Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B12694g56855929770.0
Kwal_26.762857055923440.0
Sklu_2430.457156023420.0
CAGL0K03421g56855222850.0
Scas_721.12356956122840.0
CAGL0K07480g56756022780.0
ABL029W56856022630.0
YMR105C (PGM2)56956122410.0
YKL127W (PGM1)57056221940.0
Scas_717.7056956121890.0
Kwal_27.102586204301042e-04
ABL126W624370960.002
YMR278W622595870.017
CAGL0M02981g617127860.026
AEL112C53564730.83
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B12694g
         (559 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B12694g 1107696..1109402 highly similar to sp|P37012 Saccha...  1151   0.0  
Kwal_26.7628                                                          907   0.0  
Sklu_2430.4 YMR105C, Contig c2430 6115-7830                           906   0.0  
CAGL0K03421g complement(313851..315557) highly similar to sp|P37...   884   0.0  
Scas_721.123                                                          884   0.0  
CAGL0K07480g complement(739633..741336) highly similar to sp|P37...   882   0.0  
ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C (P...   876   0.0  
YMR105C (PGM2) [4062] chr13 complement(475896..477605) Phosphogl...   867   0.0  
YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,...   849   0.0  
Scas_717.70                                                           847   0.0  
Kwal_27.10258                                                          45   2e-04
ABL126W [466] [Homologous to ScYMR278W - SH] complement(159209.....    42   0.002
YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containi...    38   0.017
CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces c...    38   0.026
AEL112C [2394] [Homologous to ScYJL162C - SH] (412116..413723) [...    33   0.83 

>KLLA0B12694g 1107696..1109402 highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, major isoform, start by similarity
          Length = 568

 Score = 1151 bits (2977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/559 (100%), Positives = 559/559 (100%)

Query: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60
           MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG
Sbjct: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60

Query: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120
           GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH
Sbjct: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120

Query: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180
           NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG
Sbjct: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180

Query: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKE 240
           DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKE
Sbjct: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKE 240

Query: 241 LGLPESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYGAG 300
           LGLPESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYGAG
Sbjct: 241 LGLPESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYGAG 300

Query: 301 PAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTGWK 360
           PAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTGWK
Sbjct: 301 PAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTGWK 360

Query: 361 FFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQ 420
           FFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQ
Sbjct: 361 FFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQ 420

Query: 421 TDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEGGD 480
           TDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEGGD
Sbjct: 421 TDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEGGD 480

Query: 481 FSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAEE 540
           FSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAEE
Sbjct: 481 FSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAEE 540

Query: 541 FLGKDIKTILKFLKFKEAI 559
           FLGKDIKTILKFLKFKEAI
Sbjct: 541 FLGKDIKTILKFLKFKEAI 559

>Kwal_26.7628
          Length = 570

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/559 (78%), Positives = 488/559 (87%), Gaps = 2/559 (0%)

Query: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60
           MSL   SV T P+ DQKPGTSGLRKKTKVF++ P+YTENFIQAI+EAIPEGS+ ATLV+G
Sbjct: 1   MSLTIESVPTKPFDDQKPGTSGLRKKTKVFKDEPHYTENFIQAILEAIPEGSENATLVVG 60

Query: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120
           GDGRYYN+ V+Q I AI +ANGVRK+++G NGILSTPAASHIIR+Y EKCTGGIILTASH
Sbjct: 61  GDGRYYNNEVMQIIGAIAAANGVRKMILGQNGILSTPAASHIIRSYPEKCTGGIILTASH 120

Query: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180
           NPGGP NDFGIKYNL+NGGPAPESVTN+I+ KS++LTHYKIV++FP ID +KIG+DQKYG
Sbjct: 121 NPGGPENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGKDQKYG 180

Query: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQ-AKNGFKILFDAMNGVTGPYGEALFVK 239
            LLVD+VDSTA YV LMKEIFDF LIK FID Q +  GFKILFD++NGVTGPYGEA+FVK
Sbjct: 181 PLLVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFVK 240

Query: 240 ELGLP-ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYG 298
           ELGLP E  LQNY PKPDFGGLHPDPNLTYAHTLVERVDK  I FGAASDGDGDRNMIYG
Sbjct: 241 ELGLPAEEVLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKEQIAFGAASDGDGDRNMIYG 300

Query: 299 AGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTG 358
            GPAFVSPGDSVAIIAEYAS IPYFKKQGIYGLARSFPTS+AIDRVAKEQGL CYEVPTG
Sbjct: 301 CGPAFVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLACYEVPTG 360

