Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B12672g60959630720.0
Sklu_2430.36266177621e-92
Scas_717.716256087272e-87
YMR106C (YKU80)6295907245e-87
ABL030W6026006903e-82
Kwal_26.76246025616632e-78
CAGL0K03443g6156025551e-62
YGR112W (SHY1)38926683.1
KLLA0A09427g101178667.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B12672g
         (600 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B12672g 1105330..1107159 weakly similar to sp|Q04437 Saccha...  1187   0.0  
Sklu_2430.3 YMR106C, Contig c2430 3786-5666                           298   1e-92
Scas_717.71                                                           284   2e-87
YMR106C (YKU80) [4063] chr13 complement(478300..480189) Componen...   283   5e-87
ABL030W [562] [Homologous to ScYMR106C (YKU80) - SH] complement(...   270   3e-82
Kwal_26.7624                                                          259   2e-78
CAGL0K03443g complement(316368..318215) similar to sp|Q04437 Sac...   218   1e-62
YGR112W (SHY1) [2071] chr7 (717360..718529) Mitochondrial protei...    31   3.1  
KLLA0A09427g complement(821244..824279) similar to sp|P07276 Sac...    30   7.4  

>KLLA0B12672g 1105330..1107159 weakly similar to sp|Q04437
           Saccharomyces cerevisiae YMR106c HDF2 component of DNA
           end-joining repair pathway singleton, start by
           similarity
          Length = 609

 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/596 (97%), Positives = 579/596 (97%)

Query: 1   MSELTCFVVDVGSLSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPVN 60
           MSELTCFVVDVGSLSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPVN
Sbjct: 1   MSELTCFVVDVGSLSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPVN 60

Query: 61  NMAMLPVLPRAPISISDVRSWLGQWYDERNNTTGNGEXXXXXMLFNGLLISVLKLKEFVG 120
           NMAMLPVLPRAPISISDVRSWLGQWYDERNNTTGNGE     MLFNGLLISVLKLKEFVG
Sbjct: 61  NMAMLPVLPRAPISISDVRSWLGQWYDERNNTTGNGEDDDDDMLFNGLLISVLKLKEFVG 120

Query: 121 KRKMKVKIVVFSSQDLQNVTDEELSTFADQCPFDLVIADCNDKQGHQESKHGNWLKLGTP 180
           KRKMKVKIVVFSSQDLQNVTDEELSTFADQCPFDLVIADCNDKQGHQESKHGNWLKLGTP
Sbjct: 121 KRKMKVKIVVFSSQDLQNVTDEELSTFADQCPFDLVIADCNDKQGHQESKHGNWLKLGTP 180

Query: 181 LVYGIDELIQSVADPKLKLTRPIRTFQGQLRLGDVNASDLGIPSLCINLEGVPGTKSVSS 240
           LVYGIDELIQSVADPKLKLTRPIRTFQGQLRLGDVNASDLGIPSLCINLEGVPGTKSVSS
Sbjct: 181 LVYGIDELIQSVADPKLKLTRPIRTFQGQLRLGDVNASDLGIPSLCINLEGVPGTKSVSS 240

Query: 241 ISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASPKKETTRKDDDGDSGNNTGPR 300
           ISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASPKKETTRKDDDGDSGNNTGPR
Sbjct: 241 ISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASPKKETTRKDDDGDSGNNTGPR 300

Query: 301 MINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLDIRGFMDIDKLPRHYLCSESMY 360
           MINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLDIRGFMDIDKLPRHYLCSESMY
Sbjct: 301 MINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLDIRGFMDIDKLPRHYLCSESMY 360

Query: 361 LVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFGNEVQMCSLFPVRVHDKDXXXX 420
           LVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFGNEVQMCSLFPVRVHDKD    
Sbjct: 361 LVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFGNEVQMCSLFPVRVHDKDRNEV 420

