Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08503g30328315100.0
Scas_667.2230628611591e-161
CAGL0D01606g30528511371e-158
YPR058W (YMC1)30728711341e-157
Sklu_1926.230528511171e-155
Kwal_27.1259930428410661e-147
YBR104W (YMC2)3293079521e-129
Kwal_33.129883032839431e-128
Sklu_1275.13112839391e-127
Scas_718.53243049281e-126
Sklu_2398.43092839251e-125
CAGL0K12210g3112919251e-125
Kwal_56.230113032839011e-122
KLLA0F17864g3072848361e-112
KLLA0E09680g3072823095e-33
Scas_697.473282922887e-30
CAGL0B04543g3173022833e-29
Kwal_55.213353172732816e-29
Kwal_33.154463052742807e-29
Sklu_2075.33452762819e-29
ADL264C3292702801e-28
CAGL0B03883g3062902753e-28
KLLA0C13431g3283012731e-27
Sklu_2127.52782682664e-27
YOR100C (CRC1)3272792694e-27
Scas_714.183052872675e-27
Kwal_23.29133202922606e-26
AGL311C3622882573e-25
Sklu_2037.23102922413e-23
YOR130C (ORT1)2922752393e-23
KLLA0E02772g2842832394e-23
CAGL0K10362g3012812291e-21
ADL049W9122692351e-21
Sklu_2334.23192742282e-21
KLLA0D07073g2972792272e-21
Scas_632.92922912253e-21
KLLA0E13453g9062702323e-21
Kwal_26.86692962742254e-21
AFR146W2812872236e-21
YPR021C (AGC1)9022662281e-20
Kwal_47.182163333002231e-20
Sklu_2359.69022772253e-20
Scas_691.43342972194e-20
Scas_640.253062882184e-20
ACR109W2992772174e-20
YOR222W (ODC2)3072842176e-20
KLLA0F03212g3052882168e-20
YJR095W (SFC1)3222782115e-19
CAGL0K02365g9192662147e-19
Scas_662.123082942098e-19
YPL134C (ODC1)3102832081e-18
Kwal_47.173218812742093e-18
CAGL0G08910g2892661893e-16
Kwal_0.2322742651883e-16
YIL134W (FLX1)3112961885e-16
CAGL0J04114g3032851861e-15
YPR011C3263061852e-15
YIL006W3732741843e-15
CAGL0J02002g3612761825e-15
Scas_602.88852661845e-15
Kwal_23.47313142941798e-15
Scas_709.93652731791e-14
CAGL0G01166g2952631718e-14
CAGL0M09020g3483081711e-13
Scas_379.23012881664e-13
YGR096W (TPC1)3142831631e-12
AGL047C3162961622e-12
Scas_589.103162961612e-12
CAGL0J05522g5193171606e-12
AER366W2932811576e-12
KLLA0E02750g3042681576e-12
ACR260W3113031577e-12
KLLA0F04697g3072831578e-12
Kwal_55.208683802931579e-12
YJL133W (MRS3)3142841561e-11
Sklu_2363.23233081561e-11
Scas_716.293163031551e-11
KLLA0C11363g5172931552e-11
KLLA0E15532g3262051523e-11
Sklu_2432.52882641504e-11
YEL006W3352751515e-11
Kwal_27.120813692901515e-11
Scas_558.22892671496e-11
CAGL0L05742g3052881497e-11
Scas_582.73292981498e-11
ADL009W3792921491e-10
KLLA0E23705g3681951481e-10
Scas_578.3*5243121491e-10
KLLA0D14036g4313181463e-10
YNL083W5453171463e-10
Kwal_33.140503143001444e-10
Scas_667.43082851434e-10
YKR052C (MRS4)3042051434e-10
AER419W4932441445e-10
AAL014C2712641417e-10
Scas_702.103022651417e-10
Sklu_2442.82752651409e-10
CAGL0J01661g3272801419e-10
Kwal_27.124813042851401e-09
YLR348C (DIC1)2982631392e-09
AGL065C3353061382e-09
AER184W3052311382e-09
Sklu_2430.103241861382e-09
YNL003C (PET8)2842591363e-09
Kwal_26.76533251861373e-09
YBR085W (AAC3)3071781373e-09
Sklu_1149.22962791363e-09
Kwal_23.30425423141383e-09
YHR002W (LEU5)3573021374e-09
YBL030C (PET9)3181781364e-09
YKL120W (OAC1)3242801364e-09
CAGL0F04213g3062891355e-09
Sklu_2374.75133141366e-09
Scas_718.243372851348e-09
KLLA0B12826g3192791338e-09
YBR291C (CTP1)2992801338e-09
Sklu_2431.53703361321e-08
CAGL0K02915g3422961312e-08
KLLA0E18810g3772771312e-08
Kwal_26.79723583241302e-08
YMR166C3683051293e-08
CAGL0H10538g2972821283e-08
KLLA0D15015g3172771283e-08
CAGL0M05225g3812951293e-08
CAGL0K11616g3201901284e-08
YDL198C (YHM1)3002931276e-08
Scas_717.203563011276e-08
Kwal_55.213383232411267e-08
CAGL0G03135g3072771267e-08
CAGL0H03839g2822581257e-08
KLLA0D04950g2742661258e-08
Scas_721.273743201268e-08
KLLA0E08877g2942841258e-08
CAGL0K08250g2972051259e-08
AGR191W2982751232e-07
Kwal_26.79672972801232e-07
AEL253W3652931223e-07
Scas_721.1293231881223e-07
KLLA0E12353g3052741213e-07
Kwal_23.43543432091213e-07
Sklu_2117.22982791213e-07
YFR045W2852051195e-07
Sklu_2260.53022461188e-07
CAGL0F07711g3682581189e-07
Scas_562.123002801161e-06
CAGL0J09790g3002821161e-06
Scas_669.63732781171e-06
CAGL0L02079g2972801152e-06
Kwal_27.114192981751142e-06
Kwal_27.116262992771133e-06
Scas_489.42972791133e-06
KLLA0D04290g1881461095e-06
KLLA0A09383g3662151125e-06
YMR056C (AAC1)3091611115e-06
KLLA0D09889g3642651117e-06
KLLA0F13464g3002741107e-06
AGL064W2962651081e-05
Kwal_47.192282811101071e-05
AFR147C3152471072e-05
Scas_715.453052501072e-05
Scas_645.93911191063e-05
Scas_328.12272031043e-05
YJR077C (MIR1)311901053e-05
CAGL0F00231g3071011053e-05
Sklu_1119.1307801053e-05
Kwal_33.15597305801053e-05
Scas_613.241771701024e-05
Kwal_23.39653071731045e-05
Kwal_23.35293951961045e-05
Sklu_2127.43232581036e-05
Sklu_2115.42992781026e-05
Sklu_2433.84201411036e-05
YDL119C3072851011e-04
Scas_673.17314911001e-04
AGR383W293292992e-04
AFL196W361200974e-04
AFR253W344148964e-04
CAGL0F08305g374136947e-04
YBR192W (RIM2)377157949e-04
KLLA0D04312g10384860.001
AAR036W317295910.002
KLLA0E18788g38167900.003
KLLA0A00979g343328890.003
AFR542W310137860.007
Kwal_14.2210315195860.008
KLLA0B14454g305149850.009
Scas_687.15*328103820.022
AFR131C344123810.029
CAGL0C02013g329307800.044
AER450C30866790.050
CAGL0D04774g32267780.063
Scas_705.932372750.15
Kwal_55.2110632835730.30
YGR257C (MTM1)36692720.40
ADR036C34094720.47
KLLA0E19547g25049671.3
CAGL0E01771g51980681.3
Scas_671.1*12389641.6
KLLA0F09768g528100671.9
Sklu_2435.234497652.7
Kwal_27.1153770844653.7
ABL023W309133627.6
KLLA0B11319g355129618.4
AFR665C37634619.2
AEL060C42992619.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08503g
         (299 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   586   0.0  
Scas_667.22                                                           451   e-161
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   442   e-158
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   441   e-157
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         434   e-155
Kwal_27.12599                                                         415   e-147
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   371   e-129
Kwal_33.12988                                                         367   e-128
Sklu_1275.1 , Contig c1275 314-1249                                   366   e-127
Scas_718.5                                                            362   e-126
Sklu_2398.4 , Contig c2398 9476-10405                                 360   e-125
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   360   e-125
Kwal_56.23011                                                         351   e-122
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   326   e-112
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   123   5e-33
Scas_697.47                                                           115   7e-30
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...   113   3e-29
Kwal_55.21335                                                         112   6e-29
Kwal_33.15446                                                         112   7e-29
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               112   9e-29
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...   112   1e-28
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   110   3e-28
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...   109   1e-27
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        107   4e-27
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...   108   4e-27
Scas_714.18                                                           107   5e-27
Kwal_23.2913                                                          104   6e-26
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   103   3e-25
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         97   3e-23
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    97   3e-23
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    97   4e-23
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    93   1e-21
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    95   1e-21
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         92   2e-21
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    92   2e-21
Scas_632.9                                                             91   3e-21
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    94   3e-21
Kwal_26.8669                                                           91   4e-21
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    91   6e-21
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    92   1e-20
Kwal_47.18216                                                          91   1e-20
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          91   3e-20
Scas_691.4                                                             89   4e-20
Scas_640.25                                                            89   4e-20
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    88   4e-20
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    88   6e-20
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    88   8e-20
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    86   5e-19
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    87   7e-19
Scas_662.12                                                            85   8e-19
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    85   1e-18
Kwal_47.17321                                                          85   3e-18
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    77   3e-16
Kwal_0.232                                                             77   3e-16
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    77   5e-16
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    76   1e-15
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    76   2e-15
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    75   3e-15
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    75   5e-15
Scas_602.8                                                             75   5e-15
Kwal_23.4731                                                           74   8e-15
Scas_709.9                                                             74   1e-14
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    70   8e-14
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    70   1e-13
Scas_379.2                                                             69   4e-13
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    67   1e-12
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    67   2e-12
Scas_589.10                                                            67   2e-12
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    66   6e-12
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    65   6e-12
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    65   6e-12
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    65   7e-12
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    65   8e-12
Kwal_55.20868                                                          65   9e-12
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    65   1e-11
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          65   1e-11
Scas_716.29                                                            64   1e-11
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    64   2e-11
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    63   3e-11
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       62   4e-11
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    63   5e-11
Kwal_27.12081                                                          63   5e-11
Scas_558.2                                                             62   6e-11
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    62   7e-11
Scas_582.7                                                             62   8e-11
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    62   1e-10
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    62   1e-10
Scas_578.3*                                                            62   1e-10
KLLA0D14036g complement(1203522..1204817) some similarities with...    61   3e-10
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    61   3e-10
Kwal_33.14050                                                          60   4e-10
Scas_667.4                                                             60   4e-10
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    60   4e-10
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    60   5e-10
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    59   7e-10
Scas_702.10                                                            59   7e-10
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          59   9e-10
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    59   9e-10
Kwal_27.12481                                                          59   1e-09
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    58   2e-09
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    58   2e-09
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    58   2e-09
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         58   2e-09
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    57   3e-09
Kwal_26.7653                                                           57   3e-09
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    57   3e-09
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         57   3e-09
Kwal_23.3042                                                           58   3e-09
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    57   4e-09
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    57   4e-09
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    57   4e-09
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    57   5e-09
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       57   6e-09
Scas_718.24                                                            56   8e-09
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    56   8e-09
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    56   8e-09
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            55   1e-08
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    55   2e-08
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    55   2e-08
Kwal_26.7972                                                           55   2e-08
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    54   3e-08
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    54   3e-08
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    54   3e-08
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    54   3e-08
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    54   4e-08
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    54   6e-08
Scas_717.20                                                            54   6e-08
Kwal_55.21338                                                          53   7e-08
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    53   7e-08
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    53   7e-08
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    53   8e-08
Scas_721.27                                                            53   8e-08
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    53   8e-08
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    53   9e-08
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    52   2e-07
Kwal_26.7967                                                           52   2e-07
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    52   3e-07
Scas_721.129                                                           52   3e-07
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    51   3e-07
Kwal_23.4354                                                           51   3e-07
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            51   3e-07
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    50   5e-07
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         50   8e-07
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    50   9e-07
Scas_562.12                                                            49   1e-06
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    49   1e-06
Scas_669.6                                                             50   1e-06
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    49   2e-06
Kwal_27.11419                                                          49   2e-06
Kwal_27.11626                                                          48   3e-06
Scas_489.4                                                             48   3e-06
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    47   5e-06
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    48   5e-06
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    47   5e-06
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    47   7e-06
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    47   7e-06
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    46   1e-05
Kwal_47.19228                                                          46   1e-05
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    46   2e-05
Scas_715.45                                                            46   2e-05
Scas_645.9                                                             45   3e-05
Scas_328.1                                                             45   3e-05
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    45   3e-05
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    45   3e-05
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             45   3e-05
Kwal_33.15597                                                          45   3e-05
Scas_613.24                                                            44   4e-05
Kwal_23.3965                                                           45   5e-05
Kwal_23.3529                                                           45   5e-05
Sklu_2127.4 , Contig c2127 6322-7293                                   44   6e-05
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            44   6e-05
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       44   6e-05
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    44   1e-04
Scas_673.17                                                            43   1e-04
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    43   2e-04
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    42   4e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    42   4e-04
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    41   7e-04
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    41   9e-04
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    38   0.001
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    40   0.002
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    39   0.003
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    39   0.003
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    38   0.007
Kwal_14.2210                                                           38   0.008
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    37   0.009
Scas_687.15*                                                           36   0.022
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    36   0.029
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    35   0.044
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    35   0.050
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    35   0.063
Scas_705.9                                                             33   0.15 
Kwal_55.21106                                                          33   0.30 
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    32   0.40 
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    32   0.47 
KLLA0E19547g complement(1729566..1730318) similar to sgd|S000611...    30   1.3  
CAGL0E01771g complement(175415..176974) similar to sp|P53379 Sac...    31   1.3  
Scas_671.1*                                                            29   1.6  
KLLA0F09768g complement(899099..900685) weakly similar to sp|P53...    30   1.9  
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         30   2.7  
Kwal_27.11537                                                          30   3.7  
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    28   7.6  
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    28   8.4  
AFR665C [3858] [Homologous to ScYGR046W - SH] (1651993..1653123)...    28   9.2  
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    28   9.4  

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/283 (100%), Positives = 283/283 (100%)

Query: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA 60
           MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA
Sbjct: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA 60

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
           VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ
Sbjct: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTP 180
           YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTP
Sbjct: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTP 180

Query: 181 TMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK 240
           TMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK
Sbjct: 181 TMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK 240

Query: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR
Sbjct: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 79/192 (41%), Gaps = 14/192 (7%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIK---DLIKNE 71
           E+   +  +++  + G AGG     +  P +  ++RLQT +T + A    K   D IK  
Sbjct: 110 EAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQT-QTGSGATAEFKGPIDCIKKL 168