Query: 359 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKS 418
           WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAI+AWLNILAIYN+  P+ + SIK 
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIVAWLNILAIYNRDHPDSDVSIKV 420

Query: 419 IQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEG 478
           IQ  FW KYGRTFFTRYDFE +SSE A +V+ +L++ VA  +S  G  F  + +LTV + 
Sbjct: 421 IQEKFWAKYGRTFFTRYDFEQVSSESAAQVLQVLEDLVAAKDSSVGKPFAGNPALTVADC 480

Query: 479 GDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTA 538
           GDFSYTDLDGSVS HQGLY +LSNG RFVVRLSGTGSSGATIRLYVE+YT+D SKY    
Sbjct: 481 GDFSYTDLDGSVSEHQGLYAKLSNGCRFVVRLSGTGSSGATIRLYVEKYTDDASKYSLDV 540

Query: 539 EEFLGKDIKTILKFLKFKE 557
           E+FLG DIK+ILKFLKF E
Sbjct: 541 EQFLGDDIKSILKFLKFCE 559

>Sklu_2430.4 YMR105C, Contig c2430 6115-7830
          Length = 571

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/560 (78%), Positives = 489/560 (87%), Gaps = 3/560 (0%)

Query: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60
           MS K  ++ T PY DQKPGTSGLRKKTKVF E PNYTENFIQA+M+AIPEGSQ ATLV+G
Sbjct: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60

Query: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAY-HEKCTGGIILTAS 119
           GDGR+YNDVV+QKIAAIG+ANGV K+VIG NGILSTPAASHIIR Y H K TGGIILTAS
Sbjct: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120

Query: 120 HNPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKY 179
           HNPGG  NDFGIKYNL+NGGPAPESVTN I+ KS++LT YKIV +FP +DL+K G DQ+Y
Sbjct: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180

Query: 180 GDLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKN-GFKILFDAMNGVTGPYGEALFV 238
           G LLVDI+DST AYV+LMK IFDF LIK FI TQ +  GFK+LFD++NGVTGPYG+ALFV
Sbjct: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240

Query: 239 KELGL-PESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIY 297
            ELGL  E SLQNY PKPDFGGLHPDPNLTYAHTLVERVDK  I FGAASDGDGDRNMIY
Sbjct: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300

Query: 298 GAGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPT 357
           G GPAFVSPGDSVAIIAEYAS IPYF KQGIYGLARSFPTS+AIDRVAK  GLNCYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360

Query: 358 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIK 417
           GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYN++ P KEASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420

Query: 418 SIQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVE 477
           +IQ +FW KYGRTFFTRYDFE ++SE+A KVI LL N+V+  +S+    FPA   LTVV+
Sbjct: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480

Query: 478 GGDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQT 537
            GDFSYTDLDGSVSS+QGL+V+LSNG +FVVRLSGTGSSGATIRLYVERY+++ S Y  T
Sbjct: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540

Query: 538 AEEFLGKDIKTILKFLKFKE 557
           A++FLG DIK +L+FLKFKE
Sbjct: 541 ADQFLGNDIKHVLQFLKFKE 560

>CAGL0K03421g complement(313851..315557) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c Phosphoglucomutase 2,
           start by similarity
          Length = 568

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/552 (75%), Positives = 482/552 (87%), Gaps = 3/552 (0%)

Query: 7   SVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIGGDGRYY 66
           SV T PY DQKPGTSGLRKKTKVFE+ PNY ENFIQ++MEAIPEG++GA LV+GGDGRYY
Sbjct: 6   SVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDGRYY 65

Query: 67  NDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPT 126
           NDV++QKIAAIG+ANGV+K+VIG NG+LSTPAASHI+R Y EKCTGGIILTASHNPGGP 
Sbjct: 66  NDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPE 125

Query: 127 NDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDLLVDI 186
           ND GIKYNL+NGGPAPE VTN IW  S++LTHYKIV+ FP +DLTK+ +++KYG LLVD+
Sbjct: 126 NDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDV 185

Query: 187 VDSTAAYVELMKEIFDFPLIKSFIDTQAK-NGFKILFDAMNGVTGPYGEALFVKELGL-P 244
           +D+T AY++L+KEIFDF LI  FI  Q K  G+K+L D+MNGVTGPY +A+FV E GL  
Sbjct: 186 IDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGLDS 245