Query: 421 XXXXXXXXPMSEDERNSAFPKMCESTELEPEDEAMGQFVDSMNLDNDAQDLPWYESDQIQ 480
                   PMSEDERNSAFPKMCESTELEPEDEAMGQFVDSMNLDNDAQDLPWYESDQIQ
Sbjct: 421 RLLVLNRLPMSEDERNSAFPKMCESTELEPEDEAMGQFVDSMNLDNDAQDLPWYESDQIQ 480

Query: 481 KYTDVALEQSSLPLPQREMFRATARNPSAIPAISLHRQQQVILECVHQKFIVGKRDQQDL 540
           KYTDVALEQSSLPLPQREMFRATARNPSAIPAISLHRQQQVILECVHQKFIVGKRDQQDL
Sbjct: 481 KYTDVALEQSSLPLPQREMFRATARNPSAIPAISLHRQQQVILECVHQKFIVGKRDQQDL 540

Query: 541 NIPPMSKMILKKITPKYNADVSLSNRIKEQFNVVKKEVSVQTPVNIEQEFEEQDPE 596
           NIPPMSKMILKKITPKYNADVSLSNRIKEQFNVVKKEVSVQTPVNIEQEFEEQDPE
Sbjct: 541 NIPPMSKMILKKITPKYNADVSLSNRIKEQFNVVKKEVSVQTPVNIEQEFEEQDPE 596

>Sklu_2430.3 YMR106C, Contig c2430 3786-5666
          Length = 626

 Score =  298 bits (762), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 199/617 (32%), Positives = 322/617 (52%), Gaps = 77/617 (12%)

Query: 2   SELTCFVVDVGS--LSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVN--VSSSDESL 57
           SE T F++DV    ++G    KA  Y+EY L  KV+  RKTDYV   LVN  ++ +++  
Sbjct: 3   SEATTFLIDVSHSMVAGGHVDKALAYLEYTLFQKVKKGRKTDYVSCILVNCPLTKNNQDT 62

Query: 58  PVNNMAMLPVLPRAPIS----ISDVRSWLGQWYDERNNTTGNGEXXXXXMLFNGLLISVL 113
                A+    P   ++    + D+R+ L Q+ +     T + +      +   +L+S +
Sbjct: 63  DYIYEALEVTAPVTSVTTVKLLKDIRTVL-QYIE-----TTDKDHSECLSMIQSVLVSSV 116

Query: 114 KLKEFVGKRKMKVKIVVFSSQDLQNVTDE-ELSTFADQCPFDLVIADCNDKQGHQESKHG 172
            L++F  KRK+   +VVF+        D+ EL   +++    +++  C D++  +++   
Sbjct: 117 ILRDFFKKRKITKNLVVFTDDMDGLDCDDDELQIMSNELDCRIILVHCEDEKKLKDNGDT 176

Query: 173 NWLK----LGTPLVYGIDELIQSVADPKLKLTRPIRTFQGQLRLG----DVNASDLGIPS 224
            W K    +   + Y I EL++++  PK  + +P+R FQG+LRLG    D  +S     S
Sbjct: 177 IWGKCVRSVPGSVKYTILELLRTITIPKPPVVKPVRIFQGELRLGASMEDAGSSMDDFKS 236

Query: 225 LCINLEGVPGTKSVSSISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASPKKET 284
           +CI +EG P TK+VS+++RKV+ K G ++    Y  VKS+IEY+I ++            
Sbjct: 237 ICIQVEGFPATKAVSNLNRKVVVKNGEND----YSPVKSIIEYEIHNRV----------- 281

Query: 285 TRKDDDGDSGNNTGPRMINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLDIRGFM 344
                   +G  +    + VSK  I KAYRYG+DYV LP  L+ ER    +PGLDIRGF+
Sbjct: 282 --------NGETSEFDAVAVSKSSITKAYRYGSDYVVLPPTLESERIYETEPGLDIRGFL 333