Query: 72  GPMGFYKGTLTP-LVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYIC--GVAG 128
              G     LTP ++       + F   EA+    H   ++  Q   +  + +C  G A 
Sbjct: 169 RVNGQLMRGLTPTMLRESHGCGVYFLTYEAL--IGHQV-KSGIQRKDIPAWKLCLFGAAS 225

Query: 129 GFTNSFLASPIEHIRIRLQT---QTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRE 185
           G     +  P++ I+  +QT   +T              I +  V+G L +G  PTMLR 
Sbjct: 226 GTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSG-LFKGFAPTMLRA 284

Query: 186 SHGCGVYFLTYE 197
           +      F T+E
Sbjct: 285 APANAATFATFE 296

>Scas_667.22
          Length = 306

 Score =  451 bits (1159), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 213/286 (74%), Positives = 243/286 (84%), Gaps = 3/286 (1%)

Query: 1   MTEEFPTPQLIDDLES--PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST 58
           M+EEFPTPQLIDDLE+   HDN RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS T T
Sbjct: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD-EAASQHLS 117
            A++VI+ L+KNEGP GFYKGTLTPL+GVGACVSLQFGVNEAMKRFFH+ + ++ SQ LS
Sbjct: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120

Query: 118 LLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRG 177
           L QYYICG+ GG TNSFLASPIEH+RIRLQTQTGSG   EFKGP+DCI+KLR  G  MRG
Sbjct: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180

Query: 178 LTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLD 237
           LTPTMLRE HGCG YFL YEA++ +++  G +R ++PAWKLCLFGA SGT LW MVYPLD
Sbjct: 181 LTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLD 240

Query: 238 VIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           VIKSVMQTDNLK+PK GN+I +V +T+ A+ G+   FKGF PTMLR
Sbjct: 241 VIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLR 286

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 79/198 (39%), Gaps = 30/198 (15%)

Query: 19  DNTRVIKDL----LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDL-----IK 69
           D+T  I  L    + G  GGI    +  P +  ++RLQT   S   V+    L     ++
Sbjct: 113 DSTSQILSLPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLR 172

Query: 70  NEGPMGFYKGTLTPLVGVGACVSLQFGVNEAM------KRFFHTFDEAASQHLSLLQYYI 123
            +G  GF +G    ++  G      F V EAM      K F  T  E  +  L L     
Sbjct: 173 AQG--GFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRT--EVPAWKLCLF---- 224

Query: 124 CGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN----GQLMRGLT 179
            G   G T   +  P++ I+  +QT   +  + ++   I  + K        G   +G  
Sbjct: 225 -GALSGTTLWMMVYPLDVIKSVMQTD--NLKSPKYGNSISSVAKTLYAKGGLGAFFKGFG 281

Query: 180 PTMLRESHGCGVYFLTYE 197
           PTMLR +   G  F T+E
Sbjct: 282 PTMLRAAPANGATFATFE 299

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  442 bits (1137), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 207/285 (72%), Positives = 236/285 (82%), Gaps = 2/285 (0%)

Query: 1   MTEEFPTPQLIDDLESP--HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST 58
           M+EEFPTPQLIDDLE     DN RV+KDLLAGTAGGIAQVL+GQPFDTTKVRLQTS+  T
Sbjct: 1   MSEEFPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPT 60

Query: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSL 118
           +A +V+K+L+KNEGP GFYKGTLTPLVGVGACVS+QFGVNEAMKRFFH  +   +  LSL
Sbjct: 61  SAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSL 120

Query: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGL 178
            QYY+CG+ GG TNSFLASPIEH+RIRLQTQTGSGA AEFKGPIDCIKKLR    LMRGL
Sbjct: 121 SQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLMRGL 180

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238
            PTMLRE HGCG YFL YEAL+  Q+  G++R +IP WKLCL+GA SGT LW MVYP+DV
Sbjct: 181 IPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDV 240

Query: 239 IKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           +KSVMQTDNL  P+NG N++ V R + AR+G+   FKGF PTMLR
Sbjct: 241 VKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLR 285

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 67/179 (37%), Gaps = 14/179 (7%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIK---DLIKN-EGPMGFYKGTLTP 83
           L G  GG+    +  P +  ++RLQT +T + A    K   D IK      G  +G +  
Sbjct: 125 LCGLTGGMTNSFLASPIEHVRIRLQT-QTGSGAQAEFKGPIDCIKKLRSQKGLMRGLIPT 183

Query: 84  LVGVGACVSLQFGVNEAM--KRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEH 141
           ++  G      F V EA+  K+              L  Y   G   G     +  PI+ 
Sbjct: 184 MLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLY---GALSGTALWLMVYPIDV 240

Query: 142 IRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQL---MRGLTPTMLRESHGCGVYFLTYE 197
           ++  +QT          K  I   + L     L    +G  PTMLR +   G  F T+E
Sbjct: 241 VKSVMQTDN-LNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFE 298

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  441 bits (1134), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 211/287 (73%), Positives = 238/287 (82%), Gaps = 4/287 (1%)

Query: 1   MTEEFPTPQLIDDLES--PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST 58
           M+EEFP+PQLIDDLE    HDN RV+KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS T T
Sbjct: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSL 118
            A++V++ L+ NEGP GFYKGTLTPL+GVGACVSLQFGVNEAMKRFFH  +   S  LSL
Sbjct: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120

Query: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGL 178
            QYY CGV GG  NSFLASPIEH+RIRLQTQTGSG  AEFKGP++CIKKLR N  L+RGL
Sbjct: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQV--KSGIQRKDIPAWKLCLFGAASGTLLWTMVYPL 236
           TPT+LRE HGCG YFL YEALI +Q+  + G++RKDIPAWKLC+FGA SGT LW MVYPL
Sbjct: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240

Query: 237 DVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           DVIKSVMQTDNL+ PK GN+I +V +T+ A  G+   FKGF PTMLR
Sbjct: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLR 287

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 71/179 (39%), Gaps = 16/179 (8%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETS-TNA-----VKVIKDLIKNEGPMGFYKGTLTP 83
           G  GGI    +  P +  ++RLQT   S TNA     ++ IK L  N+      +G    
Sbjct: 127 GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKA---LLRGLTPT 183

Query: 84  LVGVGACVSLQFGVNEAM-KRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHI 142
           ++  G      F V EA+     +       + +   +  I G   G     +  P++ I
Sbjct: 184 ILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVI 243

Query: 143 RIRLQTQTGSGATAEFKGPIDCIKK-LRVNG---QLMRGLTPTMLRESHGCGVYFLTYE 197
           +  +QT        +F   I  + K L  NG      +G  PTMLR +   G  F T+E
Sbjct: 244 KSVMQTDNLQ--KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  434 bits (1117), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 204/285 (71%), Positives = 235/285 (82%), Gaps = 2/285 (0%)

Query: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA 60
           MTEE PTP +IDDL+  HD+TRV KDLLAGTAGG++QVL+GQPFDTTKVRLQTS   T A
Sbjct: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD--EAASQHLSL 118
           + V+K L+KNEG  GFYKGTLTPLVGVGACVS+QFGVNEAMKRFFH+ +     ++ L L
Sbjct: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120

Query: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGL 178
           LQYY+CG AGG  NSFLASPIEH+RIRLQTQTG+GA A+F GP+DCIKKL  N  LMRGL
Sbjct: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRGL 180

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238
           TPTMLRESHGCGVYFLTYEALI +++  G+ R +IP WKLCLFGA SGT LW M+YPLDV
Sbjct: 181 TPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDV 240

Query: 239 IKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           IKSVMQTD+L  PK G N+L V +TI + +G+S  FKGF PTMLR
Sbjct: 241 IKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLR 285

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 78/203 (38%), Gaps = 40/203 (19%)

Query: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGF 76
           P++   +++  L G AGG A   +  P +  ++RLQT +T T A                
Sbjct: 114 PNETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQT-QTGTGAAAQ------------- 159

Query: 77  YKGTLTPLVGVGACVSLQFGVNEAMKR-------FFHTFDEAASQHL-------SLLQYY 122
           + G L  +  + A  SL  G+   M R       +F T++   +  L        +  + 
Sbjct: 160 FHGPLDCIKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWK 219

Query: 123 IC--GVAGGFTNSFLASPIEHIRIRLQTQT------GSGATAEFKGPIDCIKKLRVNGQL 174
           +C  G   G T   +  P++ I+  +QT +      G       K     I   R     
Sbjct: 220 LCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAK----TIYSTRGLSSF 275

Query: 175 MRGLTPTMLRESHGCGVYFLTYE 197
            +G  PTMLR +   G  F T+E
Sbjct: 276 FKGFGPTMLRAAPANGATFATFE 298

>Kwal_27.12599
          Length = 304

 Score =  415 bits (1066), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 223/284 (78%), Gaps = 1/284 (0%)

Query: 1   MTEEFPTPQLIDDLES-PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN 59
           M EE  +P LIDD++  PHD+ RV+KDLLAGTAGG+AQVLVGQPFDTTKVRLQTS T T 
Sbjct: 1   MPEETSSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT 60

Query: 60  AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLL 119
           AV+V+K L+KNEG  GFYKGTLTPLVGVGACVS QFGVNEAMKRFF        + L+L 
Sbjct: 61  AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLP 120

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLT 179
           QYYICG  GG  NSFLASPIEH+RIRLQTQT SG  AEFKGP+DCI KLR NG LMRGL+
Sbjct: 121 QYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGLS 180

Query: 180 PTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVI 239
           PT+LRE+ GC  YFLTYEAL+ +Q+  GI R D+PAWKLCLFGA SG  LW  VYPLDVI
Sbjct: 181 PTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI 240

Query: 240 KSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           KS+MQTDNLK P  G NI+ V R + A+ G    FKGF PTMLR
Sbjct: 241 KSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLR 284

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 81/206 (39%), Gaps = 46/206 (22%)

Query: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGF 76
           PH    + +  + G  GG+A   +  P +  ++RLQT   S              G +  
Sbjct: 113 PHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTAS--------------GTVAE 158

Query: 77  YKGTLTPLVGVGACVSLQFGVNEAMKR-------FFHTFDEAASQHL-------SLLQYY 122
           +KG L  +  + A  +L  G++  + R       +F T++   +  +        +  + 
Sbjct: 159 FKGPLDCINKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWK 218

Query: 123 IC--GVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPI---DCIKKLR-VNGQ--- 173
           +C  G   G T      P++ I+  +QT          K P+   + I+  R VN +   
Sbjct: 219 LCLFGAVSGVTLWLTVYPLDVIKSLMQTD-------NLKNPVRGKNIIQVARLVNAKYGW 271

Query: 174 --LMRGLTPTMLRESHGCGVYFLTYE 197
               +G  PTMLR +   G  F T+E
Sbjct: 272 KSFFKGFGPTMLRAAPANGATFATFE 297

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  371 bits (952), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 181/307 (58%), Positives = 224/307 (72%), Gaps = 24/307 (7%)

Query: 1   MTEEFPTPQLIDDLE------SPHD-----NTRVIKDLLAGTAGGIAQVLVGQPFDTTKV 49
           M+EEFPTPQL+D+LE      +P++     + RV+KD+ AGT GGIAQVLVGQPFDTTKV
Sbjct: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKV 60

Query: 50  RLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF- 108
           RLQT+ T T  ++V+++L+KNEG   FYKG LTPL+GVG CVS+QFGVNEAMKRFF  + 
Sbjct: 61  RLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120

Query: 109 ------------DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATA 156
                       D + S  L L QYY+CG+ GG  NSFLASPIE IRIRLQTQT +G   
Sbjct: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180

Query: 157 EFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAW 216
           EFKGP DCIKKL+  G LMRGL PTM+R  HG G YFL YEAL+  ++ +G+ R +IP W
Sbjct: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPW 240

Query: 217 KLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKG 276
           KLCLFGA SGT+LW  VYPLDV+KS++Q D+L+ PK  N+I  V +TI A++G+   FKG
Sbjct: 241 KLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKG 300

Query: 277 FAPTMLR 283
           F PTM+R
Sbjct: 301 FGPTMVR 307

>Kwal_33.12988
          Length = 303

 Score =  367 bits (943), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 173/283 (61%), Positives = 207/283 (73%)

Query: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA 60
           M++E   PQ++DDL    D  R +KD+ AGT GGIAQVLVGQPFD TKVRLQTS T T A
Sbjct: 1   MSDELTMPQVVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA 60

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
           ++V++DL+KNEG  GFYKGT  PL+GVG CVS QFG NEAMKR+FH  +   S  L L +
Sbjct: 61  LRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPE 120

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTP 180
           YY CG   G  N+FLA+PIEH+RI LQ QT S A AE++G +DCIKKL   G+LMRG TP
Sbjct: 121 YYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGKLMRGFTP 180

Query: 181 TMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK 240
           T+LR SHG GVYF +YEA+I  + + GI RKDIPAWKLCL+GA SG+LLW MVYP DVIK
Sbjct: 181 TILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIK 240

Query: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           SVMQ+D L+TP  G N+  V + I   +G     KGF PTMLR
Sbjct: 241 SVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLR 283

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  366 bits (939), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 169/283 (59%), Positives = 211/283 (74%)

Query: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA 60
           M++E  TPQ++DDL    +  + IKD+++GT+GGIAQVLVGQPFD TKVR+QTS  S  A
Sbjct: 1   MSDELTTPQVVDDLSDAPEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTA 60

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
           ++VIK+L+KNEG + FYKGTL PL+GVGACVS QFGVNEAMKR+F   +    QHLSLLQ
Sbjct: 61  IEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQ 120

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTP 180
           YY CG   G  N+FLA+PIEH+RIRLQ QT + A AE++G +DC+KKL     LMRG T 
Sbjct: 121 YYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRGFTA 180

Query: 181 TMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK 240
           T++R SHG GVYFLTYEALI +Q K+G+ RKDIP WK+C+FGA SG   W M YP DV+K
Sbjct: 181 TLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVK 240

Query: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           S+MQ D L +P +G N+  V ++I A +G     KGF PTMLR
Sbjct: 241 SIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLR 283

>Scas_718.5
          Length = 324

 Score =  362 bits (928), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 175/304 (57%), Positives = 221/304 (72%), Gaps = 21/304 (6%)

Query: 1   MTEEFPTPQLIDDLE------------SPH----DNTRVIKDLLAGTAGGIAQVLVGQPF 44
           M+E+F +PQLI++ +            S H    D+TRV+KD+LAGT GGI+QV+VGQPF
Sbjct: 1   MSEDFSSPQLINEFDDEMASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPF 60

Query: 45  DTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRF 104
           DTTKVR+QTS  S  A+ +I+ L+KNEG   FYKG+L P+VGVGACVS+QFGVNEAMKRF
Sbjct: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120

Query: 105 FHTFDEA-ASQH----LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFK 159
           F  ++ +  +QH    L L QYYICG+ GG  NSFLASPIEH+RIRLQTQTG+G   EFK
Sbjct: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180

Query: 160 GPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLC 219
           GP+DCI+KL     LMRGL P MLR  HG G YFLTYEALI +++K G  R +I +WKLC
Sbjct: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLC 240