Query: 245 ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYGAGPAFV 304
           +  LQN+HP+PDFGGLHPDPNLTYAHTLVERV+K  I+FGAASDGDGDRNMIYG GPAFV
Sbjct: 246 KEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGPAFV 305

Query: 305 SPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTGWKFFCA 364
           SPGDSVAIIAEYA+ IPYFKKQGIYGLARSFPT+SAIDRVAK+ GLNCYEVPTGWKFFCA
Sbjct: 306 SPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKFFCA 365

Query: 365 LFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQTDFW 424
           LFDAKKLSICGEESFGTGSNHVREKDG+WAIMAWLNILAI+NQR P+KEASIK+IQ +FW
Sbjct: 366 LFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQNEFW 425

Query: 425 QKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEGGDFSYT 484
             YGRTFFTRYD+E + ++ A KVI  L+ YVAD    KG+KFP D +LTVV+ GDFSYT
Sbjct: 426 DTYGRTFFTRYDYEKVETDKANKVIENLRQYVAD-SGTKGSKFPTDSALTVVDAGDFSYT 484

Query: 485 DLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAEEFLGK 544
           DLDG++SSHQGLYV LSNG RFVVRLSGTGSSGATIRLY+ERYT+D SKY   A+E+L  
Sbjct: 485 DLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYLKP 544

Query: 545 DIKTILKFLKFK 556
            IK+I++FL  K
Sbjct: 545 IIKSIVQFLDLK 556

>Scas_721.123
          Length = 569

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/561 (74%), Positives = 490/561 (87%), Gaps = 3/561 (0%)

Query: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60
           MSL+  ++ T PY DQKPGTSGLRKKT +F   PNYTENFIQA+++AIPEGSQ ATLV+G
Sbjct: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60

Query: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120
           GDGR+YNDV++ KIAAI +ANGV+K++IG NG+LSTPAASHIIR+Y EK TGGIILTASH
Sbjct: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGGIILTASH 120

Query: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180
           NPGGP ND GIKYNLANGGPAPESVTN+IW  S++LTHYKI+++FP +DL+K+G+DQKYG
Sbjct: 121 NPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYG 180

Query: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKN-GFKILFDAMNGVTGPYGEALFVK 239
            LLVDI+D T  YV+ +KEIFDF LIK FI  Q +   +K+LFD++NG+TGPYG+A+FV 
Sbjct: 181 PLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVD 240

Query: 240 ELGLPESS-LQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYG 298
           E  LP +  LQN+HPKPDFGGLHPDPNLTYA TLVERVD+  I+FGAASDGDGDRNMIYG
Sbjct: 241 EFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIYG 300

Query: 299 AGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTG 358
           AGPAFVSPGDSVAIIAEYAS IPYF KQGIYGLARSFPTS+AIDRVAK  GL+CYEVPTG
Sbjct: 301 AGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPTG 360

Query: 359 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKS 418
           WKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAIYN+  P K+ASIK+
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIKT 420

Query: 419 IQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEG 478
           IQ +FW KYGRTFFTRYD+E++S+EDA KV+ LL N+V+ P  I G+ FP D+SLTVV+ 
Sbjct: 421 IQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVI-GSAFPGDESLTVVDA 479

Query: 479 GDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTA 538
           GDFSYTDLDGSVS HQGL+ +LSNG R V+RLSGTGSSGATIR+YVE YT+D +KYE++A
Sbjct: 480 GDFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESA 539

Query: 539 EEFLGKDIKTILKFLKFKEAI 559
           ++FL   IKT++KFLKFKE I
Sbjct: 540 QDFLAPTIKTVVKFLKFKEFI 560

>CAGL0K07480g complement(739633..741336) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, hypothetical start
          Length = 567

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/560 (74%), Positives = 485/560 (86%), Gaps = 5/560 (0%)

Query: 3   LKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIGGD 62
           ++  +V T PY DQKPGTSGLRKKTKVF E PNYTENFIQAIM+AIPEG++ A LV+GGD
Sbjct: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60

Query: 63  GRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASHNP 122
           GR+YNDV++QKIAAIG+ANGVRK++IG NG+LSTPAASH+IR+Y EKCTGGIILTASHNP
Sbjct: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGGIILTASHNP 120

Query: 123 GGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDL 182
           GGP ND GIKYNLANGGPAPE VTN +W  S++LTHYKI++ FP +D +KIG+DQ+YG L
Sbjct: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPL 180