Query: 345 DIDKLPRHYLCSESMYLVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFGNEVQM 404
           D    PR+YL SES ++V D++ GS+ D++    LVDSLIK+++  IAR+V +  +EVQM
Sbjct: 334 DRKDFPRYYLNSESTFIVTDTRQGSRADYMALSALVDSLIKLEKFAIARYVQRKNSEVQM 393

Query: 405 CSLFPVRVHD---------KDXXXXXXXXXXXXPMSEDERNSAFPKMC------------ 443
           C L P+ + D         ++            P +EDER+  FPK+             
Sbjct: 394 CLLCPILIDDTNGMKRKLGREEQHTRALILSRLPFAEDERSPDFPKLSYQRTTSGKTLVE 453

Query: 444 ESTELEPEDEAMGQFVDSMNLDND--AQDLPWYESDQIQKYTDVALEQSSLPLPQREMFR 501
           ++T L   D  M  F+DSM+LD++  + +  WY +             +++PLP  E   
Sbjct: 454 DTTNL---DSQMSMFIDSMDLDDNTGSSESSWYRNPCFVTADPTNALSTTIPLPSIEQDG 510

Query: 502 ATAR---NPSAIPAISLHRQQQVILECVHQKFIV--GKRDQQDLNIPPMSKMILKKITPK 556
              +   NP  +PAIS HRQQQ +LE +HQK+++   K D+ +  +P M  ++L K  P 
Sbjct: 511 KEPKANGNPLCMPAISAHRQQQALLEYMHQKYVMETKKDDKFEFQVPSMPDLLLSKTRPP 570

Query: 557 YNADVSLSNRIKEQFNV 573
              ++ LSNR+ E  ++
Sbjct: 571 KLPEIELSNRLVEMLDI 587

>Scas_717.71
          Length = 625

 Score =  284 bits (727), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 204/608 (33%), Positives = 316/608 (51%), Gaps = 75/608 (12%)

Query: 2   SELTCFVVDVGS--LSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPV 59
           +E T F+VDV    ++ D   KA  Y+E+ LL K + +RKTD+  L   N   +  S  V
Sbjct: 3   AESTTFIVDVSKNMINNDNVSKAMAYIEFTLLEKCKKKRKTDWTSLYAANSIETSNSQEV 62

Query: 60  NNMAML-PVLPRAPISISDVRSWLGQWYDERNNTTGNGEXXXXXMLFNGLLISVLKLKEF 118
            N++ L P +  AP++  DV + + +   ++     N        +   LL++ L ++E 
Sbjct: 63  PNVSQLSPFI--APVTSDDVAATMRRL--QKQCEVKNEADDMESSMVQCLLVASLDIREQ 118

Query: 119 VGKRKMKVKIVVFSSQDLQ--NVTDEELSTFADQCPFDLVIADCNDKQGH-----QESKH 171
            G +KM  +I+VF+  DL   N  DEE+     +    +++ DC +         +++  
Sbjct: 119 FGAKKMLRQIMVFTD-DLNGLNFNDEEIDVLVGEIDSRIILVDCQEDSEDGEEEGKKNVD 177

Query: 172 GNWLKLGTPL----VYGIDELIQSVADPKLKLTRPIRTFQGQLRLG-------DVNASDL 220
             WLKL   L    +  +D+L+  +  PK  + +P+R F G+LRLG       + NA D+
Sbjct: 178 KAWLKLIKKLPGSMILPMDDLLLEITSPKPAVVKPVRVFNGELRLGANIDSNAESNADDM 237

Query: 221 GIPSLCINLEGVPGTKSVSSISRKVMRKEGSSEGQPT-YRAVKSVIEYQIEDQSASTSAS 279
               L + +EG P TKS+ S++R+   K  + E   T Y  VKSVIEY++         +
Sbjct: 238 N--CLSMKVEGYPATKSLQSLNRRNTIKTVTGENHSTKYIPVKSVIEYEV--------IN 287