Query: 220 LFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAP 279
            +G+ SG +LW  +YPLDV+KS++QTD L+ P+  N++  V   +   QG+S  FKGFAP
Sbjct: 241 SYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAP 300

Query: 280 TMLR 283
           TMLR
Sbjct: 301 TMLR 304

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 71/183 (38%), Gaps = 16/183 (8%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA------VKVIKDLIKNEGPMGFYKGTL 81
           + G  GG+    +  P +  ++RLQT   + N       +  I+ L+K +  M   +G  
Sbjct: 144 ICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLR 200

Query: 82  TPLVGVGACVSLQFGVNEAM--KRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPI 139
             ++  G  +   F   EA+         D +      L  Y   G   G        P+
Sbjct: 201 PMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSY---GSLSGVVLWLAIYPL 257

Query: 140 EHIRIRLQTQTGSGA--TAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
           + ++  +QT T          K  I+ + + +      +G  PTMLR +   G  F+T+E
Sbjct: 258 DVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317

Query: 198 ALI 200
            ++
Sbjct: 318 LVM 320

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  360 bits (925), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/283 (60%), Positives = 206/283 (72%)

Query: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA 60
           M++E   PQ++DDL    D  R IKD+L+GTAGGIAQVLVGQPFD TKVR+QTS  S  A
Sbjct: 1   MSDELTAPQVVDDLSDSLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSATA 60

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
           V V+  LIKNEG +GFYKGTL PLVGVGACVS QFGVNEAMKR F   +   S+ LSL Q
Sbjct: 61  VDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQ 120

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTP 180
           YY+CGVA G  N+FLA+PIEH+RIRLQ QT S A AE++G +DC++KL   G LMRG T 
Sbjct: 121 YYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALMRGFTA 180

Query: 181 TMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK 240
           T++R  HG G+YF TYEALI +Q K GI RKDI  WK+C+FGA SG   W M YP+DV+K
Sbjct: 181 TLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVK 240

Query: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           S+MQ+D L +P +G N+  V ++I   +G     KGF P MLR
Sbjct: 241 SIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLR 283

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  360 bits (925), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/291 (58%), Positives = 211/291 (72%), Gaps = 8/291 (2%)

Query: 1   MTEEFPTPQLIDDLES---PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS 57
           M+EEFPTPQL+++LE    P    RV+KD+ AGT GG+AQVLVGQPFDTTKVRLQTS+T 
Sbjct: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60

Query: 58  TNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF-----DEAA 112
              ++V+++L++NEG + FYKG LTPL+GVG CVS+QFGVNE+MKRFF  +     D   
Sbjct: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120

Query: 113 SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG 172
              L L QYY+CG+ GG  NSFLA+PIEH+RIRLQTQT  G   +FKGP DCIKKL    
Sbjct: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTM 232
            LMRGL PTM+R  HG G YF  YEAL+  + + G  R  IPAWKLC FGA SGT+LW  
Sbjct: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLT 240

Query: 233 VYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           VYP+DV+KSV+QTD+++ PK  N+I+   R +  + G+   FKGF PTM+R
Sbjct: 241 VYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIR 291

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 74/186 (39%), Gaps = 28/186 (15%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK------VIKDLIKNEGPMGFYKGTL 81
           L G  GG+    +  P +  ++RLQT  +  N  +       IK L K +  M   +G L
Sbjct: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKALM---RGLL 187

Query: 82  TPLVGVGACVSLQFGVNEAM--KRFFHTFDEAASQHLSLLQYYIC--GVAGGFTNSFLAS 137
             ++  G  +   F   EA+  K F     E  +    +  + +C  G   G        
Sbjct: 188 PTMIRAGHGLGTYFAAYEALVVKEF-----EKGTPRNQIPAWKLCSFGALSGTILWLTVY 242

Query: 138 PIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQ------LMRGLTPTMLRESHGCGV 191
           P++ ++  LQT   S    ++K  I  IK  R   +        +G  PTM+R +     
Sbjct: 243 PVDVVKSVLQTD--SIENPKYKNSI--IKATRALYKQHGIPAFFKGFVPTMIRAAPANAA 298

Query: 192 YFLTYE 197
            F+++E
Sbjct: 299 TFVSFE 304

>Kwal_56.23011
          Length = 303

 Score =  351 bits (901), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 164/283 (57%), Positives = 197/283 (69%)

Query: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA 60
           M+EE  +PQ++DDL   HD  + +KD+  GT GG+AQVLVGQPFD TKVRLQTS   T A
Sbjct: 1   MSEELTSPQVVDDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTA 60

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
            +VIK L+KNEG + FYKGTL PL GVGACVS QFGVNEA+K++F   D    Q L+L Q
Sbjct: 61  AQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQ 120

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTP 180
           YY CG   G  N+FLA+PIEH+RIRLQ QT S + AE+ G +DC +KL   G LMRG T 
Sbjct: 121 YYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALMRGFTA 180

Query: 181 TMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK 240
           T LR SHG G+YFLTYE LI +Q   G+ R++IPAWK+C++GA SG   W M YP DV+K
Sbjct: 181 TTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVK 240

Query: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           SVMQ D LK P  G N L V + I   +G     KGF PTMLR
Sbjct: 241 SVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLR 283

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 74/194 (38%), Gaps = 48/194 (24%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK------VIKDLIKNEGPM-GFYKGTLT 82
           G   G A   +  P +  ++RLQ    S++A +        + L+K    M GF   TL 
Sbjct: 125 GFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALMRGFTATTLR 184

Query: 83  PLVGVGACVSLQFGVNEAMKRFFHTFDE--AASQHLSLLQ-----YYICGVAGGFTNSF- 134
                    S  FG+      +F T++   A   H  +L+     + +C V G F+ +F 
Sbjct: 185 --------TSHGFGI------YFLTYETLIANQAHHGVLRENIPAWKVC-VYGAFSGAFF 229

Query: 135 --LASPIEHIRIRLQTQTGSGATAEFKGPI---------DCIKKLRVNGQLMRGLTPTML 183
             +  P + ++  +Q         + K P+           I + R      +G TPTML
Sbjct: 230 WAMTYPFDVVKSVMQAD-------KLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTML 282

Query: 184 RESHGCGVYFLTYE 197
           R     G  F  +E
Sbjct: 283 RSLPVNGATFAAFE 296

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  326 bits (836), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 191/284 (67%), Gaps = 3/284 (1%)

Query: 3   EEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK 62
           E   TPQ+++DL   H   + +KD+ +GT GG+AQVLVGQPFD  KVRLQT   +  A +
Sbjct: 4   ELLITPQVVEDLTDLHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWE 63

Query: 63  VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQH---LSLL 119
            I DL+K EG MGFYKGT+ PLVGVGACVS QFG+NEAMKR+F   + +   +   LSL 
Sbjct: 64  AITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLG 123

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLT 179
           QYY CG   G  N+ LA+PIEH+RIRLQ Q  + A AE+K  +DC +KL   G LMRG T
Sbjct: 124 QYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLMRGFT 183

Query: 180 PTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVI 239
            T++R SHG G+YFLTYE LI  Q+  G +R+DI AWK C+FGA SG   W M YP DV+
Sbjct: 184 ATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVV 243

Query: 240 KSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           KSVMQ D L  P  G N++ V + I   +G+    KGF PTMLR
Sbjct: 244 KSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLR 287

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  123 bits (309), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 138/282 (48%), Gaps = 18/282 (6%)

Query: 11  IDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN---AVKVIKDL 67
           ++ L S    +R++   +AG   G+A+  VG PFDT KVRLQTS+  T     +  +   
Sbjct: 12  VNSLISNETYSRIM-GFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKT 70

Query: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVA 127
            +N+G  GFY G   PLVG     S+  G     +   H +     + L L    I GV 
Sbjct: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130

Query: 128 GGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLR----VNGQLMRGLTPTML 183
            G++ SF+A PIE  + +LQ Q     T  +KGP+D IKK+     + G L +GL  T++
Sbjct: 131 AGWSVSFIAPPIELAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRG-LYKGLISTLI 188

Query: 184 RESHGCGVYFLTYEALI-GHQVKSGIQRKDIPAWKLCLFGAASGTL-LWTMVYPLDVIKS 241
             +H    ++ +YE L    +  + +    I  W     G  S +   WT  YP DV+K 
Sbjct: 189 FRTHFV-YWWGSYELLTRWFRENTKMSEAAINFWA----GGFSASFGFWTTAYPSDVVKQ 243

Query: 242 VMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           V+  ++ K   +  +  T  + I   +G++G FKGF P+ LR
Sbjct: 244 VVLCND-KYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLR 284

>Scas_697.47
          Length = 328

 Score =  115 bits (288), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 137/292 (46%), Gaps = 27/292 (9%)

Query: 8   PQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDL 67
           P +     +  DN   +K L+AG  GG+  VL G PFD  KVR Q+ + S+  +  IK +
Sbjct: 24  PPVTPPANAIRDN---LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASST-IHAIKII 79

Query: 68  IKNEGPM-----------GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHL 116
           +K+   +           GFYKG + PL+GV    ++ F   +  K+     D +++Q L
Sbjct: 80  LKDARAIPTSNMLVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQ-L 138

Query: 117 SLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMR 176
           ++ Q    G       + + +P E I++ LQT  G+ +   F G    I K      L +
Sbjct: 139 TMGQMAAAGFISAIPTTLVTAPTERIKVVLQT-AGANSKTSFIGAAKNIVKDGGVKSLFK 197

Query: 177 GLTPTMLRESHGCGVYFLTYEA----LIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTM 232
           G   T+ R+  G  +YF +YE     L      +  +  ++    +CL G  +G  +W +
Sbjct: 198 GSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLV 257

Query: 233 VYPLDVIKSVMQTDNLKTPKNGNNILTVGRTI-IARQGVSGLFKGFAPTMLR 283
           V+P+D IK+ +Q+ +        +++   R I + R G+ G F G  P +LR
Sbjct: 258 VFPIDTIKTKLQSSS-----GSQSMVAATREIYVKRGGIKGFFPGLGPALLR 304

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score =  113 bits (283), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 140/302 (46%), Gaps = 37/302 (12%)

Query: 7   TPQLIDDLESPHDNTRV-IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE--TSTNAVKV 63
           TP   + LE   D  R  +K L+AG  GG+  VL G PFD  KVR Q+++  ++ +AV +
Sbjct: 4   TPAETNILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSI 63

Query: 64  I----KDLIKNEGPM-----------GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF 108
           I    + L    G +           GFYKG + PL+GV    ++ F   +  KR   T+
Sbjct: 64  ILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLV-TW 122

Query: 109 DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGP-IDCIKK 167
            +A+   L+  Q    G       + + +P E I++ LQT +      EFKG  I   K 
Sbjct: 123 KQASDAPLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNS------EFKGSFIKAAKH 176

Query: 168 LRVNG---QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKD---IPAWKLCLF 221
           +   G    L  G   T+ R+  G  +YF +YE       KS + +KD   +    +CL 
Sbjct: 177 IVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKS-VAKKDKDEVNLANVCLA 235

Query: 222 GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTM 281
           G  +G  +W +V+P+D IK+ +Q     TP   + +       I R G+ G F G  P +
Sbjct: 236 GGIAGMSMWLVVFPIDTIKTRLQVAT--TPI--SMVQATKDIYIQRGGIKGFFPGLGPAL 291

Query: 282 LR 283
           LR
Sbjct: 292 LR 293

>Kwal_55.21335
          Length = 317

 Score =  112 bits (281), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 129/273 (47%), Gaps = 22/273 (8%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST--NAVKVIKDLIKNEGPM-G 75
           D    +KD+L G+  G A  ++  P DT KVRLQT        +   IK   + EG + G
Sbjct: 41  DFKDALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKG 100

Query: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFL 135
           FY+G  +PLVG     ++ F      + F   ++  +     L Q  + G   G   S++
Sbjct: 101 FYQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVS----PLSQTVLSGAFAGACTSYV 156

Query: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGVY 192
            +P+E I+  LQ     GAT         +K +  +   G L +G + T +RE  G  V+
Sbjct: 157 LTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVW 216

Query: 193 FLTYEALIGHQVKSGIQRKDIP--AWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKT 250
           F TYE+L  +  +   +R D     W+L   GA++G      ++P D IKS  QT +L  
Sbjct: 217 FTTYESLKSYLAR---RRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHL-- 271

Query: 251 PKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
                 I+   + I+AR G +GL++G   T++R
Sbjct: 272 -----GIVDATKRILARSGPAGLYRGLGITLIR 299

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 74/184 (40%), Gaps = 19/184 (10%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE---TSTNAVKV---IKDLIKNEGPMGFYK 78
           + +L+G   G     V  P +  K  LQ S     +T   K+   +K +++++G  G ++
Sbjct: 141 QTVLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQ 200

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASP 138
           G  +  +   A  ++ F   E++K +          H    +    G + G   +    P
Sbjct: 201 GQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHT--WELLASGASAGVAFNASIFP 258

Query: 139 IEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGVYFLT 195
            + I+   QTQ          G +D  K++        L RGL  T++R +    + F T
Sbjct: 259 ADTIKSTAQTQ--------HLGIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYT 310

Query: 196 YEAL 199
           YE L
Sbjct: 311 YETL 314

>Kwal_33.15446
          Length = 305

 Score =  112 bits (280), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 129/274 (47%), Gaps = 13/274 (4%)

Query: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS---TNAVKVIKDLIKNEGP 73
           P++    +   ++G   GIA+  VG PFDT KVRLQTS+ +      +  +   ++ +G 
Sbjct: 12  PNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGI 71

Query: 74  MGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNS 133
            GFY G   PLVG     S+  G     +     +     + L L    + GV  G++ S
Sbjct: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVS 131

Query: 134 FLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLR----VNGQLMRGLTPTMLRESHGC 189
           F+A+P+E  + +LQ Q     T  ++GP+D IKK+     + G + +GL  T++  +H  
Sbjct: 132 FIAAPVELAKAKLQVQY-DAQTTRYRGPLDVIKKVYAADGIRG-MYKGLVSTLIFRTH-- 187

Query: 190 GVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLK 249
            VY+     L+    K+     D  A      G ++    WT  YP DVIK V+  ++ K
Sbjct: 188 FVYWWGSYELLTRWFKANTNLSDT-AINFWAGGFSASFGFWTTAYPSDVIKQVILCND-K 245

Query: 250 TPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
              +  +       I   +G+ G FKGF P+ LR
Sbjct: 246 YDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLR 279

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  112 bits (281), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 129/276 (46%), Gaps = 17/276 (6%)

Query: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN---AVKVIKDLIKNEGP 73
           P +    I   ++G   GIA+  VG PFDT KVRLQTS+ ST     +  +      +G 
Sbjct: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGI 113

Query: 74  MGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNS 133
            GFY G   PLVG     S+  G     +     +     + L L    I GV  G++ S
Sbjct: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVS 173

Query: 134 FLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCG 190
           F+A+P+E  + +LQ Q     T ++ GP+D IKK+   NG   L +GLT T++  ++   
Sbjct: 174 FIAAPVELAKAKLQVQY-DAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFV- 231

