRFEKYFGHAGPEGIDLLMKVLCYSPERRL---SPRRVLCHAFLDEL 320

Query: 641 SWKR 644
              R
Sbjct: 321 RNDR 324

>Scas_700.35
          Length = 439

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 103/204 (50%), Gaps = 12/204 (5%)

Query: 385 LKVIGKGSFGKVMQVR-KRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLAR-VDNPFI 442
           L ++G+G+ G V + R ++++++++ALK I    + +  E    L       +   + +I
Sbjct: 152 LGMLGEGAGGSVAKCRLRKNSSQVFALKTINT--LNTDPEFQKQLFRELEFNKSFKSNYI 209

Query: 443 VPLKFSFQSS--EKLYLVLAFINGGEL--FYH--LQREGRFDLSRSRFYTAELLCALEAL 496
           V     F  +    +Y+ + ++ G  L   Y   L R GR            +L  L  L
Sbjct: 210 VTYYGMFNDTLNGSIYIAMEYMGGQSLDTIYKSLLSRGGRIGEKILGKIAESVLRGLSYL 269

Query: 497 HDFDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQG 556
           H+  II+RD+KP+NILL+ +G + LCDFG+    +      TTF GT  Y+APE + G  
Sbjct: 270 HERKIIHRDIKPQNILLNEEGEVKLCDFGVSGEAVNSL--ATTFTGTSFYMAPERIQGHP 327

Query: 557 YTKVVDWWTLGVLLYEMLTGLPPY 580
           Y+   D W+LG+ + E+  G  P+
Sbjct: 328 YSVTCDVWSLGLTILEVAQGRFPF 351

>Kwal_33.13222
          Length = 148

 Score = 82.0 bits (201), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/112 (33%), Positives = 68/112 (60%), Gaps = 1/112 (0%)

Query: 449 FQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKP 508
           ++++  LY+VL ++  GELF  L   G    + +  +  +++  +   H   I++RDLKP
Sbjct: 16  WETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP 75

Query: 509 ENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKV 560
           EN+LLD++ +I + DFG+  L  KD+   T+ CG+P Y APE++ G   +++
Sbjct: 76  ENLLLDHKFNIKIADFGMAALESKDKLLETS-CGSPHYAAPEIVSGTALSRL 126

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 138/312 (44%), Gaps = 53/312 (16%)

Query: 374 HKHLSIDD-FDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVT-HTLAER 431
           ++  S+D  F L+K IG G++G V   R  +  +   +   + + + SK+ +   +L E 
Sbjct: 14  NQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLREL 73

Query: 432 TVLARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRS--------- 482
            +L        +   +     + ++     ING  L+  L       + +S         
Sbjct: 74  KLLRHFRGHKNITCLYDM---DIVFYPDGSINGLYLYEELMECDMHQIIKSGQPLTDAHY 130

Query: 483 RFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGLCK----LNMKDQEKTT 538
           + +T ++LC L+ +H  D+++RDLKP N+L++    + +CDFGL +      +++ +  T
Sbjct: 131 QSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLT 190

Query: 539 TFCGTPEYLAPELLLG-QGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQDPL 597
            +  T  Y APE++L  QGYTK +D W+ G +L E L G P +  +D      +ILQ   
Sbjct: 191 EYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLG 250

Query: 598 RFPDD-------------------------------FDKDAKDLLIGLLCRDPKRRLGYH 626
             PD+                                +  A DLL  +L  DP++R+   
Sbjct: 251 TPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLAFDPQKRITV- 309

Query: 627 GSDEIKSHPFFN 638
             DE   HP+ +
Sbjct: 310 --DEALEHPYLS 319

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 89/334 (26%), Positives = 144/334 (43%), Gaps = 67/334 (20%)

Query: 385 LKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERT-----VLARVDN 439
           L  +G G+FG V       T +  A+K I K +       T  LA+RT     +L  + +
Sbjct: 32  LNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPF------STAVLAKRTYRELKLLKHLRH 85

Query: 440 PFIVPLKFSFQSS-EKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHD 498
             ++ L+  F S  E +Y V   + G +L   LQ     +    +++  ++L  L+ +H 
Sbjct: 86  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRP-LEKQFLQYFLYQILRGLKYVHS 143

Query: 499 FDIIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLG-QGY 557
             +I+RDLKP NIL++    + +CDFGL ++      + T +  T  Y APE++L  Q Y
Sbjct: 144 AGVIHRDLKPSNILINENCDLKICDFGLARIQ---DPQMTGYVSTRYYRAPEIMLTWQKY 200

Query: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL------------------------ 593
              VD W+ G +  EM+ G P +  +D    +  I                         
Sbjct: 201 NVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVT 260

Query: 594 ----QDPLRFPDDFDK---DAKDLLIGLLCRDPKRRLGYHGSDEIKSHPFFNQLSWKRLK 646
               +DP+ F + F     DA DLL  +L  DPK+R+    + +  +HP           
Sbjct: 261 SLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRI---TAGDALTHP----------- 306

Query: 647 MKGYIPPYKPPVMGAMDTSNFDQEFT-REQPVDS 679
              Y+ PY  P    +  + FD  F   + PVD+
Sbjct: 307 ---YLAPYHDPTDEPVADAKFDWNFNDADLPVDT 337

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,419,933
Number of extensions: 1007189
Number of successful extensions: 4419
Number of sequences better than 10.0: 664
Number of HSP's gapped: 3493
Number of HSP's successfully gapped: 732
Length of query: 705
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 596
Effective length of database: 12,822,747
Effective search space: 7642357212
Effective search space used: 7642357212
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)