Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B09592g33332814930.0
Kwal_27.126133112636599e-85
ADL330W2761976384e-82
Sklu_2286.33383036011e-75
CAGL0K12254g3352725296e-65
YBR105C (VID24)3623025248e-64
Scas_718.43562024322e-50
Scas_667.273321972821e-28
YGR066C2921962502e-24
Kwal_33.1324175264720.64
Kwal_27.1059571940645.1
YNL221C (POP1)87540645.1
Kwal_34.1609239558636.2
Kwal_47.1808974570628.8
Sklu_2442.1743936629.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B09592g
         (328 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B09592g 834414..835415 weakly similar to sp|P38263 Saccharo...   579   0.0  
Kwal_27.12613                                                         258   9e-85
ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH] complement...   250   4e-82
Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement        236   1e-75
CAGL0K12254g complement(1196376..1197383) similar to sp|P38263 S...   208   6e-65
YBR105C (VID24) [294] chr2 complement(450838..451926) Protein re...   206   8e-64
Scas_718.4                                                            171   2e-50
Scas_667.27                                                           113   1e-28
YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein...   100   2e-24
Kwal_33.13241                                                          32   0.64 
Kwal_27.10595                                                          29   5.1  
YNL221C (POP1) [4383] chr14 complement(231067..233694) Protein c...    29   5.1  
Kwal_34.16092                                                          29   6.2  
Kwal_47.18089                                                          28   8.8  
Sklu_2442.17 YNL011C, Contig c2442 30041-31360                         28   9.5  

>KLLA0B09592g 834414..835415 weakly similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 333

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/328 (86%), Positives = 285/328 (86%)

Query: 1   MINEDTRSHSSGLETQLAKASSSSPYKGXXXXXXXXXXXXXXXXXXSPIAFPAPLTPFFH 60
           MINEDTRSHSSGLETQLAKASSSSPYKG                  SPIAFPAPLTPFFH
Sbjct: 1   MINEDTRSHSSGLETQLAKASSSSPYKGQGQTQEQQQQQQQQQKQQSPIAFPAPLTPFFH 60

Query: 61  RNPYFRNTSLHRTGSHDSINSIRRSHENFQDSEDYDIQDXXXXXXXXXXXXXXQTPKNHE 120
           RNPYFRNTSLHRTGSHDSINSIRRSHENFQDSEDYDIQD              QTPKNHE
Sbjct: 61  RNPYFRNTSLHRTGSHDSINSIRRSHENFQDSEDYDIQDSCSPSLNSPPRSRPQTPKNHE 120

Query: 121 RTHWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGLTVQNP 180
           RTHWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGLTVQNP
Sbjct: 121 RTHWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGLTVQNP 180

Query: 181 EITTFFESITVTDSLGFLSKDIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDPKYPSK 240
           EITTFFESITVTDSLGFLSKDIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDPKYPSK
Sbjct: 181 EITTFFESITVTDSLGFLSKDIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDPKYPSK 240

Query: 241 NILQSIIDGTYSHTDYLNQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQLLGNI 300
           NILQSIIDGTYSHTDYLNQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQLLGNI
Sbjct: 241 NILQSIIDGTYSHTDYLNQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQLLGNI 300

Query: 301 LGFYYHEHAERFXXXXXXXXXXXSIGDC 328
           LGFYYHEHAERF           SIGDC
Sbjct: 301 LGFYYHEHAERFQQLELQPLQEPSIGDC 328

>Kwal_27.12613
          Length = 311

 Score =  258 bits (659), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 175/263 (66%), Gaps = 4/263 (1%)

Query: 70  LHRTGSHDSINSIRR----SHENFQDSEDYDIQDXXXXXXXXXXXXXXQTPKNHERTHWL 125
           L+R  S DS++S+R     S  +   +  Y  +D              +   +   T++L
Sbjct: 44  LYRCSSVDSVDSLRHTFTPSGVSSAATRKYIAEDRSRYESRARARRAARRAPHTCCTNFL 103

Query: 126 GARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGLTVQNPEITTF 185
             R +F GYQ+S YKK+QV +++Q+V+LP+   S+  +PH+TGFLSI+GLT Q+PEITTF
Sbjct: 104 RPRMQFSGYQISDYKKYQVTVSLQTVALPDAPGSSAMAPHVTGFLSIRGLTSQHPEITTF 163

Query: 186 FESITVTDSLGFLSKDIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDPKYPSKNILQS 245
           F+   VTD+LGFLS  +P +  ++KA+D+TDLEHWL+FP FKELC          N+L +
Sbjct: 164 FDGYAVTDNLGFLSSALPPELDAFKATDKTDLEHWLSFPCFKELCRPESACDEGTNVLGA 223

Query: 246 IIDGTYSHTDYLNQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQLLGNILGFYY 305
           +++G+YSH DYL  RF+YMRW EKFLVPDA+++S++GASYDGYYYIVHDQ+ G+ILGFYY
Sbjct: 224 VLEGSYSHEDYLQNRFIYMRWKEKFLVPDAEIDSVEGASYDGYYYIVHDQVTGHILGFYY 283

Query: 306 HEHAERFXXXXXXXXXXXSIGDC 328
           H+ AE+F             GDC
Sbjct: 284 HQDAEKFQQLELTPLQDPCAGDC 306

>ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH]
           complement(121954..122784) [831 bp, 276 aa]
          Length = 276

 Score =  250 bits (638), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 147/197 (74%), Gaps = 5/197 (2%)

Query: 116 PKNHERTHWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGL 175
           P+    T+WL     F GYQ+SGYKK+QV + +Q+V+LP    +   +PH+TGFL+I+GL
Sbjct: 64  PRATTTTNWLRPLMAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGL 123

Query: 176 TVQNPEITTFFESITVTDSLGFLSKDIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDP 235
           T Q+PEITTFFES  V D++GFLS  +P + A YK+SD+ DLEHWLNFPSFKELCM    
Sbjct: 124 TNQHPEITTFFESFAVNDTVGFLSSSMPPELAEYKSSDRVDLEHWLNFPSFKELCMAG-- 181

Query: 236 KYPSKNILQSIIDGTYSHTDYLNQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQ 295
                  +  I+DG Y+H DYL +RF++MRW EKFLVPD ++ +++GASYDGYYYIVHDQ
Sbjct: 182 ---GGTTVADIMDGHYTHRDYLARRFVFMRWKEKFLVPDEEVGAVEGASYDGYYYIVHDQ 238

Query: 296 LLGNILGFYYHEHAERF 312
           + G++LGFYYH+ AE+F
Sbjct: 239 VTGSVLGFYYHKDAEKF 255

>Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement
          Length = 338

 Score =  236 bits (601), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 132/303 (43%), Positives = 179/303 (59%), Gaps = 47/303 (15%)

Query: 52  PAPLTPFFHRNPYF-----RNTSLHRTGSHDSINSIR--RSHENFQDSEDYDIQDXXXXX 104
           P PLTP                SL++  S DS+ S+   +  ++    + Y ++D     
Sbjct: 20  PRPLTPPLQLTNKLIQQCREEESLYKCSSRDSLASLNSLQHQDSIASPKKYILEDNSAYN 79

Query: 105 XXXXXXXXXQTPKNHERTHWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSP 164
                     T     RT++L  R +F GYQ+SGYKK+QV++ +Q+V LP    +   +P
Sbjct: 80  NVSNDTRVDATT----RTNFLKPRMKFTGYQVSGYKKYQVIVDLQTVDLPTTPATTT-TP 134

Query: 165 HLTGFLSIKGLTVQNPEITTFFESITVTDSLGFLSKDIPIDYASYKASDQTDLEHWLNFP 224
           HLTGFL+I+GLT Q+PEITTFFES TV D++GFLS  IP +  +YK +D  DLEHWLNFP
Sbjct: 135 HLTGFLTIRGLTNQHPEITTFFESFTVMDTIGFLSSCIPEELNAYKGNDHVDLEHWLNFP 194

Query: 225 SFKELCMQ---NDPKYPSK--------------------------------NILQSIIDG 249
            FKELCM+   ++ K+ S                                 NIL  I++G
Sbjct: 195 CFKELCMRRPASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQILNG 254