Query: 191 VYFLTYEALIGHQVKSGIQRKD--IPAWKLCLFGAASGTL-LWTMVYPLDVIKSVMQTDN 247
            ++ +YE L+    K      D  I  W     G  S +   WT  YP DVIK V+  ++
Sbjct: 232 FWWGSYE-LLTRWFKEHTNMSDTAINFWS----GGFSASFGFWTTAYPSDVIKQVVLCND 286

Query: 248 LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            K      +     + I   +G  G FKGF P+ LR
Sbjct: 287 -KYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLR 321

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score =  112 bits (280), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 122/270 (45%), Gaps = 24/270 (8%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGP---------MG 75
           K L AG  GG+  VL G PFD  KVR Q+++ S     V K L++              G
Sbjct: 49  KSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRG 108

Query: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFL 135
           FYKG + PL+GV    ++ F   +  K+     D   S  L+  Q    G       + +
Sbjct: 109 FYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDN--SGKLTTAQLATAGFISAIPTTLV 166

Query: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLT 195
            +P E +++ LQTQ+     +  K  I     +R    L RG   T+ R+  G  +YF +
Sbjct: 167 MAPTERVKVVLQTQSNHSLGSAAK-HILATGGVR---SLFRGSLATLARDGPGSALYFAS 222

Query: 196 YEALIGH-QVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG 254
           YEA   +   +SG     I    +CL G  +G  +W  V+P+D IK+ +Q+ N +     
Sbjct: 223 YEATKAYLNARSGTNELSIK--NVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTR----- 275

Query: 255 NNILTVGRTII-ARQGVSGLFKGFAPTMLR 283
             ++   R I   R G+ G F G  P +LR
Sbjct: 276 QTMMEATRKIYNTRGGIKGFFPGIGPALLR 305

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  110 bits (275), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 133/290 (45%), Gaps = 28/290 (9%)

Query: 14  LESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-------VKVIKD 66
           + S    +RV+   +AG   G+A+  VG PFDT KVRLQTS+  + A       +  +  
Sbjct: 1   MVSEETYSRVM-GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYK 59

Query: 67  LIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGV 126
            +KN+G  G Y G   PL G     S   G     +   H +       L L    I GV
Sbjct: 60  TLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGV 119

Query: 127 AGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG-----------QLM 175
             G+T SF+A+P+E  + +LQ Q     T ++ GPID ++K+   G            L 
Sbjct: 120 MAGWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178

Query: 176 RGLTPTMLRESHGCGVYFLTYEALI-GHQVKSGIQRKDIPAWKLCLFGAASGTL-LWTMV 233
           +GL  T++  S+    ++ +YE +    Q  + +    I  W     G  S +   WT  
Sbjct: 179 KGLISTLIFRSNFV-FWWGSYELITQWFQKNTNLSAPAINFWA----GGLSASFGFWTSA 233

Query: 234 YPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           YP DV+K V+  ++ K   +  +  T    I  ++G+ G FKGF P+ LR
Sbjct: 234 YPSDVVKQVVLCND-KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score =  109 bits (273), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 144/301 (47%), Gaps = 32/301 (10%)

Query: 4   EFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE--TSTNAV 61
           E  T  + D  ++    T  +K L AG  GG+  VL G PFD  KVR Q+++  ++ +AV
Sbjct: 9   ELETSHVNDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAV 68

Query: 62  K-VIKDLIKNEGPM------GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQ 114
             +++   +  GP       GFYKG + PL+GV    ++ F   +  K+   +   +A+ 
Sbjct: 69  SHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAAS 128

Query: 115 -------HLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK 167
                   L+L Q    G       + + +P E +++ LQT  G    A F   +D  K+
Sbjct: 129 GAAAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQGK---ASF---LDAAKQ 182

Query: 168 L-RVNG--QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVK-SGIQRKDIPAWKLCLFGA 223
           + R  G   L +G   T+ R+  G  +YF +YE    +  K SG    ++    +C+ G 
Sbjct: 183 IVRTQGFQSLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGG 242

Query: 224 ASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTII-ARQGVSGLFKGFAPTML 282
            +G  +W +V+P+D +K+ +Q+ + +      ++L V R I   R G+ G F G  P +L
Sbjct: 243 MAGVSMWVVVFPIDTVKTQLQSSSKR-----QSMLEVTRMIYNTRGGIKGFFPGVGPAIL 297

Query: 283 R 283
           R
Sbjct: 298 R 298

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  107 bits (266), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 83/268 (30%), Positives = 128/268 (47%), Gaps = 24/268 (8%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE-----TSTNAVKVIKDLIKNEGPM-GFYK 78
           KD+L G+  G    ++  PFDT KVRLQT       T+ + +K   D   NEG   GFY+
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYD---NEGLWRGFYQ 64

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASP 138
           G  +PL G     ++ F      KR      +  S    L +    G   G   SF+ +P
Sbjct: 65  GIGSPLAGAALENAVLFVSFNQAKRLL----DVESLLSPLSKTVWAGAFAGACASFVLTP 120

Query: 139 IEHIRIRLQTQTGSGATAEFKGPIDCIKKL---RVNGQLMRGLTPTMLRESHGCGVYFLT 195
           +E I+ +LQ    S         +  IK +   R    L +G + T +RES G   +F T
Sbjct: 121 VELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTT 180

Query: 196 YEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGN 255
           YE ++ + + S  Q +    W+L   GA++G      ++P D IKS MQTD++       
Sbjct: 181 YE-VVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHI------- 232

Query: 256 NILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++ +  R I ARQG++G ++G   T++R
Sbjct: 233 DLSSATRKIYARQGIAGFYRGLGITLIR 260

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 73/195 (37%), Gaps = 18/195 (9%)

Query: 11  IDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK------VI 64
           ++ L SP     + K + AG   G     V  P +  K +LQ S  ST           I
Sbjct: 93  VESLLSP-----LSKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTI 147

Query: 65  KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYIC 124
           K ++   G +G ++G     +      +  F   E +K +  +  +A  +  +  +    
Sbjct: 148 KSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYLASRRQA--EQNTTWELLAS 205

Query: 125 GVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLR 184
           G + G   +    P + I+  +QT     ++A  K     I   +      RGL  T++R
Sbjct: 206 GASAGLAFNASIFPADTIKSTMQTDHIDLSSATRK-----IYARQGIAGFYRGLGITLIR 260

Query: 185 ESHGCGVYFLTYEAL 199
                   F TYE L
Sbjct: 261 AVPANAAIFYTYETL 275

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score =  108 bits (269), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 127/279 (45%), Gaps = 30/279 (10%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS------TNAVKVIKDLIK----NEGP 73
           IK  +AG  GG+  V  G PFD  KVR Q  + +      TN +K  K  +K        
Sbjct: 36  IKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSV 95

Query: 74  MGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD--EAASQHLSLLQYYICGVAGGFT 131
            GFYKG + PL+GV    ++ F   +  K+   TF+  +  S  L++ Q    G      
Sbjct: 96  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLV-TFNNKQGGSNELTMGQMAAAGFISAIP 154

Query: 132 NSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGV 191
            + + +P E +++ LQT +       F      I K      L +G   T+ R+  G  +
Sbjct: 155 TTLVTAPTERVKVVLQTSS----KGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSAL 210

Query: 192 YFLTYEALIGHQVKSGIQRKD------IPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQT 245
           YF +YE +  + + S   R+D      +    +CL G  +G  +W  V+P+D IK+ +Q 
Sbjct: 211 YFASYE-ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQA 269

Query: 246 DNLKTPKNGNNILTVGRTI-IARQGVSGLFKGFAPTMLR 283
            + +      N+L+  + I + R G+ G F G  P +LR
Sbjct: 270 SSTR-----QNMLSATKEIYLQRGGIKGFFPGLGPALLR 303

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 23  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDL-IKNEGPMGFYKG 79
           ++   LAG   G++  L   P DT K +LQ S T  N +   K++ ++  G  GF+ G
Sbjct: 239 ILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEIYLQRGGIKGFFPG 296

>Scas_714.18
          Length = 305

 Score =  107 bits (267), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 132/287 (45%), Gaps = 40/287 (13%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST--NAVKVIKDLIKNEGPM-GFYKGT 80
           ++++LAG+  G     +  PFDT KVRLQT E     +    IK   +NEG + GFY+G 
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGI 72

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
            +PL+G     ++ F        F + F E ++  + L+     G AG    SF+ +P+E
Sbjct: 73  ESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILIS---AGFAGS-CASFVLTPVE 128

Query: 141 HIRIRLQTQT------------------------GSGATAEFKGPIDCIKKLRVNGQLMR 176
            I+ +LQ                           G G        I  I K +    L +
Sbjct: 129 LIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQ 188

Query: 177 GLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPL 236
           G + T +RES G  V+F TYE +   Q     + +    W+L + GA +G      V+P 
Sbjct: 189 GQSSTFIRESIGSVVWFATYELM--KQTLRDPKSEVNTTWQLLISGATAGLAFNGSVFPA 246

Query: 237 DVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           D +KS+MQT++L        ++   R+I+ R GV+G ++G   T+LR
Sbjct: 247 DTVKSIMQTEHLA-------LMETVRSILERDGVAGFYRGLGITLLR 286

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 58/142 (40%), Gaps = 8/142 (5%)

Query: 58  TNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLS 117
           T  +  IK +IK +G  G ++G  +  +       + F   E MK+   T  +  S+  +
Sbjct: 168 TRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQ---TLRDPKSEVNT 224

Query: 118 LLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRG 177
             Q  I G   G   +    P + ++  +QT+      A  +     +++  V G   RG
Sbjct: 225 TWQLLISGATAGLAFNGSVFPADTVKSIMQTEH----LALMETVRSILERDGVAG-FYRG 279

Query: 178 LTPTMLRESHGCGVYFLTYEAL 199
           L  T+LR        F TYE L
Sbjct: 280 LGITLLRAVPSNAAVFYTYEKL 301

>Kwal_23.2913
          Length = 320

 Score =  104 bits (260), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 134/292 (45%), Gaps = 30/292 (10%)

Query: 11  IDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS--TNAV-KVIKDL 67
           I+   + H      + L AG  GG+  VL G PFD  KVR Q+++ S   +A+ +V+ + 
Sbjct: 16  IEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEA 75

Query: 68  IKNEGPM------GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFH------TFDEAASQH 115
               GP+      GFY+G + PL+GV    ++ F   +  KR         T    +S  
Sbjct: 76  KSKSGPLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSK 135

Query: 116 LSLLQYYICGVAGGFT---NSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG 172
           L+ L      +AG F+    + + +P E +++ LQT      +  F G    + +     
Sbjct: 136 LTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSE----SGSFLGAARTLIREGGVR 191

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKD-IPAWKLCLFGAASGTLLWT 231
            L +G   T+ R+  G  +YF +YE  +  +  S  Q  D +    +C+ G  +G  +W 
Sbjct: 192 SLFQGTLATLARDGPGSALYFASYE--VSKRFLSRNQDTDALSVVSICVAGGVAGMSMWI 249

Query: 232 MVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            V+P+D IK+ +Q+ +        +++   R I  R G+ G F G  P ++R
Sbjct: 250 GVFPIDTIKTKLQSSS-----RSQSMVQAAREIYTRAGLRGFFPGLGPALMR 296

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  103 bits (257), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 139/288 (48%), Gaps = 23/288 (7%)

Query: 12  DDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK------VIK 65
           D+  S   +T    +L+AG   G+ + L   P DT KVR+Q    +    K         
Sbjct: 46  DNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGA 105

Query: 66  DLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT-FDEAASQHLSLLQYYIC 124
           ++   EG + FYKG    ++G+   ++++F   E    F+ T   +  +  +S    ++ 
Sbjct: 106 NIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADRQTGVVSTGNTFLA 161

Query: 125 GVAGGFTNSFL-ASPIEHIRIRLQTQTGSGATAE--FKGPIDC---IKKLRVNGQLMRGL 178
           GV  G T + L  +P+E ++IRLQ Q   GA  +  ++  I     I K    G L RG+
Sbjct: 162 GVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGV 221

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238
           + T  R++   G  F  Y  L+  +++     +++P+W+  L G  SG +      PLD 
Sbjct: 222 SLTAARQATNQGANFTVYSKLM-ERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDT 280

Query: 239 IKSVMQTDNLKTPKNGNN---ILTVGRTIIARQGVSGLFKGFAPTMLR 283
           IK+ +Q D  K+ +N +N   I T+GR ++  +G   L+KG  P ++R
Sbjct: 281 IKTRLQKD--KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMR 326

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 77/189 (40%), Gaps = 16/189 (8%)

Query: 27  LLAGTAGGIAQ-VLVGQPFDTTKVRLQTS--------ETSTNAVKVIKDLIKNEGPMGFY 77
            LAG   G+ + VLV  P +  K+RLQ          +   NA++    ++K EG    Y
Sbjct: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLAS 137
           +G               F V   +      +    SQ+L   +  + G+  G    F  +
Sbjct: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYH--GSQNLPSWETSLIGLVSGAIGPFSNA 276

Query: 138 PIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQ----LMRGLTPTMLRESHGCGVYF 193
           P++ I+ RLQ    +   + +   I  I +  V  +    L +G+TP ++R + G  V F
Sbjct: 277 PLDTIKTRLQKDKSTRNLSNWVR-ITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335

Query: 194 LTYEALIGH 202
             YE +  H
Sbjct: 336 TVYEFVRRH 344

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 97.4 bits (241), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 134/292 (45%), Gaps = 31/292 (10%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSETSTNAVKVIKDLIKNEGPMG 75
           D + V K++++G   G    +   P D  KVRLQ   T++       V+K ++K+     
Sbjct: 4   DFSPVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHS 63

Query: 76  F----YKGTLTPLVGVGACVSLQFGV------------NEAMKRFFHTFDEAASQHLSLL 119
           F    Y+G    L+G      L FG+            N  +KRF +T +    + ++ L
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNN--DKEMTSL 121

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNGQ--LMR 176
            Y +     G   S L +PI  I+ R+ + T    +  ++  +D IKKL R+ G     R
Sbjct: 122 MYLLAAAMSGVATSVLTNPIWVIKTRIMS-TSFVDSRSYRSTVDGIKKLYRIEGLAGFWR 180

Query: 177 GLTPTMLRESHGCGVYFLTYEALIGHQ--VKSGIQRKDIPAWKLCLFGAASGTLLWTMVY 234
           GL P++   S G  +YF  Y+ L  H    K   ++K +   +     + S  +  T VY
Sbjct: 181 GLVPSLFGVSQG-AIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVY 239

Query: 235 PLDVIKSVMQTDNLKT---PKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           PL ++KS +Q+  + T   PK  + +  +  TI  R GV+GL+KG    ++R
Sbjct: 240 PLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIR 291

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 96.7 bits (239), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 128/275 (46%), Gaps = 29/275 (10%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST--NAVKVIKDLIKNEG-PMGFYKGT 80
           I D++ G+  G    ++  PFDT KVRLQT  ++        IK   +NEG   GF++G 
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGI 73

