Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08525g32632117000.0
Sklu_1926.33553423407e-37
ADL325C3223213151e-33
Kwal_27.125963493333056e-32
Scas_667.213593482794e-28
CAGL0D01628g3603442638e-26
YPR057W (BRR1)3413402513e-24
KLLA0E05610g57778720.52
CAGL0J04576g55162681.7
Scas_721.9463137654.0
KLLA0F01210g49895644.5
Kwal_56.2283337158644.6
Scas_645.1539326619.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08525g
         (321 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08525g complement(754935..755915) weakly similar to sgd|S0...   659   0.0  
Sklu_1926.3 YPR057W, Contig c1926 1476-2543 reverse complement        135   7e-37
ADL325C [1416] [Homologous to ScYPR057W (BRR1) - SH] (126156..12...   125   1e-33
Kwal_27.12596                                                         122   6e-32
Scas_667.21                                                           112   4e-28
CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99...   105   8e-26
YPR057W (BRR1) [5487] chr16 (672466..673491) Protein involved in...   101   3e-24
KLLA0E05610g complement(503859..505592) similar to sp|P27614 Sac...    32   0.52 
CAGL0J04576g complement(433096..434751) similar to sp|P32461 Sac...    31   1.7  
Scas_721.9                                                             30   4.0  
KLLA0F01210g 112835..114331 similar to sp|P37292 Saccharomyces c...    29   4.5  
Kwal_56.22833                                                          29   4.6  
Scas_645.15                                                            28   9.8  

>KLLA0B08525g complement(754935..755915) weakly similar to
           sgd|S0006261 Saccharomyces cerevisiae YPR057w BRR1
           involved in snRNP biogenesis, start by similarity
          Length = 326

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/321 (100%), Positives = 321/321 (100%)

Query: 1   MVGVDSNQGPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSH 60
           MVGVDSNQGPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSH
Sbjct: 1   MVGVDSNQGPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSH 60

Query: 61  NVVETGLVADTSDLLNARSILEDSEAINEWINEIRKEMEPLEESPSDSIYTDDMLDLLVS 120
           NVVETGLVADTSDLLNARSILEDSEAINEWINEIRKEMEPLEESPSDSIYTDDMLDLLVS
Sbjct: 61  NVVETGLVADTSDLLNARSILEDSEAINEWINEIRKEMEPLEESPSDSIYTDDMLDLLVS 120

Query: 121 EIKKYLDQHPEEINDPVRRVTRSVLPIANPEYDISTETVQSMVAKLRNKRFSDVSFLKRY 180
           EIKKYLDQHPEEINDPVRRVTRSVLPIANPEYDISTETVQSMVAKLRNKRFSDVSFLKRY
Sbjct: 121 EIKKYLDQHPEEINDPVRRVTRSVLPIANPEYDISTETVQSMVAKLRNKRFSDVSFLKRY 180

Query: 181 INRPMPIPTNFRQWFGHIKHNEPTRQFMLRLEFDDLMKILGFMIQWINSITKNKPDSKQL 240
           INRPMPIPTNFRQWFGHIKHNEPTRQFMLRLEFDDLMKILGFMIQWINSITKNKPDSKQL
Sbjct: 181 INRPMPIPTNFRQWFGHIKHNEPTRQFMLRLEFDDLMKILGFMIQWINSITKNKPDSKQL 240

Query: 241 QQWLLYIWIFMPNELLSPQISQLRDLGRKCQLSLIAASNSKITSLTMPTEIRDIPFPNQR 300
           QQWLLYIWIFMPNELLSPQISQLRDLGRKCQLSLIAASNSKITSLTMPTEIRDIPFPNQR
Sbjct: 241 QQWLLYIWIFMPNELLSPQISQLRDLGRKCQLSLIAASNSKITSLTMPTEIRDIPFPNQR 300

Query: 301 DQLNAIEITLAVIAHRFGQRD 321
           DQLNAIEITLAVIAHRFGQRD
Sbjct: 301 DQLNAIEITLAVIAHRFGQRD 321

>Sklu_1926.3 YPR057W, Contig c1926 1476-2543 reverse complement
          Length = 355

 Score =  135 bits (340), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 104/342 (30%), Positives = 168/342 (49%), Gaps = 40/342 (11%)

Query: 12  DPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYST-----SRTEQNSHNVVETG 66
           DPVFGQ  AFALN   V+P+ + YL  VR EAL  S +  T      +T   SHN    G
Sbjct: 18  DPVFGQSRAFALNGTLVNPDAVSYLNSVRKEALRTSGIDVTRSVDVKKTRAQSHNTDFCG 77