Query: 250 TYSHTDYLNQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQLLGNILGFYYHEHA 309
            Y+H +YL  RF++MRW EKFLVPDA+++S++GASYDGYYYIVHDQ+ GNILGFYYH+ A
Sbjct: 255 QYTHENYLCNRFIFMRWKEKFLVPDAEIDSVEGASYDGYYYIVHDQVTGNILGFYYHKDA 314

Query: 310 ERF 312
           E+F
Sbjct: 315 EKF 317

>CAGL0K12254g complement(1196376..1197383) similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 335

 Score =  208 bits (529), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 119/272 (43%), Positives = 164/272 (60%), Gaps = 29/272 (10%)

Query: 70  LHRTGSHDSINSI-----RRSHENF--QDSEDYDIQDXXXXXXXXXXXXXXQTPKNHERT 122
           L++  S DS+ S+     R S E+   +  + Y + D               T KN  +T
Sbjct: 40  LYKCHSKDSLPSLQHLIDRSSSESLPLKKKKKYIMNDRSSYTTVSVPRYVTPTHKNTTQT 99

Query: 123 HWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCS-PHLTGFLSIKGLTVQNPE 181
           ++L  R  F GYQLSGYK++QV +++++V LP     N  + PH+TG+L+IKGLT Q+PE
Sbjct: 100 NFLRPRLEFSGYQLSGYKRYQVNVSLKTVDLPTVESGNTTTTPHITGYLTIKGLTSQHPE 159

Query: 182 ITTFFESITVT-DSLGFLSKDIPID--YASYKASDQTDLEHWLNFPSFKELCM------- 231
           ITTFFE+  V  + LGFLS   P +  Y  YK+ DQTDLEHWLNFP+F+EL +       
Sbjct: 160 ITTFFEAYAVEHNELGFLSSQWPEENNYEPYKSDDQTDLEHWLNFPAFRELFIAQHANLV 219

Query: 232 ----QNDPKYPSK----NILQSIIDGTYSHTD---YLNQRFLYMRWNEKFLVPDADLESI 280
               +  P +  K    N L  +     +  +   YLN R+++MRW EKFLVPDA +E++
Sbjct: 220 KEDEEATPDFKKKRQSINTLAELFMENQAQNEGRNYLNDRYIFMRWKEKFLVPDAFVENV 279

Query: 281 DGASYDGYYYIVHDQLLGNILGFYYHEHAERF 312
           DGASYDG+YY+VHDQL G + GFYYH+ AERF
Sbjct: 280 DGASYDGFYYVVHDQLTGCMQGFYYHQDAERF 311

>YBR105C (VID24) [294] chr2 complement(450838..451926) Protein
           required for vacuolar import and degradation of Fbp1p
           (fructose-1,6-bisphosphatase) [1089 bp, 362 aa]
          Length = 362

 Score =  206 bits (524), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 176/302 (58%), Gaps = 41/302 (13%)

Query: 48  PIAFPAPLTPFFH---RNPYFRNTSLHRTGSHDSINSIRR-SHE-NFQDSEDYDIQDXXX 102
           PI F    T  FH   R+ Y +   L++  S DS++S+++ +H  N    + Y ++D   
Sbjct: 42  PITFNLTSTAPFHLHDRHRYLQEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSP 101

Query: 103 XXXXXXXXXXXQTPKNHER-THWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNC 161
                       +  NH   T++L  R +F GYQ+SGYK++QV + +++V LP   +   
Sbjct: 102 YSSENPVIVT--SSYNHTVCTNYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPK-KDCTS 158

Query: 162 CSPHLTGFLSIKGLTVQNPEITTFFESITVT-DSLGFLS---KDIPIDYASYKASDQTDL 217
            SPHL+GFLSI+GLT Q+PEI+T+FE+  V    LGFLS   KD P+    +KA+DQTDL
Sbjct: 159 LSPHLSGFLSIRGLTNQHPEISTYFEAYAVNHKELGFLSSSWKDEPV-LNEFKATDQTDL 217

Query: 218 EHWLNFPSFKELCM------------------------QNDPKYPSKNI--LQSIIDGTY 251
           EHW+NFPSF++L +                        Q  P  PS +   +  I     
Sbjct: 218 EHWINFPSFRQLFLMSQKNGLNSTDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEK 277