Query: 81  LTPLVGVGACV---SLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLAS 137
            +PLVG  AC+   +L    N+  K     F E  +    L Q  I G   G   S + +
Sbjct: 74  ASPLVG--ACLENATLFVSYNQCSK-----FLEKHTNVFPLGQILISGGVAGSCASLVLT 126

Query: 138 PIEHIRIRLQTQTGSGATAEFKGP-----IDCIKKLRVNGQLMRGLTPTMLRESHGCGVY 192
           P+E ++ +LQ      A+A+ K       I  I   R    L +G + T +RES G   +
Sbjct: 127 PVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAW 186

Query: 193 FLTYE----ALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNL 248
           F TYE    +L         +R +   W+L + G ++G      ++P D +KSVMQT+++
Sbjct: 187 FATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEHI 246

Query: 249 KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
                  ++    + I  + G+ G ++G   T+ R
Sbjct: 247 -------SLTNAVKKIFGKFGLKGFYRGLGITLFR 274

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 96.7 bits (239), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 129/283 (45%), Gaps = 28/283 (9%)

Query: 11  IDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SETSTNAVKVIKDLI 68
           + DLES       +KD+  G+  G    ++  PFDT KVRLQT  +         I+   
Sbjct: 1   MSDLES------ALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTY 54

Query: 69  KNEGPM-GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVA 127
            +EG   GFY+G  +PL G     ++ F        F   F    +Q   L +    G  
Sbjct: 55  TDEGIWKGFYQGIASPLFGAALENAVLFVSFNQCTNFLDEF----TQLKPLTKTIYSGAF 110

Query: 128 GGFTNSFLASPIEHIRIRLQTQTGSGA-------TAEFKGPIDCIKKLRVNGQLMRGLTP 180
            G   SF+ +P+E ++ +LQ    S +       T+ +      IK+  + G L +G   
Sbjct: 111 AGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLG-LWQGQLS 169

Query: 181 TMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK 240
           T +RE  G  V+F TYE +           K+   W+L + GA++G L    V+P D +K
Sbjct: 170 TFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVK 229

Query: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           SV QT+++       +I+   + ++   G++G ++G   T++R
Sbjct: 230 SVCQTEHV-------SIVNALKKVLRTHGITGFYRGLGITLIR 265

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 78/187 (41%), Gaps = 21/187 (11%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS---------TNAVKVIKDLIKNEGPMG 75
           K + +G   G     +  P +  K +LQ S  S         T+    IK +IK +G +G
Sbjct: 103 KTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLG 162

Query: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFL 135
            ++G L+  V      ++ F   E MK  F +   A  ++ +  +  + G + G   +  
Sbjct: 163 LWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTW-ELLVSGASAGVLFNAS 221

Query: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-LRVNG--QLMRGLTPTMLRESHGCGVY 192
             P + ++   QT        E    ++ +KK LR +G     RGL  T++R +      
Sbjct: 222 VFPADTVKSVCQT--------EHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATV 273

Query: 193 FLTYEAL 199
           F TYE L
Sbjct: 274 FYTYETL 280

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 2/79 (2%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVG 86
           L++G + G+       P DT K   QT   S   V  +K +++  G  GFY+G    L+ 
Sbjct: 208 LVSGASAGVLFNASVFPADTVKSVCQTEHVSI--VNALKKVLRTHGITGFYRGLGITLIR 265

Query: 87  VGACVSLQFGVNEAMKRFF 105
                +  F   E +K+ F
Sbjct: 266 AAPANATVFYTYETLKKMF 284

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 92.8 bits (229), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 125/281 (44%), Gaps = 32/281 (11%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPM-GFYKGT 80
            +D+L G+  G    ++  PFDT KVRLQT       +    I    KNEG + GF++G 
Sbjct: 14  FRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGI 73

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
            +PL G     +  F       +F   +   +     L    I G   G   SF+ +P+E
Sbjct: 74  ASPLAGAAIENAALFLSYNQCSKFLQHYTNVSD----LTNILISGAFAGSCASFVLTPVE 129

Query: 141 HIRIRLQTQT----------GSGATAEFKGPIDCIKKLRVNGQ---LMRGLTPTMLRESH 187
            I+ +LQ             G+  T      I  I+ +  N     L +G + T +RES 
Sbjct: 130 LIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESF 189

Query: 188 GCGVYFLTYEALIGH-QVKSGIQRKDIP----AWKLCLFGAASGTLLWTMVYPLDVIKSV 242
           G   +F TYE +  + + +  I+   +P     W+L   GA++G      ++P D +KS+
Sbjct: 190 GGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSM 249

Query: 243 MQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           MQT++L        + T  + I   +G+ G ++G   T++R
Sbjct: 250 MQTEHL-------GLKTAIKKIFVEKGLRGFYRGLGITLIR 283

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 95.1 bits (235), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 75/269 (27%), Positives = 114/269 (42%), Gaps = 14/269 (5%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST---NAVKVIKDLIKNEGPMGFYKGT 80
           I +   G+  G    +V  P D  K R+Q     +   N++  +  ++  EG  G Y G 
Sbjct: 525 IYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGL 584

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
              L+GV    +++  VN+ M+      D      LSL    I G   G       +P+E
Sbjct: 585 GPQLIGVAPEKAIKLTVNDHMRATLAGRD----GKLSLPCEIISGATAGACQVVFTNPLE 640

Query: 141 HIRIRLQTQTGSGATAEFKG--PIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTY-- 196
            ++IRLQ ++   A A       I  IK L + G L RG    +LR+     +YF TY  
Sbjct: 641 IVKIRLQVKSDYVADAARNSVNAISVIKNLGLIG-LYRGAGACLLRDIPFSAIYFPTYAH 699

Query: 197 --EALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG 254
               +     K   +R  +  W+L + G  +G     +  P DVIK+ +Q D  K     
Sbjct: 700 IKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVY 759

Query: 255 NNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           N I    RTI+  +G+   FKG    +LR
Sbjct: 760 NGIWDAARTILKEEGIKSFFKGGPARVLR 788

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 129/274 (47%), Gaps = 21/274 (7%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST-------NAVKVIKDLIKNEGPMGFYK 78
           +L+AG   G+ + L   P DT KVR+Q    S          +K  +++   EG +  YK
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYK 72

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHT-FDEAASQHLSLLQYYICGVAGGFTNSFLA- 136
           G    ++G+   ++++F   E    F+ +   +  +  +S    ++ GV  G T + L  
Sbjct: 73  GLGAVVIGIIPKMAIRFSSYE----FYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVV 128

Query: 137 SPIEHIRIRLQTQ---TGSGATAEFKGPIDC---IKKLRVNGQLMRGLTPTMLRESHGCG 190
           +P+E ++IRLQ Q     + A+  ++  +     I K    G L RG++ T  R++   G
Sbjct: 129 NPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQG 188

Query: 191 VYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKT 250
             F  Y  L    ++   +   +P+W+    G  SG +      PLD IK+ +Q D    
Sbjct: 189 ANFTVYSKL-KEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTA 247

Query: 251 PKNG-NNILTVGRTIIARQGVSGLFKGFAPTMLR 283
             +G + I+T+G+ +I  +G   L+KG  P ++R
Sbjct: 248 NMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMR 281

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 83/198 (41%), Gaps = 21/198 (10%)

Query: 27  LLAGTAGGIAQ-VLVGQPFDTTKVRLQTS----ETST-----NAVKVIKDLIKNEGPMGF 76
            LAG   G  + VLV  P +  K+RLQ      ET+      NA++    ++K EG    
Sbjct: 113 FLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGAL 172

Query: 77  YKGTLTPLVGVGACVSLQFGVNEAMKRFF---HTFDEAASQHLSLLQYYICGVAGGFTNS 133
           Y+G               F V   +K F    H  D   S   S +   I G  G F+N+
Sbjct: 173 YRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGL-ISGAIGPFSNA 231

Query: 134 FLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCG 190
               P++ I+ RLQ    +   + +   +   K+L +  G   L +G+TP ++R + G  
Sbjct: 232 ----PLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQA 287

Query: 191 VYFLTYEALIGHQVKSGI 208
           V F  YE +  H    GI
Sbjct: 288 VTFTVYEFVREHLETLGI 305

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 122/279 (43%), Gaps = 36/279 (12%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTK--VRLQTSETSTNAVKVIKDLIK----NEGPMGFY 77
           +   +AG   G++++LV  P D  K  ++LQ S  S    K + D +K     EGP   Y
Sbjct: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFFHTF--DEAASQHLSLLQYYICGVAGGFTNSFL 135
           KG  +P++      + +F  N+  ++ +      E  +Q LS+L     G + G   SF+
Sbjct: 70  KGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSIL----SGASAGICESFV 125

Query: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRESHGC--- 189
             P E ++IRLQ       +++F  PI  +K +     ++    GL  TM R  HG    
Sbjct: 126 VVPFELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR--HGIWNA 178

Query: 190 ---GVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTD 246
              G+ F     L     KS   R D+      L G   GTL   +  P DV+KS +Q  
Sbjct: 179 GYFGIIFQVRALLPKASTKSEQTRNDL------LAGTVGGTLSSLLSTPFDVVKSRVQNT 232

Query: 247 NL--KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            +    P+  N       TI   +G   L+KGF P +LR
Sbjct: 233 AVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLR 271

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 82/180 (45%), Gaps = 8/180 (4%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSETSTNAVKVIKDLIKNEGPMGFYKGTLTPL 84
            +L+G + GI +  V  PF+  K+RLQ  S   T+ + V+K++++ EG +  Y G  + +
Sbjct: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170

Query: 85  VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRI 144
              G   +  FG+   ++         + Q  + L   + G  GG  +S L++P + ++ 
Sbjct: 171 WRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDL---LAGTVGGTLSSLLSTPFDVVKS 227

Query: 145 RLQTQT---GSGATAEFKGP-IDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALI 200
           R+Q      G      +  P +  I K      L +G  P +LR   G G+  + +  ++
Sbjct: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 78/176 (44%), Gaps = 18/176 (10%)

Query: 116 LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---G 172
           L  +  ++ G   G +   +  P++ ++  +Q Q   G+  ++KG  DC+K++       
Sbjct: 7   LPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPS 66

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKL-----CLFGAASGT 227
           +L +G++  +L E+      F   +          I +    A KL      L GA++G 
Sbjct: 67  RLYKGISSPILMEAPKRATKFACNDEF------QKIYKDLFGAEKLTQPLSILSGASAGI 120

Query: 228 LLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
               +V P +++K  +Q  + K      + + V + I+ ++G+  ++ G   TM R
Sbjct: 121 CESFVVVPFELVKIRLQDVSSKF----TSPIAVVKNIVEKEGILAMYNGLESTMWR 172

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (40%), Gaps = 9/113 (7%)

Query: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-- 62
           F    L+    +  + TR   DLLAGT GG    L+  PFD  K R+Q +       +  
Sbjct: 185 FQVRALLPKASTKSEQTR--NDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKY 242

Query: 63  -----VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDE 110
                 +  + K EG    YKG +  ++ +G    +   V   +  FF T  E
Sbjct: 243 NWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTVHE 295

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 210 RKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIARQ 268
           +K +P     + GA +G     ++YPLD++K+VMQ   +  +      +    + I A++
Sbjct: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKE 63

Query: 269 GVSGLFKGFAPTML 282
           G S L+KG +  +L
Sbjct: 64  GPSRLYKGISSPIL 77

>Scas_632.9
          Length = 292

 Score = 91.3 bits (225), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 131/291 (45%), Gaps = 38/291 (13%)

Query: 12  DDLESPHDNTRV---IKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SETSTNAVKVIKD 66
           + ++ P + + V   + D++ G+  G    ++  PFDT KVRLQT  S         IK 
Sbjct: 3   ESIDHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKY 62

Query: 67  LIKNEGPM-GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICG 125
              NEG   GF++G  +PL G     +  F            F   +     L    + G
Sbjct: 63  TYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSP----LSNILLSG 118

Query: 126 VAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIK-------KLRVNG--QLMR 176
              G   SF+ +P+E I+ +LQ    S      +G I   K        LR  G   L +
Sbjct: 119 AFAGSCASFVLTPVELIKCKLQV---SNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQ 175

Query: 177 GLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQ--RKDIP--AWKLCLFGAASGTLLWTM 232
           G + T +RES G   +F TYE +     K G++  RKD     W+L + GA++G      
Sbjct: 176 GQSSTFIRESLGGVAWFATYEVM-----KQGLKDRRKDTENKTWELLVSGASAGLAFNAS 230

Query: 233 VYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++P D +KS+MQT+++        ++   + ++   G++G ++G   T++R
Sbjct: 231 IFPADTVKSMMQTEHI-------TLINAVKKVLTTYGITGFYRGLGITLIR 274

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 117/270 (43%), Gaps = 16/270 (5%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST---NAVKVIKDLIKNEGPMGFYKGT 80
           I +   G+  G     V  P D  K R+Q    S    N++  +  + + +G  G Y G 
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGL 564

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
              L+GV    +++  VN+ M+++F       S+ +   Q  + G   G       +P+E
Sbjct: 565 GPQLIGVAPEKAIKLTVNDFMRQYFMN----KSRTIKWYQEILSGATAGACQVVFTNPLE 620

Query: 141 HIRIRLQTQT---GSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
            ++IRLQ ++   G  A  +  G +  I++L + G L +G    +LR+     +YF TY 
Sbjct: 621 IVKIRLQMRSDYVGENARPQL-GAVGIIRQLGLRG-LYKGAAACLLRDVPFSAIYFPTYA 678

Query: 198 AL----IGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKN 253
            L             +R  +  W+L L G  +G     +  P DVIK+ +Q D  K    
Sbjct: 679 HLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETT 738

Query: 254 GNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
              ++   RTI+  + +   FKG    +LR
Sbjct: 739 YTGVIHAARTILKEESIKSFFKGGPARVLR 768

>Kwal_26.8669
          Length = 296

 Score = 91.3 bits (225), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 122/274 (44%), Gaps = 36/274 (13%)

Query: 29  AGTAGGIAQVLVGQPFDTTKVRLQTSETS------TNAVKVIKDLIKNEGPMGFYKGTLT 82
           AG   GI+++LV  P D  K R+Q   +          V  IK ++  EG    YKG  +
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 83  PLVGVGACVSLQFGVNEAMKRFF-HTFD-EAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
           P++      + +F  N+  ++ +   F  E  +Q LS+L     G + G   +F+  P E
Sbjct: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS----GASAGCCEAFVVVPFE 130

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRESHGC------GV 191
            ++IRLQ  + S     +KGPID ++K+     ++    GL  T+ R  HG       G+
Sbjct: 131 LVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR--HGVWNAGYFGI 183

Query: 192 YFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKT- 250
            F     L   + KS   R D+ A      G+  GT+   M  P DV+KS +Q   +   
Sbjct: 184 IFQVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237

Query: 251 -PKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
             +  N       TI   +G   L+KGF P +LR
Sbjct: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLR 271