Query: 280 PKKETTRKDDDGDSGNNTGPRMINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLD 339
           PK+ +   DD  D+      R + VS+D I KAYRYGADYV LP  L  +      PGLD
Sbjct: 288 PKESSQDADDKNDA------RPVTVSRDSITKAYRYGADYVVLPSTLQSQLVYETFPGLD 341

Query: 340 IRGFMDIDKLPRHYLCSESMYLVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFG 399
           IRGFMD++ LPR+YL SES +++ D++ G   D + F  LVD L+  +++ +AR+VPK  
Sbjct: 342 IRGFMDMELLPRYYLNSESTFIIADTRLGGLADSVTFGVLVDVLLNNRKVAVARYVPKAN 401

Query: 400 NEVQMCSLFPVRV--HDK------DXXXXXXXXXXXXPMSEDERNSAFPKMC-------- 443
           +EVQMC L P+ V  HD+      +            P +EDER S FP++         
Sbjct: 402 SEVQMCVLVPLFVAHHDQSFSGEGEENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGR 461

Query: 444 ----ESTELEPEDEAMGQFVDSMNLDN--DAQDLPWYESDQIQKYTDVALEQSSLPLPQR 497
               +  E++  D  M +FVDSM+ DN  +  D  +Y+   I + T    + ++L LP +
Sbjct: 462 TLPEDKNEIDELDVLMEEFVDSMDTDNLLNVPDPEYYKP--ISQVT----QDTTLRLPTK 515

Query: 498 EMFR-ATARNPSAIPAISLHRQQQVILECVHQKFIVGKRDQQDLNIPPMSKMILKKITPK 556
           E+      ++P  IPAI +HRQQQV+LE +HQK I+G       +IP +   + ++I P 
Sbjct: 516 EVKELENEQDPLRIPAIGVHRQQQVLLEWIHQKVIMG---SDAFDIPDIPDKLREQIAPH 572

Query: 557 YNADVSLS 564
            N  V LS
Sbjct: 573 VNKKVDLS 580

>YMR106C (YKU80) [4063] chr13 complement(478300..480189) Component
           of DNA end-joining repair pathway, involved in
           protecting telomeres from homologous recombination, acts
           in a complex with Yku70p [1890 bp, 629 aa]
          Length = 629

 Score =  283 bits (724), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 192/590 (32%), Positives = 309/590 (52%), Gaps = 60/590 (10%)

Query: 2   SELTCFVVDVGS--LSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPV 59
           SE T F+VDV    +  +   K+  Y+EY LLNK +  RKTD++   L N   S+ S  +
Sbjct: 3   SESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQEI 62

Query: 60  NNMAMLPVLPRAPISISDVRSW---LGQWYDERNNTTGNGEXXXXXMLFNGLLISVLKLK 116
            N+  +     AP++ +    +   L Q+ D+ ++ + N        +   LL+  L +K
Sbjct: 63  PNVFQIQSF-LAPVTTTATIGFIKRLKQYCDQHSHDSSN---EGLQSMIQCLLVVSLDIK 118

Query: 117 EFVGKRKMKVKIVVFSSQ-DLQNVTDEELSTFADQCPFDLVIADCNDKQGHQESKHGNWL 175
           +    RK+  +IVVF+   D  ++TDEE+    ++    +++ DC  K   +E K  NWL
Sbjct: 119 QQFQARKILKQIVVFTDNLDDLDITDEEIDLLTEELSTRIILIDCG-KDTQEERKKSNWL 177

Query: 176 KLGTPL----VYGIDELIQSVADPKLKLTRPIRTFQGQLRLG-DVNASDLGIPS------ 224
           KL   +    +Y ++EL+  +  P   + +P+R F G+LRLG D+ ++    PS      
Sbjct: 178 KLVEAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADILSTQTSNPSGSMQDE 237

Query: 225 --LCINLEGVPGTKSVSSISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASPKK 282
             LCI +E  P TK+VS ++RK   +   S+ +  Y  VKS+IEY+I ++    + S   
Sbjct: 238 NCLCIKVEAFPATKAVSGLNRKTAVEVEDSQKKERYVGVKSIIEYEIHNEGNKKNVS--- 294

Query: 283 ETTRKDDDGDSGNNTGPRMINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLDIRG 342
                 +D  SG++  P  + +SKD + KAYRYGADYV LP  L ++      PGLD+RG
Sbjct: 295 ------EDDQSGSSYIP--VTISKDSVTKAYRYGADYVVLPSVLVDQTVYESFPGLDLRG 346

Query: 343 FMDIDKLPRHYLCSESMYLVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFGNEV 402
           F++ + LPR++L SES ++  D++ G + D + F  LVD +++ +++ +AR+V K  +EV
Sbjct: 347 FLNREALPRYFLTSESSFITADTRLGCQSDLMAFSALVDVMLENRKIAVARYVSKKDSEV 406

Query: 403 QMCSLFPVRVH----DKDXXXXXXXXXXXXPMSEDERNSAFPKMCESTE-----LEPE-- 451
            MC+L PV +     + +            P +EDER + FPK+ + T      L+ E  
Sbjct: 407 NMCALCPVLIEHSNINSEKKFVKSLTLCRLPFAEDERVTDFPKLLDRTTTSGVPLKKETD 466

Query: 452 ----DEAMGQFVDSMNLDNDAQDLPW--YESDQIQKYTDVALEQSSLPLPQREMFRATAR 505
               DE M QFVDSM+ D +  ++P   Y     +  TD  L   SL   Q E      +
Sbjct: 467 GHQIDELMEQFVDSMDTD-ELPEIPLGNYYQPIGEVTTDTTLPLPSLNKDQEE----NKK 521

Query: 506 NPSAIPAISLHRQQQVILECVHQKFIVGKRDQQDLNIPPMSKMILKKITP 555
           +P  IP + ++RQQQV+LE +HQ  I    D ++  IP +   +  KI+P
Sbjct: 522 DPLRIPTVFVYRQQQVLLEWIHQLMI---NDSREFEIPELPDSLKNKISP 568

>ABL030W [562] [Homologous to ScYMR106C (YKU80) - SH]
           complement(341669..343477) [1809 bp, 602 aa]
          Length = 602

 Score =  270 bits (690), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 196/600 (32%), Positives = 300/600 (50%), Gaps = 69/600 (11%)

Query: 3   ELTCFVVDVGSLSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPVNNM 62
           E T F++D  +   +   K   Y+EY L +K Q  RKTDY  + L N +   E  P N  
Sbjct: 4   ECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYTHVVLANCAM--EKNPNNVK 61

Query: 63  AMLPVL-PRAPISISDV-----RSWLGQWYDERNNTTGNGEXXXXXMLFNGLLISVLKLK 116
            M  V  P API++S V     R    +  D  +    N        +F  LL   +++ 
Sbjct: 62  NMFEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSN--------VFEALLAIGMQVN 113

Query: 117 EFVGKRKM-KVKIVVFSSQDLQNVTDEELSTFADQCPFDLVIADCNDK--QGHQESKHGN 173
           +   KRKM K  +VV    D  NV  E+L          L++  C ++      ++K G 
Sbjct: 114 DKFNKRKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFPDNFSKTKWGQ 173

Query: 174 WLKL--GTPLVYGIDELIQSVADPKLKLTRPIRTFQGQLRLG----DVNASDLGIPSLCI 227
            L L  G+ + + + E++ ++     +  +P+R F GQLRLG    ++         LCI
Sbjct: 174 LLALKDGSRM-FTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAGCQQDPHCLCI 232

Query: 228 NLEGVPGTKSVSSISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASPKKETTRK 287
           N+EG P TK+V S+SRK ++K  + +G+  Y  ++SVIEY+I +        P +E    
Sbjct: 233 NVEGYPATKAVVSMSRKQVQK--TEDGK--YLPLQSVIEYEIHE--------PTEE---- 276

Query: 288 DDDGDSGNNTGPRMINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLDIRGFMDID 347
                  +N    ++ V K+ + KAYRYGADYV LP  L+ ER  +  PGLDIRGF+D  
Sbjct: 277 -------DNEEYHVVPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTG 329

Query: 348 KLPRHYLCSESMYLVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFGNEVQMCSL 407
           K+ RH+LCSES+Y++ DS+ G+  D++ F  LVD++I  ++  IAR+V K  +EVQMC L
Sbjct: 330 KVLRHHLCSESVYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLL 389

Query: 408 FPVRVH---------DKDXXXXXXXXXXXXPMSEDERNSAFPKMCESTELEPE----DEA 454
            P+ V          D              P +EDER+S FP + +    EP     D  
Sbjct: 390 CPLLVEPSTKKRPADDDAAEAKRALVLCRLPFAEDERSSDFPPLVKQ---EPADVMLDTT 446

Query: 455 MGQFVDSMNLDNDAQDLPWYESDQIQKYTDVALEQSSLPLPQREMFRATARNPSAIPAIS 514
           M  F+DSM++D  A    W  S  ++ + D  ++ S+LPLP            + IPA++
Sbjct: 447 MAAFIDSMDMDAAAPPASWCSSSNVRSF-DSFMKDSTLPLPDDPSLAEPCSAAACIPAVA 505

Query: 515 LHRQQQVILECVHQKFIVGKRDQQDLNIPPMSKMILKKITPKYNADVS-LSNRIKEQFNV 573
           LH Q+ V+LE   Q+FI+  R     ++  +   +  K++P   A+ S L+ RIK+   V
Sbjct: 506 LHHQKHVLLEYFRQRFIL--RLSGGFSVADLRDSLRSKVSPWATAETSELAARIKDTCAV 563

>Kwal_26.7624
          Length = 602

 Score =  259 bits (663), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 185/561 (32%), Positives = 284/561 (50%), Gaps = 64/561 (11%)

Query: 2   SELTCFVVDVGS--LSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPV 59
           SE T F++DV    +      +A  Y+EY L  K + QRKTD+V   L N   +  S   
Sbjct: 3   SEATTFIIDVSPSMIELGYAEQASAYLEYTLFLKSKKQRKTDWVNCYLANCPLTRNSYET 62

Query: 60  NNM-AMLPVLPRAPISISDVRSWLGQWYDERNNTTGNGEXXXXXMLFNGLLISVLKLKEF 118
           +N+  ++P    APIS   V   L +       +  + E      +   LL++ + +++ 
Sbjct: 63  DNVFELMPFT--APISADRVIETLRELQSVSQKSIASKERINT--MIQCLLVTSMNMRDE 118

Query: 119 VGKRKMKVKIVVFSSQDLQNVTDEELSTFADQ----CPFDLVIADCNDKQGHQESKHGNW 174
             KRK++ +I+VF+  DL  +   E      +    C   L++  C  K+   E      
Sbjct: 119 FKKRKIRKQIMVFT-DDLNGLDLTEEELTTLEQELGC--SLILVKCGPKKDSSEDMKLTI 175

Query: 175 LKLGTPLVYG-----IDELIQSVADPKLKLTRPIRTFQGQLRLG----DVNASDLGIPSL 225
            +    ++ G     + EL++ ++  +  + +PIR FQ  LRLG         +    SL
Sbjct: 176 WEKCIQVIPGSRQTTMTELLKEISSHRPAVVKPIRIFQANLRLGAQIFQEEGQETNYDSL 235

Query: 226 CINLEGVPGTKSVSSISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASPKKETT 285
            + +EG P TK+VSS++R+V+ K G  E    Y  VKS+IEY                + 
Sbjct: 236 DVKVEGYPATKAVSSLNRRVVAKIGEQE----YEQVKSIIEY----------------SA 275