Query: 183 LVDIVDSTAAYVELMKEIFDFPLIKSFIDTQ--AKNGFKILFDAMNGVTGPYGEALFVKE 240
           LVDI+D+T  YV+ MKEIFDF LIK FI  Q  AKN +K+LFD++NG+TGPYG+A+FV E
Sbjct: 181 LVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKN-WKLLFDSLNGITGPYGKAIFVDE 239

Query: 241 LGLP-ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYGA 299
             LP +  LQN+HP+PDFGGLHPDPNLTYAHTLVERVD+  I+FGAASDGDGDRNMIYGA
Sbjct: 240 FDLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGA 299

Query: 300 GPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTGW 359
           GPAFVSPGDSVAIIAEYA  IPYF+KQGIYGLARSFPTS AIDRVAK QGLNCYEVPTGW
Sbjct: 300 GPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGW 359

Query: 360 KFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSI 419
           KFFCALFDAKKLSICGEESFGTGSNH+REKDGVWAI AWLNILA+YN+  P KEASIK+I
Sbjct: 360 KFFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTI 419

Query: 420 QTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEGG 479
           Q +FW KYGRTFFTRYD+E +++E A KV+ LL  +V DP+S K   FP D+SLTV + G
Sbjct: 420 QEEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKS-KNAPFPGDESLTVSDCG 478

Query: 480 DFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAE 539
           DFSYTDLDGSVS HQGL+V+LSNG RFV+RLSGTGS+GATIRLY+E Y++D S Y Q+A+
Sbjct: 479 DFSYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSAD 538

Query: 540 EFLGKDIKTILKFLKFKEAI 559
           ++L K IK++  FL FKE I
Sbjct: 539 QYLQKMIKSVTSFLNFKELI 558

>ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C
           (PGM2) - SH] complement(343852..345558) [1707 bp, 568
           aa]
          Length = 568

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/560 (74%), Positives = 479/560 (85%), Gaps = 2/560 (0%)

Query: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60
           MS+   SV T  + DQKPGTSGLRKKTKVFE+T +YTENFIQAIME+IPEGS+ A LVIG
Sbjct: 1   MSITIESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAIMESIPEGSENAVLVIG 60

Query: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120
           GDGRYYND V+QKIA +GSANGVRK++IG NG+LSTPAASHIIR YH+K TGGIILTASH
Sbjct: 61  GDGRYYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHIIRTYHDKVTGGIILTASH 120

Query: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180
           NPGGP NDFGIKYNLANG PAPE VTNS++ +SR LTHYKI    P +DL KIG++Q+YG
Sbjct: 121 NPGGPDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYG 180

Query: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFID-TQAKNGFKILFDAMNGVTGPYGEALFVK 239
           +LLVD++D T AYV LMKEIFDFPLIK F++  Q + G K+LFDA+NG+TGPYG+A+FV 
Sbjct: 181 NLLVDVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVD 240

Query: 240 ELGLPESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYGA 299
           ELGL E SLQN+ PKPDFGGLHPDPNLTYAHTLV RVD+  I FGAASDGDGDRNMIYGA
Sbjct: 241 ELGLSEDSLQNFVPKPDFGGLHPDPNLTYAHTLVSRVDRENIAFGAASDGDGDRNMIYGA 300

Query: 300 GPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTGW 359
           GPAFVSPGDSVAIIAEYAS IPYF K GI+GLARSFPTS AID VAKE+ L+CYEVPTGW
Sbjct: 301 GPAFVSPGDSVAIIAEYASEIPYFIKNGIHGLARSFPTSGAIDLVAKEKNLDCYEVPTGW 360

Query: 360 KFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSI 419
           KFFC LFD+KKLSICGEESFGTGS+HVREKDG+WAI+AWLN+LAIY++R P++E SIK+I
Sbjct: 361 KFFCNLFDSKKLSICGEESFGTGSDHVREKDGLWAIVAWLNVLAIYHRRHPDREPSIKTI 420

Query: 420 QTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEGG 479
           Q +FW KYGRTFFTRYDFE   +EDA KVI LL+ +  +P ++ G  FPA   ++V   G
Sbjct: 421 QEEFWAKYGRTFFTRYDFEECDTEDANKVIELLRTFAENP-AVVGQPFPAWHEVSVSAAG 479