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 75/176 (42%), Gaps = 8/176 (4%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSETSTNAVKVIKDLIKNEGPMGFYKGTLTPL 84
            +L+G + G  +  V  PF+  K+RLQ  S +    + V++ +I  EG +  Y G  + L
Sbjct: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170

Query: 85  VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRI 144
              G   +  FG+   ++       EA S+        I G  GG   S +++P + ++ 
Sbjct: 171 WRHGVWNAGYFGIIFQVRAL---LPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKS 227

Query: 145 RLQTQ---TGSGATAEFKGP-IDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTY 196
           R+Q      G      +  P I  I K      L +G  P +LR   G G+  + +
Sbjct: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 82/181 (45%), Gaps = 22/181 (12%)

Query: 113 SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN- 171
           ++ L     +  G   G +   +  P++ ++ R+Q Q   G   ++KG +DCIK++    
Sbjct: 4   ARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKE 63

Query: 172 --GQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKL-----CLFGAA 224
              +L +G++  +L E+      F   +          I +++    KL      L GA+
Sbjct: 64  GASRLYKGISSPVLMEAPKRATKFACNDEF------QKIYKREFGVEKLTQSLSILSGAS 117

Query: 225 SGTLLWTMVYPLDVIKSVMQ--TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           +G     +V P +++K  +Q  + + K P      + V R IIA++GV  ++ G   T+ 
Sbjct: 118 AGCCEAFVVVPFELVKIRLQDVSSSYKGP------IDVVRKIIAQEGVLAMYNGLESTLW 171

Query: 283 R 283
           R
Sbjct: 172 R 172

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 9/111 (8%)

Query: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-- 62
           F    L+ + +S    TR   DL+AG+ GG    L+  PFD  K R+Q +       +  
Sbjct: 185 FQVRALLPEAKSKSQQTR--NDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKY 242

Query: 63  -----VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF 108
                 I  + K EG    YKG +  ++ +G    +   V      FF T 
Sbjct: 243 NWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 90.5 bits (223), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 126/287 (43%), Gaps = 47/287 (16%)

Query: 18  HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST--NAVKVIKDLIKNEGPM- 74
            D  +  KDLL G   G    LV  PFDT KVRLQT   +        +    K EG   
Sbjct: 3   EDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWR 62

Query: 75  GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICG--------- 125
           GFY+G  +P+          FG        F +F+ A +    L   Y CG         
Sbjct: 63  GFYQGMASPV----------FGAFLEHAVLFVSFNRAQA---VLENCYSCGPLEKVVFAG 109

Query: 126 -VAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGP--------IDCIKKLRVNGQLMR 176
            +AG  T S++ +P+E ++ +LQ    +G +    GP        +  I K    G L +
Sbjct: 110 AIAGACT-SYVLTPVELVKCKLQVSNLTGVS----GPRYTAVLPTLRAIVKQNGLGGLWQ 164

Query: 177 GLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPL 236
           G + T +RES G  V+F  YE L G   +     ++   W+L   GA +G      ++P 
Sbjct: 165 GQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENT-VWELLASGAGAGAAFHASIFPA 223

Query: 237 DVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           D +KS MQT++L        +    RT++ + G +G ++G   T+LR
Sbjct: 224 DTVKSTMQTEHL-------GLGPAVRTVLKKHGPTGFYRGVGITLLR 263

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 74/196 (37%), Gaps = 16/196 (8%)

Query: 14  LESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS-------TNAVKVIKD 66
           LE+ +    + K + AG   G     V  P +  K +LQ S  +       T  +  ++ 
Sbjct: 93  LENCYSCGPLEKVVFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRA 152

Query: 67  LIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGV 126
           ++K  G  G ++G     +   A  ++ F   E +K +      +    +  L     G 
Sbjct: 153 IVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGA 212

Query: 127 AGGFTNSFLASPIEHIRIRLQTQ-TGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRE 185
              F  S    P + ++  +QT+  G G           +KK    G   RG+  T+LR 
Sbjct: 213 GAAFHASIF--PADTVKSTMQTEHLGLGPAVR-----TVLKKHGPTG-FYRGVGITLLRA 264

Query: 186 SHGCGVYFLTYEALIG 201
                V F  YE+L G
Sbjct: 265 LPANAVIFYVYESLCG 280

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 73/266 (27%), Positives = 112/266 (42%), Gaps = 16/266 (6%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSET---STNAVKVIKDLIKNEGPMGFYKGTLTPL 84
           L   AG I   +V  P D  K R+Q   +     N++  +  +I  EG  G Y G    L
Sbjct: 536 LGSIAGCIGATVV-YPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQL 594

Query: 85  VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRI 144
           +GV    +++  VN+ M+          +  LSL    I G + G       +P+E ++I
Sbjct: 595 IGVAPEKAIKLTVNDFMRNRL----TDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKI 650

Query: 145 RLQTQT---GSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTY----E 197
           RLQ Q+   G       +     +KKL + G L  G+   ++R+     +YF TY    +
Sbjct: 651 RLQVQSDYVGENIQQANETATQIVKKLGLRG-LYNGVAACLMRDVPFSAIYFPTYAHLKK 709

Query: 198 ALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNI 257
            L         +R  +  W+L   GA +G     +  P DVIK+ +Q D  K     N I
Sbjct: 710 DLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGI 769

Query: 258 LTVGRTIIARQGVSGLFKGFAPTMLR 283
               RTI+  +     FKG    +LR
Sbjct: 770 FHAIRTILKEESFRSFFKGGGARVLR 795

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 45/187 (24%), Positives = 71/187 (37%), Gaps = 12/187 (6%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTS-----ETSTNAVKVIKDLIKNEGPMGFYKGT 80
           ++++G + G  QV+   P +  K+RLQ       E    A +    ++K  G  G Y G 
Sbjct: 627 EIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGV 686

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTF---DEAASQHLSLLQYYICGVAGGFTNSFLAS 137
              L+      ++ F     +K+    F   D+     L   +    G   G   +FL +
Sbjct: 687 AACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTT 746

Query: 138 PIEHIRIRLQTQTGSGATAEFKG---PIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFL 194
           P + I+ RLQ     G T ++ G    I  I K        +G    +LR S   G    
Sbjct: 747 PFDVIKTRLQIDPRKGET-KYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLA 805

Query: 195 TYEALIG 201
            YE   G
Sbjct: 806 AYELFKG 812

>Kwal_47.18216
          Length = 333

 Score = 90.5 bits (223), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 132/300 (44%), Gaps = 47/300 (15%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQT-------SETSTNAVKVIKDLIKNEGPMGFYK 78
           +L+AG   G+ + L   P DT KVR+Q         + +   +   +D+   EG +  YK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTF-DEAASQHLSLLQYYICGVAGGFTNSFLA- 136
           G    ++G+   ++++F   E    FF T   +  +  +S    ++ GV  G T + +  
Sbjct: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128

Query: 137 SPIEHIRIRLQTQ-----------TGS------------------GATAEFKGPIDC--- 164
           +P+E ++IRLQ Q            GS                   AT +++  I     
Sbjct: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYV 188

Query: 165 IKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAA 224
           I K      L RG++ T  R++   G  F  Y  L   +++   Q   +P+W+  L G  
Sbjct: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWETSLIGLI 247

Query: 225 SGTLLWTMVYPLDVIKSVMQTDNLKTPKNG-NNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           SG L      PLD IK+ +Q D   +  +G + IL +GR +I  +G   L+KG  P ++R
Sbjct: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 80/213 (37%), Gaps = 47/213 (22%)

Query: 27  LLAGTAGGIAQ-VLVGQPFDTTKVRLQTSETS---------------------------- 57
            +AG   GI + V+V  P +  K+RLQ                                 
Sbjct: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATEN 172

Query: 58  -------TNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK---RFFHT 107
                   NA++    ++K EGP   Y+G               F V   +K   + +H 
Sbjct: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232

Query: 108 FDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK 167
            D   S   SL+   I G  G F+N+    P++ I+ RLQ    +   + +   +   ++
Sbjct: 233 TDMLPSWETSLIGL-ISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQ 287

Query: 168 L-RVNG--QLMRGLTPTMLRESHGCGVYFLTYE 197
           L R  G   L +G+TP ++R + G  V F  YE
Sbjct: 288 LIREEGFRALYKGITPRVMRVAPGQAVTFTVYE 320

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 43  PFDTTKVRLQTSETSTN------AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFG 96
           P DT K RLQ  ++++        + + + LI+ EG    YKG    ++ V    ++ F 
Sbjct: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317

Query: 97  VNEAMKR 103
           V E +++
Sbjct: 318 VYELIRK 324

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 70/277 (25%), Positives = 116/277 (41%), Gaps = 30/277 (10%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST---NAVKVIKDLIKNEGPMGFYKGT 80
           I +   G+  G     V  P D  K R+Q   + +   N++     +   EG  G Y G 
Sbjct: 519 IYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGL 578

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYY--ICGVAGGFTNSFLASP 138
              L+GV    +++  VN+ M+           +H +L  Y+  + G   G       +P
Sbjct: 579 GPQLIGVAPEKAIKLTVNDYMR------GRLMDKHANLKWYFEILSGACAGACQVVFTNP 632

Query: 139 IEHIRIRLQTQTGSGATAEFKGPI--------DCIKKLRVNGQLMRGLTPTMLRESHGCG 190
           +E ++IRLQ ++      E+ G +          IK+L + G L +G+   ++R+     
Sbjct: 633 LEVVKIRLQVRS------EYAGDVLKSQVTALGVIKQLGIKG-LYKGIAACLMRDVPFSA 685

Query: 191 VYFLTYEAL----IGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTD 246
           +YF TY  L      +  K   QR  +  W+L + G  +G     +  P DVIK+ +Q D
Sbjct: 686 IYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID 745

Query: 247 NLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
             K       I    RTI+  +     FKG +  +LR
Sbjct: 746 PRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLR 782

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 50/194 (25%), Positives = 81/194 (41%), Gaps = 11/194 (5%)

Query: 14  LESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-SETSTNAVK---VIKDLIK 69
           L   H N +   ++L+G   G  QV+   P +  K+RLQ  SE + + +K       +IK
Sbjct: 603 LMDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIK 662

Query: 70  NEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGG 129
             G  G YKG    L+      ++ F     +K+    +D    +  + L+ +   VAGG
Sbjct: 663 QLGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGG 722

Query: 130 FTN---SFLASPIEHIRIRLQTQTGSGATAEFKGPIDC---IKKLRVNGQLMRGLTPTML 183
                 ++L +P + I+ RLQ     G T  ++G       I K        +G +  +L
Sbjct: 723 LAGMPAAYLTTPFDVIKTRLQIDPRKGET-RYEGIFHAARTILKEESFKSFFKGGSARVL 781

Query: 184 RESHGCGVYFLTYE 197
           R S   G     YE
Sbjct: 782 RSSPQFGFTLAAYE 795

>Scas_691.4
          Length = 334

 Score = 89.0 bits (219), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 137/297 (46%), Gaps = 32/297 (10%)

Query: 15  ESPHDN-TRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-----VKVIKDLI 68
           ++P+D  +  + +L+AG   G+ + L   P DT KVR+Q ++ +        +   +++ 
Sbjct: 4   KNPNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIY 63

Query: 69  KNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAG 128
            +EG +  YKG    ++G+   ++++F   E  +   +   +  ++ ++    ++ GV  
Sbjct: 64  SHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYR---NALTDKETRTITTGNTFLAGVGA 120

Query: 129 GFTNSFL-ASPIEHIRIRLQTQ--------------TGSGATA---EFKGPIDC---IKK 167
           G T + L  +P+E ++IRLQ Q               G+ AT    ++   I     I K
Sbjct: 121 GITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVK 180

Query: 168 LRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGT 227
               G L RG++ T  R++   G  F  Y  L  +  K    R+ +P+W+    G  SG 
Sbjct: 181 EEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYH-NRESLPSWETSCIGLISGA 239

Query: 228 LLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           +      PLD IK+ +Q D ++ +      I  +G  +I  +G   L+KG  P ++R
Sbjct: 240 IGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMR 296

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 83/206 (40%), Gaps = 35/206 (16%)

Query: 27  LLAGTAGGIAQ-VLVGQPFDTTKVRLQ------------------TSETST-----NAVK 62
            LAG   GI + VLV  P +  K+RLQ                  T+ T T     NA+ 
Sbjct: 114 FLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIH 173

Query: 63  VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRF---FHTFDEAASQHLSLL 119
               ++K EG    Y+G               F V   +K +   +H  +   S   S +
Sbjct: 174 AAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCI 233

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKG-PIDCIKKLRVNG--QLMR 176
              I G  G F+N+    P++ I+ RLQ      + + +K   I   + ++  G   L +
Sbjct: 234 GL-ISGAIGPFSNA----PLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYK 288

Query: 177 GLTPTMLRESHGCGVYFLTYEALIGH 202
           G+TP ++R + G  V F  YE +  H
Sbjct: 289 GITPRVMRVAPGQAVTFTVYEFVRKH 314

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 43  PFDTTKVRLQTSET--STNAVKVI----KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFG 96
           P DT K RLQ  ++  S +A K I      LIK EG    YKG    ++ V    ++ F 
Sbjct: 247 PLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFT 306

Query: 97  VNEAMKRFFHTFD 109
           V E +++   T +
Sbjct: 307 VYEFVRKHLETLN 319

>Scas_640.25
          Length = 306

 Score = 88.6 bits (218), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 128/288 (44%), Gaps = 53/288 (18%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-----------VKVIKDLIKNEGPM 74
             +AG   GI++++V  P D  K R+Q  + ST A           +  +  ++K EGPM
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQL-QVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74

Query: 75  GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF--DEAASQHLSLLQYYICGVAGGFTN 132
             YKG  +P++      +++F  N+   + + +    +  +Q +S+L     G + G T 
Sbjct: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVL----SGASAGITE 130

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-LRVNG--QLMRGLTPTMLRESHG- 188
           + +  P E ++IRLQ        ++FKGP++ +K  ++ +G   L  G+  T+ R +   
Sbjct: 131 ALVIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185

Query: 189 ---CGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQT 245
               GV F   E L   + K    R D+ A      G   GT       P DV+KS +Q+
Sbjct: 186 AGYFGVIFQVRELLPVAKSKQEKTRNDLCA------GFVGGTFGVMFNTPFDVVKSRIQS 239

Query: 246 DNLKTPKNGNNILTVGR----------TIIARQGVSGLFKGFAPTMLR 283
           D       GN I+   R           I   +G   L+KGF P +LR
Sbjct: 240 D-------GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 10/114 (8%)

Query: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS-TNAVK- 62
           F   +L+   +S  + TR   DL AG  GG   V+   PFD  K R+Q+      N V+ 
Sbjct: 193 FQVRELLPVAKSKQEKTR--NDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRK 250

Query: 63  ------VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDE 110
                  +  +   EG    YKG +  ++ +G   ++   V   +   F  F E
Sbjct: 251 YNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHE 304