Query: 286 RKDDDGDSGNNTGPRMINVSKDFIKKAYRYGADYVDLPMPLDEERKLSEKPGLDIRGFMD 345
            ++DD DS         +VSKDF+ KAYRYG+DYV LP  ++ ER     PGLD+RGF+D
Sbjct: 276 LEEDDSDSAEAA-----SVSKDFVTKAYRYGSDYVVLPQTIESERIYKTTPGLDLRGFLD 330

Query: 346 IDKLPRHYLCSESMYLVPDSKNGSKGDFLGFVTLVDSLIKMKRLIIARFVPKFGNEVQMC 405
            + +PRHYL SES ++V  +K+GS+ DFL F  LVDS+IK+ +  +AR+V K  +EVQMC
Sbjct: 331 KEDIPRHYLNSESTFIVASTKDGSRADFLAFAALVDSMIKLNKFAVARYVQKTNSEVQMC 390

Query: 406 SLFPVRVHDK------DXXXXXXXXXXXXPMSEDERNSAFPKMCESTELEPE------DE 453
            L P+ V  K                   P +EDER S +PK+  S+ + PE      D 
Sbjct: 391 VLCPLLVKKKRRELEDSEPYYRALVLNRLPFAEDERVSDYPKLSRSSGM-PEAKIVETDA 449

Query: 454 AMGQFVDSMNLDNDAQDLPWYESDQIQKYTDVALEQSSLPLPQREMFRATAR-NPSAIPA 512
            M  F+DSM+L     D  W  + + +   D A    SLPLP  +  R   + +P  +PA
Sbjct: 450 LMDDFIDSMDLGGGG-DSSWCYTSRYRP-IDSATTDPSLPLPASDSPRDDEKPDPMQLPA 507

Query: 513 ISLHRQQQVILECVHQKFIVG 533
           I ++RQQQ+++E +HQ+ ++G
Sbjct: 508 IGVYRQQQLLVEYMHQRVVMG 528

>CAGL0K03443g complement(316368..318215) similar to sp|Q04437
           Saccharomyces cerevisiae YMR106c, start by similarity
          Length = 615

 Score =  218 bits (555), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 175/602 (29%), Positives = 299/602 (49%), Gaps = 79/602 (13%)

Query: 1   MSELTCFVVDVGSLSGDQWLKAFTYVEYVLLNKVQSQRKTDYVQLNLVNVSSSDESLPVN 60
           MSE T  ++DV  +      K   Y+EY+LL+K +  RKTDYV   LVN + +  S  V 
Sbjct: 1   MSEATSVLIDV-DVEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAYLVNHTETQNSQDVP 59

Query: 61  NMAMLPVLPRAPISISDVRSWLGQWYDERNNTTGNGEXXXXXMLFNGLLISVLKLKEFVG 120
           ++  L     AP +   + + L Q    R    G+        +   LL++ +  +++ G
Sbjct: 60  HVVRLCDF-LAPTTEGAI-ALLRQLALVRREYRGDN-------ILQALLLASIDGRDYFG 110

Query: 121 KRKMKVKIVVFSSQDLQ-NVTDEELSTFADQCPFDLVIADCNDKQGHQESKHGNWLKL-- 177
           KRK+  ++++F+ +  + +++ EEL T  ++    +++ DC+    HQ ++   W  L  
Sbjct: 111 KRKVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCS-THPHQNAQGSQWDALVR 169

Query: 178 --GTPLVYGIDELIQSVADPKLKLTRPIRTFQGQLRLG---------------DVNASD- 219
                + + IDEL+  +     K+ +P+  F GQLRLG               +  A+D 
Sbjct: 170 TVKGSMSFHIDELLLRITQTVPKVVKPVTVFSGQLRLGASLENIVDLEPHRRDEAAAADN 229