Query: 252 SHTDYLNQRFLYMRWNEKFLVPDADL-ESIDGASYDGYYYIVHDQLLGNILGFYYHEHAE 310
              +YLN+RF++M+W EKFLVPDA L E +DGASYDG+YYIVHDQ+ GNI GFYYH+ AE
Sbjct: 278 QFDNYLNERFIFMKWKEKFLVPDALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAE 337

Query: 311 RF 312
           +F
Sbjct: 338 KF 339

>Scas_718.4
          Length = 356

 Score =  171 bits (432), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 92/202 (45%), Positives = 130/202 (64%), Gaps = 16/202 (7%)

Query: 122 THWLGARKRFVGYQLSGYKKFQVMITIQSVSLPND-NESNCCSPHLTGFLSIKGLTVQNP 180
           T++L    +F G+Q+SGYKK+QV +TI++V+LP+   E+    PH+TG L+IKGLT Q P
Sbjct: 137 TNFLTPSMKFKGFQMSGYKKYQVTVTIKTVNLPSSTQETITTQPHMTGSLTIKGLTFQYP 196

Query: 181 EITTFFESITVTDSLGFLSK----DIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDPK 236
           +ITTFF+S  V ++  FLS     +        +++D+ DLEHWLNFP FK+L M +   
Sbjct: 197 QITTFFQSFAVNENFHFLSSHWDANTRAQLHDLQSNDRIDLEHWLNFPIFKQLFMAD--- 253

Query: 237 YPSKNILQSIIDGTYSHTDYLNQRFLYMRWNEKFLVPDAD------LESIDGASYDGYYY 290
              +      ID       YLN RF++MRW EKFL+ D +       + I+GAS+DG+YY
Sbjct: 254 VEGEETQDHEIDSYLKQ--YLNNRFIFMRWKEKFLIRDGEHIDDDDEDEINGASFDGFYY 311

Query: 291 IVHDQLLGNILGFYYHEHAERF 312
           IVHDQ+ G+I GFYYH+ AE+F
Sbjct: 312 IVHDQVDGSIHGFYYHKDAEKF 333

>Scas_667.27
          Length = 332

 Score =  113 bits (282), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 108/197 (54%), Gaps = 8/197 (4%)

Query: 122 THWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGLTVQNPE 181
           +H+L  +KRF G Q+ G K + + + +++++ P  N  N  +PHLTG L+I+G +    +
Sbjct: 116 SHYLKPKKRFHGVQVVGPKVYVIKVDLETINFPPFN-YNIFNPHLTGRLNIQGFSDTGED 174

Query: 182 ITTFFESITV-TDSLGFLS---KDIPIDYASYKASDQTDLEHWLNFPSFKELCMQNDPKY 237
           +TT+FE  ++  D LGFLS   +D P       A D  D+ HWL    F+ +  +     
Sbjct: 175 VTTYFEGYSIENDKLGFLSSNWEDHPC-LEDLTADDIVDIFHWLKLKPFRRILNKKPVNK 233

Query: 238 PSKNILQSIIDGTYSHTDYLNQ-RFLYMRWNEKFLVPDA-DLESIDGASYDGYYYIVHDQ 295
               +   ++    + T+Y N  R+++M+W E+F++  A D E + G +Y G+YYIVHD+
Sbjct: 234 RWSKLPLRVLKDIVNETEYQNDGRYVFMKWKERFVIDHAVDDEPVAGITYRGFYYIVHDK 293

Query: 296 LLGNILGFYYHEHAERF 312
             G I GFY+      F
Sbjct: 294 FTGEIEGFYHERGTAAF 310

>YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein of
           unknown function, has low similarity to a region of S.
           cerevisiae Vid24p, which is required for vacuolar import
           and degradation of fructose-1,6-bisphosphatase (S.
           cerevisiae Fbp1p) [879 bp, 292 aa]
          Length = 292

 Score =  100 bits (250), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 100/196 (51%), Gaps = 23/196 (11%)

Query: 130 RFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCSPHLTGFLSIKGLTVQNPEITTFFESI 189
           RF G Q S Y  + V + I +V+LP   +S    PH+TG  +IK LT    ++ T FE  
Sbjct: 84  RFGGSQSSKYTYYTVEVKIDTVNLPLYKDSRSLDPHVTGTFTIKNLTPVLDKVVTLFEGY 143