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 88.2 bits (217), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 127/277 (45%), Gaps = 32/277 (11%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ------TSETSTNAVKVIKDLIKNEGPMGFY 77
           +    AG   G++++LV  P D  K R+Q           T  V  +K ++  EG    Y
Sbjct: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLY 71

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFF-HTFD-EAASQHLSLLQYYICGVAGGFTNSFL 135
           KG  +P++      + +F  N+  ++ +   F  E  SQ LS+L     G + G   +F+
Sbjct: 72  KGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSML----AGASAGCVEAFV 127

Query: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRESHGCGVY 192
             P E ++IRLQ      A++ +KGP+D ++K+     ++    GL  T+ R +   G Y
Sbjct: 128 VVPFELVKIRLQD-----ASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGY 182

Query: 193 F-LTYEA---LIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNL 248
           F + ++A   L     K+     D+ +  +   G + G +L T   P DV+KS +Q   +
Sbjct: 183 FGIIFQARALLPAAHNKTQCITNDLISDSI---GCSIGCMLST---PFDVVKSRIQNTAV 236

Query: 249 --KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
                +  N  L    TI   +G   L+KGF P +LR
Sbjct: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLR 273

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 85/177 (48%), Gaps = 14/177 (7%)

Query: 113 SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN- 171
           ++ L  L  +  G   G +   +  P++ ++ R+Q Q   GA   + G +DC+KK+    
Sbjct: 6   TKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGE 65

Query: 172 --GQLMRGLTPTMLRESHGCGVYFLTYEALIG-HQVKSGIQRKDIPAWKLCLFGAASGTL 228
             G+L +G++  +L E+      F   +     ++   G+++   P   L   GA++G +
Sbjct: 66  GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLA--GASAGCV 123

Query: 229 LWTMVYPLDVIKSVMQ--TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
              +V P +++K  +Q  + + K P      + V R I+AR+GV  ++ G   T+ R
Sbjct: 124 EAFVVVPFELVKIRLQDASSSYKGP------VDVVRKIVAREGVLAMYNGLESTLWR 174

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 76/183 (41%), Gaps = 14/183 (7%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-VKVIKDLIKNEGPMGFYKGTLTPL 84
            +LAG + G  +  V  PF+  K+RLQ + +S    V V++ ++  EG +  Y G  + L
Sbjct: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172

Query: 85  VGVGACVSLQFGV---NEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEH 141
                     FG+     A+    H   +  +  L      I    G      L++P + 
Sbjct: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCITNDL------ISDSIGCSIGCMLSTPFDV 226

Query: 142 IRIRLQ-TQTGSGATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCGVYFLTYE 197
           ++ R+Q T    G   ++   +  +  + R  G   L +G  P +LR   G G+  + + 
Sbjct: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286

Query: 198 ALI 200
            ++
Sbjct: 287 GVL 289

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 14  LESPHDNTRVI-KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-------VIK 65
           L + H+ T+ I  DL++ + G     ++  PFD  K R+Q +      V+        + 
Sbjct: 193 LPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLL 252

Query: 66  DLIKNEGPMGFYKGTLTPLVGVG 88
            + + EG    YKG +  ++ +G
Sbjct: 253 TIYREEGFRALYKGFVPKVLRLG 275

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 88.2 bits (217), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 126/284 (44%), Gaps = 39/284 (13%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKV-------------IKDLIKN 70
           I   ++G   GI+++ V  P D  K R Q   T+  A  V             +K ++K 
Sbjct: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72

Query: 71  EGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF--DEAASQHLSLLQYYICGVAG 128
           EG    Y+G  +P++      + +F  N+  ++ F         +Q +S+      G + 
Sbjct: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISI----AAGASA 128

Query: 129 GFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRE 185
           G T + +  P E I+IR+Q    S     + GP+DC+KK   N  +M   +G+  TM R 
Sbjct: 129 GMTEAAVIVPFELIKIRMQDVKSS-----YLGPMDCLKKTIKNEGIMGLYKGIESTMWRN 183

Query: 186 SHGCGVYF-LTYE---ALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKS 241
           +   G YF + Y+   ++   + K    R D+ A      GA  GT+   +  P DV+KS
Sbjct: 184 ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIA------GAIGGTVGTMLNTPFDVVKS 237

Query: 242 VMQT-DNLKTPKNGNNILTVGRTIIAR-QGVSGLFKGFAPTMLR 283
            +Q+ D + +     N       +I R +G   L+KGF P + R
Sbjct: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 7/88 (7%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-------VIKDLIKNEGPMGFYK 78
           DL+AG  GG    ++  PFD  K R+Q+ +  ++AVK        +  + + EG    YK
Sbjct: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFH 106
           G +  +  +    SL   V   M  FF 
Sbjct: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFR 301

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 211 KDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTP---------KNGNNILTVG 261
           K +P     + GA +G    T++YPLDV+K+  Q + + TP         +  N ++   
Sbjct: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLE-VTTPTAAAVGKQVERYNGVIDCL 66

Query: 262 RTIIARQGVSGLFKGFAPTML 282
           + I+ ++G S L++G +  ML
Sbjct: 67  KKIVKKEGFSRLYRGISSPML 87

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 87.8 bits (216), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 138/288 (47%), Gaps = 26/288 (9%)

Query: 14  LESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-------VKVIKD 66
           + S   ++    +L+AG   G+ + L   P DT KVR+Q  + +  +       +K   +
Sbjct: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60

Query: 67  LIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT-FDEAASQHLSLLQYYICG 125
           + +NEG + FYKG    ++G+   ++++F   E    F+ T   +  +  +S    +I G
Sbjct: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAG 116

Query: 126 VAGGFTNS-FLASPIEHIRIRLQTQ--TGSGATAEFKGPID-CIKKLRVNG--QLMRGLT 179
           V  G T +  + +P+E ++IRLQ Q         ++K  +  C   ++  G   L RG++
Sbjct: 117 VGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVS 176

Query: 180 PTMLRESHGCGVYFLTYEALIGHQVKSGIQRKD-IPAWKLCLFGAASGTLLWTMVYPLDV 238
            T  R++   G  F  Y  L   +   G   ++ +P+W+  L G  SG +      PLD 
Sbjct: 177 LTAARQATNQGANFTVYSKL--KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDT 234

Query: 239 IKSVMQTDNLKTPKNGN---NILTVGRTIIARQGVSGLFKGFAPTMLR 283
           IK+ +Q D  K+ KN +    I  +G+ +I  +G   L+KG  P ++R
Sbjct: 235 IKTRLQKD--KSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 81/198 (40%), Gaps = 22/198 (11%)

Query: 27  LLAGTAGGIAQVLVGQPFDTT-KVRLQTSETS--------TNAVKVIKDLIKNEGPMGFY 77
            +AG   GI + +V        K+RLQ    +         NAV+    ++K EG    Y
Sbjct: 113 FIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALY 172

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRF---FHTFDEAASQHLSLLQYYICGVAGGFTNSF 134
           +G               F V   +K F   +H  +   S   SL+   I G  G F+N+ 
Sbjct: 173 RGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGL-ISGAIGPFSNA- 230

Query: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQ----LMRGLTPTMLRESHGCG 190
              P++ I+ RLQ    +   +  K  I  I K  +  +    L +G+TP ++R + G  
Sbjct: 231 ---PLDTIKTRLQKDKSTKNMSGLK-RITIIGKQLIQEEGFRALYKGITPRVMRVAPGQA 286

Query: 191 VYFLTYEALIGHQVKSGI 208
           V F  YE +     K+G+
Sbjct: 287 VTFTAYEFIRKELEKTGV 304

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 85.9 bits (211), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 125/278 (44%), Gaps = 25/278 (8%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA--------VKVIKDLIKNEGPMGFY 77
           +L+AG   G+ + L   P DT KVR+Q                +K  + + + EG +  Y
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFFHT-FDEAASQHLSLLQYYICGVAGGFTNSFL- 135
           KG    ++G+   ++++F   E    F+ T      S  +S    ++ GV  G T + L 
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYE----FYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLV 128

Query: 136 ASPIEHIRIRLQTQ----TGSGATAEFKGPIDC---IKKLRVNGQLMRGLTPTMLRESHG 188
            +P+E ++IRLQ Q    +   A  ++   I     I K      L RG++ T  R++  
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 189 CGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTD-- 246
            G  F  Y  L    +++  Q   +P+W+    G  SG +      PLD IK+ +Q D  
Sbjct: 189 QGANFTVYSKL-KEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKS 247

Query: 247 -NLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            +L+       I+T+G  ++  +G   L+KG  P ++R
Sbjct: 248 ISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMR 285

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 85/215 (39%), Gaps = 33/215 (15%)

Query: 27  LLAGTAGGIAQ-VLVGQPFDTTKVRLQTSETS----------TNAVKVIKDLIKNEGPMG 75
            +AG   GI + VLV  P +  K+RLQ    +           NA+     ++K EG   
Sbjct: 114 FVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSA 173

Query: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRF---FHTFDEAASQHLSLLQYYICGVAGGFTN 132
            Y+G               F V   +K F   +H  D   S   S +   I G  G F+N
Sbjct: 174 LYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGL-ISGAIGPFSN 232

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMR---------GLTPTML 183
           +    P++ I+ RLQ       +   +      K + +  QL++         G+TP ++
Sbjct: 233 A----PLDTIKTRLQKDK----SISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVM 284

Query: 184 RESHGCGVYFLTYEALIGHQVKSGIQRK-DIPAWK 217
           R + G  V F  YE +  H    GI +K D P  K
Sbjct: 285 RVAPGQAVTFTVYEYVREHLENLGIFKKNDTPKPK 319

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 87.0 bits (214), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 72/266 (27%), Positives = 112/266 (42%), Gaps = 16/266 (6%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETST---NAVKVIKDLIKNEGPMGFYKGTLTPL 84
           L   AG I   +V  P D  K R+Q   + +   N++     ++  EG  G Y G    L
Sbjct: 549 LGSVAGCIGATIV-YPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQL 607

Query: 85  VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRI 144
           +GV    +++  VN+ M+       +  +  L LL   I G + G       +P+E ++I
Sbjct: 608 IGVAPEKAIKLTVNDYMRNKL----KDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKI 663

Query: 145 RLQTQ---TGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTY----E 197
           RLQ +       A       +  IK+L + G L +G    +LR+     +YF TY     
Sbjct: 664 RLQVKGEYVAENAENAKLTALQIIKRLGLPG-LYKGAAACLLRDVPFSAIYFPTYAHLKR 722

Query: 198 ALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNI 257
            L         +R  +  W+L   GA +G     +  P DVIK+ +Q D  K       I
Sbjct: 723 DLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGI 782

Query: 258 LTVGRTIIARQGVSGLFKGFAPTMLR 283
           +   RTI+  +     FKG A  +LR
Sbjct: 783 IHAARTILREESFKSFFKGGAARVLR 808

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 48/186 (25%), Positives = 77/186 (41%), Gaps = 12/186 (6%)

Query: 23  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----TSETSTNAVKVIKDLIKNEGPMGFY 77
           ++ ++++G + G  QV+   P +  K+RLQ      +E + NA      +IK  G  G Y
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLY 696

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFFHTF---DEAASQHLSLLQYYICGVAGGFTNSF 134
           KG    L+      ++ F     +KR    F   D+     L+  +    G   G   ++
Sbjct: 697 KGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAY 756

Query: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-LRVNG--QLMRGLTPTMLRESHGCGV 191
           L +P + I+ RLQ     G T  +KG I   +  LR        +G    +LR S   G 
Sbjct: 757 LTTPFDVIKTRLQIDPKKGETI-YKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGF 815

Query: 192 YFLTYE 197
               YE
Sbjct: 816 TLAAYE 821

>Scas_662.12
          Length = 308

 Score = 85.1 bits (209), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 130/294 (44%), Gaps = 34/294 (11%)

Query: 18  HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA------VKVIKDLIKNE 71
           H+ T + K++++G + G    L+  P D  KVRLQ   T+T          +I +LI N 
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 72  GPMG-----------FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
             MG            Y+G    L+G     SL F +  + K +    +   + + ++  
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTI-- 119

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRG 177
           +   G+  G + + L +P+  I+ R+ + T       +K      K L        +  G
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIMS-TSRHHKDSYKSIRHGFKSLLTKEGPKAIWMG 178

Query: 178 LTPTMLRESHGCGVYFLTYEALIGH-QVKSGIQRKD--IPAWKLCLFGAASGTLLWTMVY 234
           L P++L  S G  +YF+ Y+ L  H  V     +KD      K+ L  + S  L    VY
Sbjct: 179 LLPSLLGVSQG-AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVY 237

Query: 235 PLDVIKSVMQ-----TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           P  ++KS +Q     T+N+  P+N  + +T+ R I    G+ GL+KG +  +LR
Sbjct: 238 PFQLLKSNLQTFRSVTNNI--PQNDYHFITLIRKIYRDNGIKGLYKGLSANLLR 289

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 122/283 (43%), Gaps = 35/283 (12%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS----------------TNAVKVIKDL 67
           I    AG   G++++LV  P D  K R+Q   T+                T  +  +  +
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKI 71

Query: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVA 127
           +K EG    YKG  +P++      +++F  N+  + F+       +  ++       G +
Sbjct: 72  VKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGAS 131

Query: 128 GGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG---QLMRGLTPTMLR 184
            G   +F+ +P E ++IRLQ        ++FK PI+ +K   V G    L  GL  T+ R
Sbjct: 132 AGAVEAFVVAPFELVKIRLQD-----VNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWR 186

Query: 185 E----SHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIK 240
                +   G+ F   + L   +  +   R D+ A      GA  GT+   +  P DV+K
Sbjct: 187 HVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIA------GAIGGTVGCLLNTPFDVVK 240

Query: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           S +Q  +    K   ++ +V   +   +G   L+KGFAP ++R
Sbjct: 241 SRIQRSSGPLRKYNWSLPSV-LLVYREEGFKALYKGFAPKVMR 282

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN----A 60
           F   +L+   ++  + TR   DL+AG  GG    L+  PFD  K R+Q S         +
Sbjct: 199 FQIRKLLPAAKTSTEKTR--NDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWS 256

Query: 61  VKVIKDLIKNEGPMGFYKG 79
           +  +  + + EG    YKG
Sbjct: 257 LPSVLLVYREEGFKALYKG 275

>Kwal_47.17321
          Length = 881

 Score = 85.1 bits (209), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 115/274 (41%), Gaps = 24/274 (8%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST---NAVKVIKDLIKNEGPMGFYKGT 80
           I + L G+  G        P D  K R+Q     +   N++     +   EG  G Y G 
Sbjct: 501 IYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGL 560

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
              LVGV    +++  VN+ +++     DE  +  L+L    I G A G       +P+E
Sbjct: 561 GPQLVGVAPEKAIKLTVNDYVRKLL--MDE--NNRLTLPLEIISGAAAGACQVIFTNPLE 616

Query: 141 HIRIRLQTQT-------GSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYF 193
            ++IRLQ ++        S  TA     +  +K L + G L +GL   ++R+     +YF
Sbjct: 617 IVKIRLQVRSEYADSLPKSQLTA-----LGVVKSLGLRG-LYKGLVACLMRDVPFSAIYF 670