Query: 220 -------LGIPS---------LCINLEGVPGTKSVSSISRKVMRKEGSSEGQPTYRAVKS 263
                   G  +         LCI ++G P TK   S+ +K + K+ S   +P +  VKS
Sbjct: 230 PKKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDAS---KPGFVPVKS 286

Query: 264 VIEYQIEDQSASTSASPKKETTRKDDDGDSGNNTGPRMINVSKDFIKKAYRYGADYVDLP 323
           VI+Y++ D         K E            +  P  I V+++ I KAYRYG DYV LP
Sbjct: 287 VIDYELRDNEVEGEGKGKGEG-----------DAPP--ITVARESITKAYRYGTDYVVLP 333

Query: 324 MPLDEERKLSEKPGLDIRGFMDIDKLPRHYLCSESMYLVPDSKNGSKGDFLGFVTLVDSL 383
             L+++       GLDIRGFM++  + RH+L SES+++     + S  D + F  L+D++
Sbjct: 334 SSLEDQLVYQTYAGLDIRGFMNMSDMHRHFLTSESVFV---VSSSSSADQITFSALIDAM 390

Query: 384 IKMKRLIIARFVPKFGNEVQMCSLFPVRVHDKDXXXXXXXXXXXXPMSEDERNSAFPKMC 443
           I++ ++ I R+VPK  ++VQMC L+P+ +  ++            P +EDER + FP++ 
Sbjct: 391 IQIDKIAIGRYVPKNNSDVQMCMLYPMILEKENGTHVRTLILNRLPFTEDERIAIFPRLT 450

Query: 444 ESTELEPE-----DEAMGQFVDSMNLDNDAQDLPWYESDQIQKYTDVALEQSSLPLPQRE 498
              + + E     D+ M  FV+S ++D    DLP  E  +  ++ + ++  ++L LP + 
Sbjct: 451 REDDKKSEKDETIDQLMAGFVESRSMD----DLPRVEEKKYYEFYEDSVRDTTLVLPMKS 506

Query: 499 MFRATARNPSAIPAISLHRQQQVILECVHQKFIVGKRDQQDLNIPPMSKMILKKITPKYN 558
                 R+P  +PA+ LHRQ QV+LE +HQ  ++ K ++ D   P +   +  KITP   
Sbjct: 507 KDETRERDPLMVPAMGLHRQLQVMLEYLHQ-VVINKSEKFD--PPELQDHLKAKITPHIV 563

Query: 559 AD 560
           +D
Sbjct: 564 SD 565

>YGR112W (SHY1) [2071] chr7 (717360..718529) Mitochondrial protein
           required for respiration, involved in assembly of the
           cytochrome c oxidase complex [1170 bp, 389 aa]
          Length = 389

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 349 LPRHYLCSESMYLVPDSKNGSKGDFL 374
           L  H+L +E M++ P  KNG KG FL
Sbjct: 135 LTGHFLHNEEMFVGPRKKNGEKGYFL 160

>KLLA0A09427g complement(821244..824279) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 1011

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 221 GIPSLCINLEGVPGTKSVSSISRKVMRKEGSSEGQPTYRAVKSVIEYQIEDQSASTSASP 280
           GI  + +   GVP  K +++I  +  R++G  +        + ++  QI        +SP
Sbjct: 69  GIKPVFVFDGGVPVLK-LNTIRERKERRQGKRDTANA--TARRLLARQIHQSQTDKESSP 125

Query: 281 KKETTRKDDDGDSGNNTG 298
           KK+    D++G +G+ TG
Sbjct: 126 KKKKQSPDENGQTGSETG 143

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,810,627
Number of extensions: 892794
Number of successful extensions: 2818
Number of sequences better than 10.0: 17
Number of HSP's gapped: 2856
Number of HSP's successfully gapped: 18
Length of query: 600
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 493
Effective length of database: 12,891,983
Effective search space: 6355747619
Effective search space used: 6355747619
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)