Query: 480 DFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAE 539
           DFSYTDLDGSVS HQGLY++LSNG R+VVRLSGTGSSGATIRLYVERYTND + Y QTA+
Sbjct: 480 DFSYTDLDGSVSEHQGLYIKLSNGTRYVVRLSGTGSSGATIRLYVERYTNDPAYYAQTAD 539

Query: 540 EFLGKDIKTILKFLKFKEAI 559
           +FL  DIK +LKFL+FK+ I
Sbjct: 540 QFLAPDIKAVLKFLRFKDLI 559

>YMR105C (PGM2) [4062] chr13 complement(475896..477605)
           Phosphoglucomutase, major isozyme, interconverts Glc-1-P
           and Glc-6-P [1710 bp, 569 aa]
          Length = 569

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/561 (73%), Positives = 479/561 (85%), Gaps = 3/561 (0%)

Query: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60
           MS +  +V T PY DQKPGTSGLRKKTKVF++ PNYTENFIQ+IMEAIPEGS+GATLV+G
Sbjct: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60

Query: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120
           GDGRYYNDV++ KIAAIG+ANG++K+VIG +G+LSTPAASHI+R Y EKCTGGIILTASH
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASH 120

Query: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180
           NPGGP ND GIKYNL+NGGPAPESVTN+IW  S++LT YKI++ FP +DL  IG+++KYG
Sbjct: 121 NPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYG 180

Query: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQ-AKNGFKILFDAMNGVTGPYGEALFVK 239
            LLVDI+D T  YV  +KEIFDF LIK FID Q +   +K+LFD+MNGVTGPYG+A+FV 
Sbjct: 181 PLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVD 240

Query: 240 ELGLP-ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYG 298
           E GLP +  LQN+HP PDFGG+HPDPNLTYA +LV+RVD+  I+FGAASDGDGDRNMIYG
Sbjct: 241 EFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYG 300

Query: 299 AGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTG 358
            GP+FVSPGDSVAIIAEYA+ IPYF KQGIYGLARSFPTS AIDRVAK  GLNCYEVPTG
Sbjct: 301 YGPSFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTG 360

Query: 359 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKS 418
           WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYN+  P  EASIK+
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKT 420

Query: 419 IQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEG 478
           IQ +FW KYGRTFFTRYDFE + +E A K++  L+ YV     +  + FPAD+SL V + 
Sbjct: 421 IQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTK-SGVVNSAFPADESLKVTDC 479

Query: 479 GDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTA 538
           GDFSYTDLDGSVS HQGLYV+LSNG RFV+RLSGTGSSGATIRLY+E+Y +D S+Y++TA
Sbjct: 480 GDFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTA 539

Query: 539 EEFLGKDIKTILKFLKFKEAI 559
           EE+L   I +++KFL FK+ +
Sbjct: 540 EEYLKPIINSVIKFLNFKQVL 560

>YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,
           minor isoform, interconverts Glc-1-P and Glc-6-P [1713
           bp, 570 aa]
          Length = 570

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/562 (72%), Positives = 480/562 (85%), Gaps = 4/562 (0%)

Query: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60
           MSL   SV T  Y DQKPGTSGLRKKTKVF + P+YTENFIQA M++IP GS+G TLV+G
Sbjct: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60

Query: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGG-IILTAS 119
           GDGR+YNDV++ KIAA+G+ANGVRK+VIG  G+LSTPAASHIIR Y EKCTGG IILTAS
Sbjct: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120

Query: 120 HNPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKY 179
           HNPGGP ND GIKYNL NGGPAPESVTN+IW  S++LTHYKI+++FP ++L K+G++QKY
Sbjct: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKY 180

Query: 180 GDLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKN-GFKILFDAMNGVTGPYGEALFV 238
           G LLVDI+D   AYV+ +KEIFDF LIKSF+  Q K+ G+K+LFD++NG+TGPYG+A+FV
Sbjct: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240

Query: 239 KELGLP-ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIY 297
            E GLP E  LQN+HP PDFGGLHPDPNLTYA TLV+RVD+  I FGAASDGDGDRNMIY
Sbjct: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300

Query: 298 GAGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPT 357
           G GPAFVSPGDSVAIIAEYA  IPYF KQGIYGLARSFPTSSAIDRVA ++GL CYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360

Query: 358 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIK 417
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLNILAIY++R P KEASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIK 420