Query: 190 TVT-DSLGFLSKDIPIDYA--SYKASDQTDLEHWLNFPSFKELCMQNDPKYPSKNILQSI 246
            +  +     S   P +     Y A  ++D  HW  F  F      ++     +N     
Sbjct: 144 VINYNQFPLCSLHWPAEETLDPYMAQRESDCSHWKRFGHFG----SDNWSLTERNF---- 195

Query: 247 IDGTYSH--TDYLNQRFLYMRWNEKFLVPDADLESI--------DGASYDGYYYIVHDQL 296
             G Y+H   +++NQR++Y++W E+FL+ D + E++        +GAS++G+YY+  DQL
Sbjct: 196 --GQYNHESAEFMNQRYIYLKWKERFLLDDEEQENLMLDDNHHLEGASFEGFYYVCLDQL 253

Query: 297 LGNILGFYYHEHAERF 312
            G++ G+YYH   E F
Sbjct: 254 TGSVEGYYYHPACELF 269

>Kwal_33.13241
          Length = 752

 Score = 32.3 bits (72), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 214 QTDLEHWLNFPS----FKELCMQNDPKYPSKNILQSIIDGTYSHTDYLNQRFLYMRWNEK 269
           + +L  ++NF      F  L    D  +P+K+ +++++D  + HTD LN +   +    +
Sbjct: 515 ELELALFINFLKKKIHFDSLITNRDQHFPNKDFIRALVDSIHGHTDELNSKLYDVIELTQ 574

Query: 270 FLVP 273
            ++P
Sbjct: 575 LIIP 578

>Kwal_27.10595
          Length = 719

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 60  HRNPYFRNTSLHRTGSHDSINSIRRSHENFQDSEDYDIQD 99
            R PYFR T  +     + +N + R   NF+   D D QD
Sbjct: 120 RRTPYFRKTDKYALEKANPLNHLSRHQSNFRVEYDMDEQD 159

>YNL221C (POP1) [4383] chr14 complement(231067..233694) Protein
           component of both RNase P and RNase MRP, involved in
           both tRNA maturation (RNase P) and in 5.8S rRNA
           processing (RNase MRP) [2628 bp, 875 aa]
          Length = 875

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 17/40 (42%)

Query: 184 TFFESITVTDSLGFLSKDIPIDYASYKASDQTDLEHWLNF 223
           TFF    +  S   L +  P D A      + DLEHWL  
Sbjct: 756 TFFPRCIIAVSCTLLERGHPKDNARIYQVPEKDLEHWLQL 795

>Kwal_34.16092
          Length = 395

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 6/58 (10%)

Query: 145 MITIQSVSLPNDNES-----NCCSPHLTGFLSIKGLTVQNPEITTFFESITVTDSLGF 197
           M+ + ++  PN N S      C SPHL    SI G  +    +    E  T  DS GF
Sbjct: 130 MVAMANMGEPNSNSSQFFITTCSSPHLNNKHSIFGRVIHGKSVVRTIEH-TAVDSDGF 186

>Kwal_47.18089
          Length = 745

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 15/70 (21%)

Query: 226 FKELCMQNDPKYPSKNILQSIIDGTYSHTDYL--------------NQRFLYMRWNEKFL 271
           F + C QN P YPS N L +  D  YS TD                N+R + M  N ++ 
Sbjct: 606 FMDSC-QNPPAYPSLNDLSAPEDTLYSLTDCFQVFSSIVDELWRPENERMIQMLRNSRYY 664

Query: 272 VPDADLESID 281
           V    LE I+
Sbjct: 665 VIMIGLERIN 674

>Sklu_2442.17 YNL011C, Contig c2442 30041-31360
          Length = 439

 Score = 28.5 bits (62), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 51  FPAPLTPFFHRNPYFRNTSLHRTGSHDSINSIRRSH 86
            PAP+   F+ NPY     +H +G+  +++ I+ SH
Sbjct: 272 LPAPIRKIFYINPY--GEEIHPSGNARAVSKIKSSH 305

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,467,515
Number of extensions: 440026
Number of successful extensions: 1060
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1054
Number of HSP's successfully gapped: 23
Length of query: 328
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 226
Effective length of database: 13,065,073
Effective search space: 2952706498
Effective search space used: 2952706498
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)