Query: 67  LVADTSDLLNARSILEDSEAINE---WINEIRKEM---------EPLEESPSDSIYTDDM 114
                  +LN R +++ +   N+   W  E+R+ +         E  E +   S Y  + 
Sbjct: 78  ----EEPILN-RELIKCNRKSNQLLQWFLELREHLVEQRLEDSREQQENAQEFSGYDIET 132

Query: 115 LDLLVSEIKKYL---DQHPEEINDPVRRVTRSVLPIANPE-YDISTETVQSMVAKLRNKR 170
           L+LLV   K YL   D   + + + +  + +    I   +   I     + ++ +LR+K 
Sbjct: 133 LNLLVHYFKNYLRGRDNKDDTVVELLLEILKDFPSIKEDQSLAIDEAWAEKLLDQLRSKT 192

Query: 171 FSDVSFLKRYINRP----MPIPTNFRQWFGHIKHNEPTRQFMLRLEFDDLMKILGFMIQW 226
            ++V  LK  IN+P    +  P N + W  HI  NEP+ +   RL  D  +K++G+M QW
Sbjct: 193 VNNVEELKEAINKPAKASVEFPKNAKGWHSHINKNEPSSKVFTRLTLDQKLKLIGYMTQW 252

Query: 227 INSITKNKPDSKQLQQWLLYIWIFMPNELLSPQISQLRDLGRKC-QLSLIAA-SNSKITS 284
           +N    ++ +++Q+ QW LY  + +P  L +P IS LR+LG+K  QL L +   N  +  
Sbjct: 253 LNHTVGDQSNARQISQWCLYTLLSIPEYLPAPHISILRELGKKAKQLKLRSCQENIALLP 312

Query: 285 LTMPTEI-----RDIPFPNQRDQLNAIEITLAVIAHRFGQRD 321
           LT+ +E+      D   P +    +  ++ L V++  +GQRD
Sbjct: 313 LTVSSEMIGKYTTDSTVPQES---SITDLVLVVVSKIYGQRD 351

>ADL325C [1416] [Homologous to ScYPR057W (BRR1) - SH]
           (126156..127124) [969 bp, 322 aa]
          Length = 322

 Score =  125 bits (315), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 166/321 (51%), Gaps = 16/321 (4%)

Query: 9   GPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNS---PLYSTSRTEQNSHNVVET 65
           GP+DPVFGQ   F  +   V+P V++YL  VR+EAL      P  S  R  +   +  + 
Sbjct: 6   GPVDPVFGQCQVFDCSAAEVNPEVVKYLAHVRDEALHTVGVVPSASNLRKRKIEISYDDE 65

Query: 66  GLVADTSDLLNARSILEDSEAINEWINEIRKEMEPLEESPSDSIYTDDMLDLLVSEIKKY 125
            +V   S+   A  +  D + +  W ++++++   L E  +   Y ++ L+ L+  I+ Y
Sbjct: 66  EVVKRPSEGEKAIELPFDMDEVISWFDQVKEDA--LSEREAFEGYDEETLNTLLVGIRDY 123

Query: 126 LDQHP--EEINDPVRRVTRSVLPIA-NPEYDISTETVQSMVAKLRNKRFSDVSFLKRYIN 182
           + +    +E  + + ++   V P+  N   ++  +    +VA+L  ++F+ +  LK  +N
Sbjct: 124 ISRMSSRDESTNNLIKLLEGVQPVVTNEALELDEKWAAKLVARLGRRKFTTLDNLKLRLN 183

Query: 183 RPMPIPTNFRQWFGHIKHNEPTRQFMLRLEFDDLMKILGFMIQWINSITKNKPDSK-QLQ 241
             +PIPT  + W  HI  NEP+ +F  R+    L  +L ++    N +   + DS     
Sbjct: 184 TQLPIPTRAKAWKIHIPINEPSHEFFHRMNSTQLFDLLRYLTD--NIVEHYQTDSATDYG 241

Query: 242 QWLLYIWIFMPNELLSPQISQLRDLGRKCQLSLIAASNSKITSLTMPTEIRDI-PFPNQR 300
           QWL+Y+ + +P +L + +IS++R L +K +  +I     K+  L +P+EI D+ P P   
Sbjct: 242 QWLVYLLLHLPRQLTANEISEVRGLSKKVRALIIDHEILKLPML-LPSEIEDVSPIPR-- 298

Query: 301 DQLNAIEITLAVIAHRFGQRD 321
             +N + + LAV+A  +GQRD
Sbjct: 299 -GVNPLHLALAVVAVIYGQRD 318

>Kwal_27.12596
          Length = 349

 Score =  122 bits (305), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 172/333 (51%), Gaps = 37/333 (11%)