Query: 418 SIQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVE 477
           +IQ +FW +YGRTFFTRYD+E++  E A KV+ LL  +V+ P ++ G+ FPAD+SLTV++
Sbjct: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRP-NVCGSHFPADESLTVID 479

Query: 478 GGDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQT 537
            GDFSY DLDGS+S +QGL+V+ SNG +FV+RLSGTGSSGATIRLYVE+YT+    Y QT
Sbjct: 480 CGDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQT 539

Query: 538 AEEFLGKDIKTILKFLKFKEAI 559
           A+ FL   I +I+KFL+FKE +
Sbjct: 540 ADVFLKPVINSIVKFLRFKEIL 561

>Scas_717.70
          Length = 569

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/561 (71%), Positives = 477/561 (85%), Gaps = 3/561 (0%)

Query: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60
           MS +  +V T PY DQKPGTSGLRKKTK+F++TPNYTENFIQAIM+AIPEGS+GATLV+G
Sbjct: 1   MSFQIQTVPTKPYQDQKPGTSGLRKKTKIFKDTPNYTENFIQAIMDAIPEGSKGATLVVG 60

Query: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASH 120
           GDGRYYNDV++ KIAAIG+ANGV+K+VIG  G+LSTPAASHI+R Y EK  GGIILTASH
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGVKKLVIGQRGLLSTPAASHIMRTYEEKTQGGIILTASH 120

Query: 121 NPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYG 180
           NPGG  ND GIK+NL+NGGPAPE VTN IW  S+++T +KI++ FP ++L  +G+++KYG
Sbjct: 121 NPGGIKNDMGIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYG 180

Query: 181 DLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNG-FKILFDAMNGVTGPYGEALFVK 239
            LLVD++D+T AYVE +K+IFDF LIK F+  Q     +K+LFD MNGVTGPYG+A+FV 
Sbjct: 181 PLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVD 240

Query: 240 ELGLP-ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIYG 298
           ELGLP +  LQ +HP PDFGG+HPDPNLTYA  LV+RVD+  I+FGAASDGDGDRNMIYG
Sbjct: 241 ELGLPADEVLQQWHPSPDFGGVHPDPNLTYAKALVDRVDRENIEFGAASDGDGDRNMIYG 300

Query: 299 AGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPTG 358
           AGPAFVSPGDSVAIIAEYA+ IPYF KQGIYGLARSFPTSSAIDRVAK  GLNCYEVPTG
Sbjct: 301 AGPAFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCYEVPTG 360

Query: 359 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKS 418
           WKFFCALFDAKKLSICGEESFGTGSNHVREKDG+WAI+AWLN+LAIYN+  P+++ SIK 
Sbjct: 361 WKFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAILAWLNLLAIYNKHHPDRDVSIKI 420

Query: 419 IQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVEG 478
           IQ +FW KYGRTFFTRYD+E +++EDA KVI  L+ +V + ++    KFP D+SLTVVE 
Sbjct: 421 IQDEFWNKYGRTFFTRYDYEKVATEDAAKVIDNLRKHV-ESKTFVNHKFPTDESLTVVEA 479

Query: 479 GDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTA 538
           GDFSYTDLDGSVS+HQGL+ +LSNG R VVRLSGTGSSGATIRLYVE+YT+D S Y Q A
Sbjct: 480 GDFSYTDLDGSVSAHQGLFFKLSNGARVVVRLSGTGSSGATIRLYVEKYTDDKSVYGQNA 539

Query: 539 EEFLGKDIKTILKFLKFKEAI 559
           + +L   I++++KFL FKE I
Sbjct: 540 QVYLKPVIQSVVKFLNFKEFI 560

>Kwal_27.10258
          Length = 620

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 103/430 (23%), Positives = 173/430 (40%), Gaps = 64/430 (14%)

Query: 19  GTSGLRKKTKV-FEETPNYT-----ENFIQAIMEAIPEGSQGATLVIGGDGRYYNDVVIQ 72
           GT+GLR K +  F      T     +   + I E  PE     T+ +G D R+ N     
Sbjct: 55  GTAGLRSKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENK---TVAVGHDHRF-NSRDFA 110

Query: 73  KIAAIGSANGVRKIV-IGHNG------ILSTPAASHIIRAYHEKCTGGIILTASHNPGGP 125
           ++ ++       K+  +G N        + TP     I       + G+++TASHN   P
Sbjct: 111 EVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAIDRL--GASAGVMITASHN---P 165

Query: 126 TNDFGIKYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGD 181
             D G K   +NG     P    +  SI      L  ++      A+ + +  +   + D
Sbjct: 166 KMDNGYKVYYSNGCQIIPPHDRLIAQSILDN---LNPWERAWDCKAV-IAEATEKGYFVD 221

Query: 182 LLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKEL 241
           +   +VD        +KEI D  L+ S I  ++K  F  ++  ++GV     E +  + L
Sbjct: 222 MKKPMVD------HYVKEISD-KLVSSDIGDRSKPWF--VYTPLHGVGFEIFERIASEVL 272

Query: 242 GLPESS-----LQNYHPKPDFGGLH-PDPNLTYAHTL-VERVDKYGIQFGAASDGDGDR- 293
           GL E        ++  P P F  +  P+P    A  L +   DK GI F   +D D DR 
Sbjct: 273 GLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAGALDLAIALADKNGISFVLGNDPDADRF 332

Query: 294 -NMIYGAGPAFVSPGDSVAII------AEYASAIPYFKKQGIYGLARSFPTSSAIDRVAK 346
              +   G      G+ +  +       +Y      FK +    L  S  +S  I ++A 
Sbjct: 333 SAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAG 392

Query: 347 EQGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAIMAW 398
            +  +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A + +
Sbjct: 393 VEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVF 450

Query: 399 LNILAIYNQR 408
           L +L  + ++
Sbjct: 451 LQMLWSWKKQ 460

>ABL126W [466] [Homologous to ScYMR278W - SH]
           complement(159209..161083) [1875 bp, 624 aa]
          Length = 624

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 86/370 (23%), Positives = 153/370 (41%), Gaps = 68/370 (18%)

Query: 111 TGGIILTASHNPGGPTNDFGIKYNLANGG----PAPESVTNSI------WHKSRELTHYK 160
           + G+++TASHNP     D G K   ANG     P  E +   I      W ++ + +   
Sbjct: 158 SCGVMITASHNP---KMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWD-SKAL 213

Query: 161 IVESFPAIDLTKIGQD--QKYGDLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGF 218
           I E+  +  L  + ++  QKY D +  +                  L+K   + +   G 
Sbjct: 214 IEEAIKSGKLHDVRKEMLQKYKDSIQTM------------------LVKQ-SNLKFAGGP 254

Query: 219 KILFDAMNGVTGPYGEALFVKELGLPESS-----LQNYHPKPDFGGLH-PDPNLTYAHTL 272
             ++  M+GV   + +      LG+ E        +  +P P+F  +  P+P    A  +
Sbjct: 255 WFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDM 314

Query: 273 VERV-DKYGIQFGAASDGDGDRNMI----YGAGPAFVSPGDSVAIIAEYASAIPYFKKQG 327
             +V D  GI    A+D D DR  +    +G        G+ + I+   A    YFK+  
Sbjct: 315 AMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLT--GNQIGILFAQAEMQSYFKEPK 372

Query: 328 I----YGLARSFPTSSAIDRVAKEQGLNCYEVPTGWKFFCALFDAKKLSICG-------E 376
           +      +  S  +S  + ++A+E+G    E  TG+K+      A++L + G       E
Sbjct: 373 LDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYE 430

Query: 377 ESFG-TGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQTDFWQKYGRTFFTRY 435
           E+ G   S  V +KDG+ A   +L +   + +       S + +  + ++KYG  +F  Y
Sbjct: 431 EAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDY 484

Query: 436 DFENLSSEDA 445
           +   +SS  A
Sbjct: 485 NGYYISSAPA 494

>YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containing
           a phosphoglucomutase or phosphomannomutase
           alpha-beta-alpha domain I, has high similarity to
           uncharacterized C. albicans Orf6.8892p [1869 bp, 622 aa]
          Length = 622

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 131/595 (22%), Positives = 241/595 (40%), Gaps = 95/595 (15%)

Query: 19  GTSGLRKKTKVFEETPNYTENFIQA-------IMEAIPEGSQGATLVIGGDGRYYNDVVI 71
           GT+GLR + +      N T   IQA       + +  P+       V+G D R+++    
Sbjct: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPDN---LVAVVGHDHRFHSKEFA 111

Query: 72  QKIAAIGSANGVRKIVIG-HNGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPTNDFG 130
           +  AA     G +   +   +  + TP     +     K + G+++TASHN   P  D G
Sbjct: 112 RATAAAFLLKGFKVHYLNPDHEFVHTPLVPFAVDKL--KASVGVMITASHN---PKMDNG 166