Query: 11  LDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSHNVVETGLVAD 70
           +DPVFGQ  AFAL  + V+P V +YL  VR +AL+      ++R   ++        V  
Sbjct: 23  IDPVFGQGRAFALEGDLVNPEVQQYLKTVRTQALTTLAARPSNRGRHDTK-------VNR 75

Query: 71  TSDLLNARSIL--------EDSEAINEWINEIRKEMEPLEESPSDSIYTDDMLDLLVSEI 122
           TSDL +   ++            +  +W NE+++  +    +P+   Y   ML+LLV   
Sbjct: 76  TSDLYDEEPLIPPELSRFNRYKSSWLKWFNELKRSKDA-HTAPAPG-YDSAMLNLLVFYF 133

Query: 123 KKYLDQHPEEINDPVRRVTR--SVLPIANPEYDIST-----ETVQSMVAKLRNKRFSDVS 175
           K+YL +     ++    + R  ++L   N E   ST     E  + ++ +L++ +    S
Sbjct: 134 KQYLQELKAAASESDADLDRILTILQDHNVEKQDSTLEIDEEWAKGILQQLKSSKSQVSS 193

Query: 176 F--LKRYINRPMPIPTNFRQWFGHIKHNEPTRQFMLRLEFDDLMKILGFMIQWINSITKN 233
              LK +I++P P+P NF  W+  +   EPT     R+  +   K+  ++ QW+  ++K+
Sbjct: 194 VSDLKDFISKPAPLPKNFNGWYYCVTKTEPTCALFERMSPELTFKLASYLNQWLGDVSKD 253

Query: 234 KPDSKQLQQWLLYIWIFMPNELLSPQISQLRDLGRKCQLSLIAASNS--KITSLTMPTEI 291
           K  S+ +  W+LY ++F+ ++L + ++S LRDLG+K +   +  S+S   +  +  P+++
Sbjct: 254 KKASR-ITAWILYTFLFLGDQLPAQEVSVLRDLGKKARQMKLNCSDSADALPKIVQPSDM 312

Query: 292 ---RDIPFPNQRDQLNAIEITLAVIAHRFGQRD 321
              +D P P     L+AI++ L ++A ++GQRD
Sbjct: 313 SFYKDPPQP-----LSAIDLILVLVAFKYGQRD 340

>Scas_667.21
          Length = 359

 Score =  112 bits (279), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 91/348 (26%), Positives = 170/348 (48%), Gaps = 40/348 (11%)

Query: 6   SNQGPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSHNVVET 65
           + +  ++P+FGQ  AFA+ +  V P V+RYL DVR EAL  + +  + + ++ +  VV  
Sbjct: 11  TERQAVNPLFGQAPAFAVQNSLVDPAVVRYLQDVRKEALRTTVV--SIKPQKRARPVVTA 68

Query: 66  GLVADTSD---LLNARSILEDSEA------------INEWINEIRKEMEPLEESPSD-SI 109
            +  D  D    L AR    +S              +N+WI         ++E   + + 
Sbjct: 69  SMYDDDDDELPTLTARKKGRNSAYEFPDQLIYFDRNMNDWIKWFECTKNIVQEKAYEFTG 128

Query: 110 YTDDMLDLLVSEIKKYLDQHPEE----------INDPVRRVTRSVLPIANPEYDISTETV 159
           Y D+ L++L+ ++K+Y++   ++          I+D     T S    ++   +I     
Sbjct: 129 YDDNTLNILLCQLKQYMETKSKDEDKLSSLIGIISDECIETTDS----SDHSLEIDETWA 184

Query: 160 QSMVAKLRNKRFSDVSFLKRYI-NRPMPIPTNFRQWFGHIKHNEPTRQFMLRLEFDDLMK 218
           ++M  KL+++   ++S +K  +   PM  P  F+ W+ ++  N P     + +  D  + 
Sbjct: 185 ETMCEKLQSRAIKNISEIKDCVLETPME-PYGFKAWYKYLISNVPVHTCFVTMINDRNVW 243

Query: 219 IL--GFMIQWINSITKNKPDSKQLQQWLLYIWIFMPNELLSPQISQLRDLGRKCQLSL-- 274
           IL   F    +  I K   ++  L++WLL I I +P  + +   S LRDLG+KCQ+ +  
Sbjct: 244 ILIQYFQQGLLEEIYKRGKNASVLEEWLLEIMIHLPVNITAEYTSTLRDLGKKCQVLIKR 303