Query: 131 IKYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDLLVDI 186
            K   +NG     P   ++++SI      L  +  V  F  +    + +  K G L+   
Sbjct: 167 YKVYYSNGCQIIPPHDHAISDSI---DANLEPWANVWDFDDV----LNKALKQGKLMYSR 219

Query: 187 VDSTAAYV-ELMKEIFDFPLIKSFIDTQAKNGFKILFDAMNGVTGPYGEALFVKELGLPE 245
            +    Y+ E+ K + +   +K  ++ +AK  F  ++  M+GV       +  K L L E
Sbjct: 220 EEMLKLYLEEVSKNLVEINPLK--LEVKAKPWF--VYTPMHGVGFDIFSTIVKKTLCLVE 275

Query: 246 SS-----LQNYHPKPDFGGL-HPDPNLTYAHTL-VERVDKYGIQFGAASDGDGDRNMI-- 296
                   +  +P P F  +  P+P    A  + +   +K+ I    A+D D DR  +  
Sbjct: 276 GKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAV 335

Query: 297 --YGAGPAFVSPGDSVAII------AEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQ 348
               +G      G+ +  +       +Y S    F+      +  S  +S  I ++A+ +
Sbjct: 336 KDMQSGEWRQLTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIE 395

Query: 349 GLNCYEVPTGWKFF--CALFDAKK---LSICGEESFG---TGSNHVREKDGVWAIMAWLN 400
           G +  +  TG+K+    A+   KK   +    EE+ G       H  +KDG+ A + +L 
Sbjct: 396 GFHYEDTLTGFKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEH--DKDGISASIVFLQ 453

Query: 401 ILAIYNQRFPNKEASIKSIQTDFWQKYGRTFFTRYD-FENLSSEDAGKVILLLQNYVADP 459
             A    +  +    +  ++  F +KYG   F  Y+ +  + +    K I    +Y+ + 
Sbjct: 454 --AYCKWKIDHNLDPLNVLENGF-KKYG--VFKEYNGYYVVPNPTVTKDIF---DYIRNV 505

Query: 460 ESIKGTKFPAD--DSLTVVEGGDFSYTDLDGSVSSHQGLYV-----------RLSNG--- 503
            + +G  +P+   + + V+   D +      +++    L V           R SNG   
Sbjct: 506 YTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSEN 565

Query: 504 --VRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQTAEEFLGKDIKTILKFLKFK 556
             +RF +R SGT      +++Y+E   N+    EQ A  FL K    +L+   F+
Sbjct: 566 EHIRFTIRGSGTEPK---LKVYIEACANE----EQRA-SFLAKLTWNVLRREWFR 612

>CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces
           cerevisiae YMR278w, hypothetical start
          Length = 617

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 15/127 (11%)

Query: 19  GTSGLRKKTKVFEETPNY------TENFIQAIMEAIPEGSQGATLVIGGDGRYYNDVVIQ 72
           GT+GLR + +      N       ++     I +  P   Q  T V+G D RY++    Q
Sbjct: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQ 109

Query: 73  KIAAIGSANGVRKIVIG-HNGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPTNDFGI 131
             AA     G +   +  H+  + TP   + +   H   + G+++TASHNP     D G 
Sbjct: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVD--HLNASVGVMITASHNPKM---DNGY 164

Query: 132 KYNLANG 138
           K    NG
Sbjct: 165 KVYYTNG 171

>AEL112C [2394] [Homologous to ScYJL162C - SH] (412116..413723)
           [1608 bp, 535 aa]
          Length = 535

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 328 IYGLARSFPTSSAIDRVAKEQGLNCYEVPTGWKFFCALFDAKKLSICGEE--SFGTGSNH 385
           +Y + R  PT  A+D       ++  E+PT   F C + D   + +C E+   F T +N 
Sbjct: 408 VYKIDRIPPTEFAMD-----LSVSDIELPTMPSFHCNILDKSDIKLCREKILEFNTKANR 462

Query: 386 VREK 389
           ++++
Sbjct: 463 LKKQ 466

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,565,448
Number of extensions: 899938
Number of successful extensions: 2010
Number of sequences better than 10.0: 18
Number of HSP's gapped: 2022
Number of HSP's successfully gapped: 18
Length of query: 559
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 452
Effective length of database: 12,891,983
Effective search space: 5827176316
Effective search space used: 5827176316
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)