Query: 275 -IAASNSKITSLTMPTEIRDIPFPNQRDQLNAIEITLAVIAHRFGQRD 321
            I +S++K T L +P E+ ++     +  ++  E+ L++IA  +GQRD
Sbjct: 304 QIESSSAK-TLLRLPKELEELDIKAPQQNVSIFELVLSIIAKIYGQRD 350

>CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99177
           Saccharomyces cerevisiae YPR057w BRR1 involved in snRNP
           biogenesis, hypothetical start
          Length = 360

 Score =  105 bits (263), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 163/344 (47%), Gaps = 36/344 (10%)

Query: 9   GPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSHNVVETGLV 68
             +DPVFGQ  AF +ND  V+P V  YL +VRNEAL  + +  + +  Q S N  +  + 
Sbjct: 18  SAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAI--SHQIGQVSKNTFDANIY 75

Query: 69  ADTSDLLNARSILEDSEAINEWINEIRKEMEPLE---ESPSDSI---------YTDDMLD 116
            D  D   + SI  D++  ++ I E    +E      E+ SD I         Y D+ + 
Sbjct: 76  DDEDD---STSIPSDTKVKSDQITEYLYSIENWYKWFENISDIIWHGCYVFEGYDDESIS 132

Query: 117 LLVSEIKKYLDQHPEE-----INDPVRRVTRSVLPIANPE-----YDISTETVQSMVAKL 166
            L   ++ YL +  +E      +  +  + R  L  ++P+      +I  +  ++++  +
Sbjct: 133 HLTQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEIDEDWAENLLKTM 192

Query: 167 RNKRFSDVSFLKRYINRPMP-IPTNFRQWFGHIKHNEPTR-QFMLRLEFDDLMKILGFMI 224
           RN +  D++ +K  I       P   + W  ++  N+PT   F+  ++  +L  ++ +M 
Sbjct: 193 RNSKIKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMIDSSNLWTLVMYMT 252

Query: 225 Q-WINSI---TKNKPDSKQLQQWLLYIWIFMPNELLSPQISQLRDLGRKCQLSLIAASNS 280
           Q W+  I    KN    K L QWLLYI + +P  L + Q+S +R L ++ +  L    NS
Sbjct: 253 QIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAKQAREILNRRVNS 312

Query: 281 KI---TSLTMPTEIRDIPFPNQRDQLNAIEITLAVIAHRFGQRD 321
            I   T++ +P E+ +   P     L+   + LAV+  ++GQ D
Sbjct: 313 NIFGTTNIVIPDELHEHNCPPCPPNLDIASLILAVVTRKYGQHD 356

>YPR057W (BRR1) [5487] chr16 (672466..673491) Protein involved in
           snRNP biogenesis [1026 bp, 341 aa]
          Length = 341

 Score =  101 bits (251), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 92/340 (27%), Positives = 155/340 (45%), Gaps = 32/340 (9%)

Query: 7   NQGPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSHNVVETG 66
           +Q P D +FGQ  AFAL+D  V+P+VI YL  VR EAL  + +   +          ++ 
Sbjct: 6   SQAP-DAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTRHKSS 64

Query: 67  LVADTSDLLNARSILEDS--------EAINEWINEIRKEMEPLEESPSDSIYTDDMLDLL 118
           +  D  +    R  +  S        E    W N ++  +  L  +   + Y D+ LDLL
Sbjct: 65  MYDDEDEGALKRHAISPSLIRLQRNVEIWVRWFNSVKATV--LTNAYEFTGYEDETLDLL 122

Query: 119 VSEIKKYLDQHPEEINDPVRRVTRSVLPIANPE--------YDISTETVQSMVAKLRNKR 170
           +  +K YL+  P +    V ++   +   + PE          I  E  ++++ +L   +
Sbjct: 123 LLFLKNYLEDMPSKCT-TVEKIISVLNQHSFPEKAEEKEENLQIDEEWAKNILVRLEKTK 181

Query: 171 FSDVSFLKRYINRPMPIP-TNFRQWFGHIKHNEPTR-QFMLRLEFDDLMKILGFMIQ-WI 227
              V  +K+ I          + QWF ++ +NEP    F  ++    L  ++ +M   WI
Sbjct: 182 IDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWVLIKYMSNTWI 241

Query: 228 NSITKNKPDSKQLQQWLLYIWIFMPNELLSPQISQLRDLGRKC----QLSLIAASNSKIT 283
             I K     ++LQ WL YI +  P  + +   S LRDLG+KC    Q   + A  +KI 
Sbjct: 242 KEIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKCLELIQKKPVEAHENKI- 300

Query: 284 SLTMPTEIRD--IPFPNQRDQLNAIEITLAVIAHRFGQRD 321
             T+P E+ +  +  P   + +   E+T++VIA  +GQ+D
Sbjct: 301 --TLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQKD 338

>KLLA0E05610g complement(503859..505592) similar to sp|P27614
           Saccharomyces cerevisiae YJL172w CPS1 Gly-X
           carboxypeptidase YSCS precursor, hypothetical start
          Length = 577

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 22  ALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSHNVVETGLVADT-SDLLNARSI 80
           A+NDEG +  VI YLL     ++    L  TS+     H   ++  + +T S L+N+R  
Sbjct: 362 AMNDEGSNARVIEYLLQTGGRSMEY--LLRTSQAVDIIHGGFKSNALPETVSVLINSRIA 419

Query: 81  LEDS--EAINEWINEIRK 96
           LE +  E + ++IN++++
Sbjct: 420 LESTVNETMTKFINQLKE 437

>CAGL0J04576g complement(433096..434751) similar to sp|P32461
           Saccharomyces cerevisiae YKL191w DPH2 diphtheria toxin
           resistance protein, start by similarity
          Length = 551

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 35  YLLDVRNEALSNSPLYSTSRTEQNSHNVVETGLVADTSDLLNARSILEDSEAINEWINEI 94
           +  DV ++ +SN P  S +R  +N H     G +     L+N  SI    E +N+ I  I
Sbjct: 281 HTYDVADQVISNGPYPSLTRRYKNMHKARTAGCIG---ILVNTLSIRGTRETVNKLIKLI 337

Query: 95  RK 96
           R+
Sbjct: 338 RE 339

>Scas_721.9
          Length = 463

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 68/137 (49%), Gaps = 26/137 (18%)

Query: 118 LVSEIKKYLDQHPEEINDPVRRVTRSVL-PIANPEYDISTETVQSMVAKLRNKRFSDVSF 176
           ++++++K ++ H  ++   +R +  S+L P   P    +   + +++  LR       S 
Sbjct: 273 VITQLEKTINLHSNKL---IRIIIPSLLHPAMYPPKMFNLTGIIALLHGLR-------SI 322

Query: 177 LKRYINRPMPIPTNFRQWFGHIKHNEPTRQFMLRLE--FDDLMKILGF---MIQWINSIT 231
           +K+Y +R +   T     FG +         + +LE  FD ++K+  F   M+QW+  I 
Sbjct: 323 IKKYGDRCVMFGTISSDLFGPL--------LLTQLENLFDSVVKLEPFPQEMLQWLEKIY 374

Query: 232 KNKPDSKQLQQWLLYIW 248
           K++P   ++Q  LL+++
Sbjct: 375 KSQPS--KVQHGLLHVF 389

>KLLA0F01210g 112835..114331 similar to sp|P37292 Saccharomyces
           cerevisiae YBR263w SHM1 serine hydroxymethyltransferase
           precursor, mitochondrial, start by similarity
          Length = 498

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 40  RNEALSNSPLYSTSRTEQNSHNVVETGLVADTSDLLNARSILE-DSEAINEWINEIRKEM 98
           R+   S + L+S  R+  +  N   TG  A  + ++ ++ + + D E  +    E +++ 
Sbjct: 4   RSARCSRAVLFSAKRSLASQAN---TGANASANQVMVSKHVQDIDPEMYDILTKERKRQK 60

Query: 99  EPLEESPSDSIYTDDMLDLLVSEIK-KYLDQHPEE 132
             +   PS++  +  ++DLL SE++ KY + +P E
Sbjct: 61  HSITLIPSENFTSKSVMDLLGSEMQNKYSEGYPGE 95

>Kwal_56.22833
          Length = 371

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 29/58 (50%)

Query: 1   MVGVDSNQGPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQN 58
           +V VD+N G ++P+       AL         +++ + +  +AL++S L+ T+    N
Sbjct: 100 LVFVDANYGVMNPLKASAKCGALYSSLKGATAVKFSIQIPGKALTDSFLFVTAHLAAN 157

>Scas_645.15
          Length = 393

 Score = 28.1 bits (61), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 275 IAASNSKITSLTMPTEIRDIPFPNQR 300
           I  S   I SL++PT  R +PFPNQ+
Sbjct: 213 IPVSLKSIPSLSVPTPQRQLPFPNQQ 238

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,869,080
Number of extensions: 479874
Number of successful extensions: 1939
Number of sequences better than 10.0: 59
Number of HSP's gapped: 1918
Number of HSP's successfully gapped: 59
Length of query: 321
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 219
Effective length of database: 13,065,073
Effective search space: 2861250987
Effective search space used: 2861250987
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)