Query: 194 LTYEAL----IGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLK 249
            TY  L      +  +   +R  +  W+L   G  +G     +  P DVIK+ +Q D  K
Sbjct: 671 PTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRK 730

Query: 250 TPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
                  IL   RTI+  +     FKG    +LR
Sbjct: 731 GETRYTGILHAARTILKEERFKSFFKGGGARVLR 764

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 117/266 (43%), Gaps = 12/266 (4%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSETSTNAVKVIKDLIKNEGPMG--FYKG 79
           K++++G   G    L+  P D  KVRLQ   TS T      +  +++ ++  +    Y+G
Sbjct: 10  KEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRELYRG 69

Query: 80  TLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAA--SQHLSLLQYYICGVAGGFTNSFLAS 137
               LVG      L F      K +   ++      + LS   Y     + G   + L +
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTN 129

Query: 138 PIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
           P+  I+ R+ ++  S  T+  K   D IK   V G L +GL P ++  S G  ++F  Y+
Sbjct: 130 PLWVIKTRMMSKANSDLTS-MKVLRDLIKNDGVQG-LWKGLVPALVGVSQG-ALHFTCYD 186

Query: 198 ALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNI 257
            L    V       +I   +     + S  L  + VYP  ++KS +Q+   +  +N   +
Sbjct: 187 TLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQS--FQASENDFKL 244

Query: 258 LTVGRTIIARQGVSGLFKGFAPTMLR 283
           L + + I +R G+ G +KG +  +LR
Sbjct: 245 LPLSKMIYSRSGLLGFYKGLSANLLR 270

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 3/66 (4%)

Query: 43  PFDTTKVRLQTSETSTNAVKVI---KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNE 99
           PF   K  LQ+ + S N  K++   K +    G +GFYKG    L+       + F + E
Sbjct: 224 PFQLLKSNLQSFQASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

Query: 100 AMKRFF 105
             K F 
Sbjct: 284 NFKSFL 289

>Kwal_0.232
          Length = 274

 Score = 77.0 bits (188), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 102/265 (38%), Gaps = 20/265 (7%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYK 78
           D +  I  LLAG A G +  L   P DT K RLQ +               N G +G Y+
Sbjct: 2   DRSSFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAA----------GGFFANGGYLGVYR 51

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRF----FHTFDEAASQHLSLLQYYICGVAGGFTNSF 134
           G  + +V      SL F   + MK +    F+    ++ Q      +     AG      
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACM 111

Query: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFL 194
           +  P E I+ R QT     +    K  +       +   L RG + T++RE     + F 
Sbjct: 112 VRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFP 171

Query: 195 TYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG 254
            YE L      SG  R+ +  W+    G  +G +      PLDV+K+ +   +   P   
Sbjct: 172 LYEFLKKQWAISG-GREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP--- 227

Query: 255 NNILTVGRTIIARQGVSGLFKGFAP 279
             +L + R I A +G    F G  P
Sbjct: 228 --VLHLARQIYATEGWKVFFSGVGP 250

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 1/70 (1%)

Query: 32  AGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACV 91
           AGGIA      P D  K RL  S TS   + + + +   EG   F+ G     V + A  
Sbjct: 201 AGGIAAATT-TPLDVLKTRLMLSHTSVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGG 259

Query: 92  SLQFGVNEAM 101
           ++  GV E +
Sbjct: 260 AIFLGVYETV 269

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 77.0 bits (188), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 127/296 (42%), Gaps = 37/296 (12%)

Query: 18  HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-----VIKDLIKNEG 72
           H  T + K++++G + G    LV  P D  KVRLQ S TS          VIK++I++  
Sbjct: 4   HQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSA 63

Query: 73  PMG------FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT---------FDEAASQH-L 116
             G       Y+G    L G      + FG+    K   +               + H +
Sbjct: 64  NSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKM 123

Query: 117 SLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-LRVNG--Q 173
           + L Y   G + G   + L +PI  I+ R+ + T  GA   +    + +++ LR +G   
Sbjct: 124 NSLIYLSAGASSGLMTAILTNPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQG 182

Query: 174 LMRGLTPTMLRESHGCGVYFLTYEALIGHQVKS------GIQRKDIPAWKLCLFGAASGT 227
           L +GL P +   S G  +YF  Y+ L   +++        I   ++   ++   G     
Sbjct: 183 LWKGLVPALFGVSQGA-LYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSV 241

Query: 228 LLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
              T+VYP  ++KS +Q+   +  +    +  + + IIA  G  GL+KG +  ++R
Sbjct: 242 ---TLVYPFQLLKSNLQS--FRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVR 292

 Score = 31.6 bits (70), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 33  GGIAQVLVGQPFDTTKVRLQT---SETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGA 89
           G +  V +  PF   K  LQ+   +E       +IK +I N+G +G YKG    LV    
Sbjct: 236 GKMVSVTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIP 295

Query: 90  CVSLQFGVNEAMK 102
              + F V E +K
Sbjct: 296 STCITFCVYENLK 308

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 127/285 (44%), Gaps = 41/285 (14%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS--------TNAVKVIKDLIKNEGPMG 75
           I   ++G A G++++LV  P D  K R+Q    S           +  +  ++K EG   
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68

Query: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD--EAASQHLSLLQYYICGVAGGFTNS 133
            YKG  +P++      + +F  N++ ++ F      +  +Q +S+L     G   G T +
Sbjct: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS----GSLAGVTEA 124

Query: 134 FLASPIEHIRIRLQTQTGSGATAEFKGPIDCI-KKLRVNG--QLMRGLTPTMLRESHGCG 190
            +  P E ++IRLQ        ++F GP++ + K +R  G   L  GL  TM R +   G
Sbjct: 125 CVIVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179

Query: 191 VYF---LTYEALIGHQVKSGIQR--KDIPAWKLCLFGAASGTLLWTMVYP-LDVIKSVMQ 244
            YF       AL+  + K+  ++   D+ A      G   G   ++  +  L V+KS +Q
Sbjct: 180 GYFGVIFQIRALL-PKAKTNTEKTTNDLIA------GTIGGYCRYSTEHTILSVVKSRIQ 232

Query: 245 TDNLKTPKNGNNILTVGRT------IIARQGVSGLFKGFAPTMLR 283
           +    T  +G  +     T      I + +G + L+KGF P +LR
Sbjct: 233 SGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILR 277

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 79/182 (43%), Gaps = 20/182 (10%)

Query: 112 ASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGS--GATAEFKGPIDC---IK 166
           + + L  +  ++ G A G +   +  P++ ++ R+Q Q GS  G+   + G IDC   I 
Sbjct: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61

Query: 167 KLRVNGQLMRGLTPTMLRESHGCGVYFL---TYEALIG--HQVKSGIQRKDIPAWKLCLF 221
           K     +L +G++  ML E+      F    +Y+ +    + V    Q+  I      L 
Sbjct: 62  KREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISI------LS 115

Query: 222 GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTM 281
           G+ +G     ++ P +++K  +Q  N K     N  + V    I   G+  L+ G   TM
Sbjct: 116 GSLAGVTEACVIVPFELVKIRLQDVNSKF----NGPMEVVFKTIRETGILSLYNGLESTM 171

Query: 282 LR 283
            R
Sbjct: 172 WR 173

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 208 IQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG---NNILTVGRTI 264
           +  K +P     + GAA+G     ++YPLDV+K+ MQ        +G   N ++     I
Sbjct: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60

Query: 265 IARQGVSGLFKGFAPTML 282
           + R+G S L+KG +  ML
Sbjct: 61  VKREGFSRLYKGISSPML 78

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 129/306 (42%), Gaps = 42/306 (13%)

Query: 8   PQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK----V 63
           P  I D      N   I  L  G AG +++ +V  PF+  K+ LQ   ++T+  +     
Sbjct: 11  PNSIKDFLKQDSN---IAFLAGGVAGAVSRTVV-SPFERVKILLQVQSSTTSYNRGIFSS 66

Query: 64  IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAM-KRFFHTFDEAASQHLSLLQYY 122
           I+ +   EG  G ++G     + +    ++QF V EA  K+ FH       + L+  Q  
Sbjct: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL 126

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-----------LRVN 171
             G   G  +     P++ I+ RL  QT + ++   +     I K            R+ 
Sbjct: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLN-RSKAKSISKPPGIWQLLSETYRLE 185

Query: 172 G---QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLF----GAA 224
           G    L RG+ PT L       + F  YE L    V S   +   P+WK  L+    GA 
Sbjct: 186 GGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQ---PSWKSNLYKLTIGAI 242

Query: 225 SGTLLWTMVYPLDVIKSVMQTDNLKTPKNG-------NNILTVGRTIIARQGVSGLFKGF 277
           SG +  T+ YP D+++   Q   +   + G       + ++T+GR     +GVSG +KG 
Sbjct: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRA----EGVSGYYKGL 298

Query: 278 APTMLR 283
           A  + +
Sbjct: 299 AANLFK 304

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 82/198 (41%), Gaps = 25/198 (12%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRL--QTSETST-------------NAVKVIKDLIK 69
           + L +G   G   V+   P D  K RL  QT+  S+                +++ +  +
Sbjct: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYR 183

Query: 70  NEGPM-GFYKGTLTPLVGVGACVSLQFGVNEAMKRF-FHTFDEAASQHLSLLQYYICGVA 127
            EG + G Y+G     +GV   V+L F V E ++ F  ++ D   S   +L +  I  ++
Sbjct: 184 LEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAIS 243

Query: 128 GGFTNSFLASPIEHIRIRLQ------TQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPT 181
           GG   + +  P + +R R Q       + G   T+ +   +   +   V+G   +GL   
Sbjct: 244 GGVAQT-ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSG-YYKGLAAN 301

Query: 182 MLRESHGCGVYFLTYEAL 199
           + +      V +L YE +
Sbjct: 302 LFKVVPSTAVSWLVYEVV 319

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 111/274 (40%), Gaps = 27/274 (9%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN--------AVKVIKDLIKNEGPMGFYKG 79
           L+G   G    +   P D  K RLQ     T          +  +  ++++EGP G YKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 80  TLTPLVGVGACVSLQFGVNEAMKRFFH----TFDEAASQHLSLLQYYICGVAGGFTNSFL 135
            +  ++G      + F V E  K+FFH     FD  A             +  G  ++ L
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS--------CAAITAGAASTTL 193

Query: 136 ASPIEHIRIRLQTQTGSGA-TAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            +PI  ++ RL  Q+  G     +KG  D  +KL        L  GL P++L   H   +
Sbjct: 194 TNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFH-VAI 252

Query: 192 YFLTYEALI--GHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLK 249
           +F  YE L    H          I   +L +  + S  +   + YP +++++ MQ  +  
Sbjct: 253 HFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDI 312

Query: 250 TPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
                  +  + +   A++G+ G + GF   ++R
Sbjct: 313 PDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVR 346

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 123/276 (44%), Gaps = 25/276 (9%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQT----SETSTN-----AVKVIKDLIKNEGPMGF 76
           + ++G   G+   +V  P D  K RLQ     + T+ N     ++  +  ++++EG  G 
Sbjct: 71  NAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGL 130

Query: 77  YKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA 136
           YKG +  ++G      + F V E  K    T     S + S + +    +  G  ++ + 
Sbjct: 131 YKGLVPIIMGYFPTWMIYFSVYEFCKDNLRT----NSSNWSFVSHSFSAITAGAVSTVVT 186

Query: 137 SPIEHIRIRLQTQTGSGA-TAEFKGPIDCIKKLRVNGQ----LMRGLTPTMLRESHGCGV 191
           +PI  ++ RL  QT  G+ T  ++G  D  KK+ +N +    L  GL P++L   H   +
Sbjct: 187 NPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKI-INQEGVKALYAGLVPSLLGLLH-VAI 244

Query: 192 YFLTYEAL----IGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDN 247
           +F  YE L      +Q         I   +L L  + S  +   + YP +++++ +Q  +
Sbjct: 245 HFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKS 304

Query: 248 LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
              P +   ++ + +    ++G+ G + GF   + R
Sbjct: 305 -DLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFR 339

>Scas_602.8
          Length = 885

 Score = 75.5 bits (184), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 116/266 (43%), Gaps = 16/266 (6%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETST---NAVKVIKDLIKNEGPMGFYKGTLTPL 84
           L   AG I   LV  P D  K R+Q   + T   N++  +  +   EG  G Y G    L
Sbjct: 504 LGSVAGCIGATLV-YPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQL 562

Query: 85  VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRI 144
           +GV    +++  VN+ M++     D+    +L L    + G   G       +P+E ++I
Sbjct: 563 IGVAPEKAIKLTVNDFMRK--SLVDKKG--NLQLGAEVLSGATAGACQVVFTNPLEIVKI 618

Query: 145 RLQTQTGSGATAEFKGPI---DCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIG 201
           RLQ ++        K  +     IK+L++ G L +G+   +LR+     +YF TY  L  
Sbjct: 619 RLQVKSEYTNAMIPKSQLTAFQIIKELKLIG-LYKGVGACLLRDVPFSAIYFPTYAHLKK 677

Query: 202 HQVKSGIQRKD----IPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNI 257
           +  +     KD    +  W+L   GA +G     +  P DVIK+ +Q +          I
Sbjct: 678 NVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGI 737

Query: 258 LTVGRTIIARQGVSGLFKGFAPTMLR 283
           L   RTI+  +     FKG A  ++R
Sbjct: 738 LHAVRTILKEESFRSFFKGGAARVMR 763

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 79/194 (40%), Gaps = 34/194 (17%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV---------KVIKDLIKNEGPMGF 76
           ++L+G   G  QV+   P +  K+RLQ     TNA+         ++IK+L      +G 
Sbjct: 595 EVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKEL----KLIGL 650

Query: 77  YKGTLTPLVGVGACV-------SLQFGVNEAMKRFFHTF---DEAASQHLSLLQYYICGV 126
           YK       GVGAC+       ++ F     +K+    F   D+     L   +    G 
Sbjct: 651 YK-------GVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGA 703

Query: 127 AGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIK---KLRVNGQLMRGLTPTML 183
             G   +FL +P + I+ RLQ + G G T  + G +  ++   K        +G    ++
Sbjct: 704 LAGVPAAFLTTPFDVIKTRLQIEPGVGET-RYTGILHAVRTILKEESFRSFFKGGAARVM 762

Query: 184 RESHGCGVYFLTYE 197
           R S   G     YE
Sbjct: 763 RSSPQFGFTLAAYE 776

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 57/152 (37%), Gaps = 18/152 (11%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTS----ETS-TNAVKVIKDLIKNEGPMGFYKGTL 81
           L AG   G+    +  PFD  K RLQ      ET  T  +  ++ ++K E    F+KG  
Sbjct: 699 LTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGA 758

Query: 82  TPLVGVGACVSLQFGVNEAMKRFFHTFDEAA-SQHLSLLQYYICGVAGGFTNSFLAS--- 137
             ++             E  K  F+  D+   +++    + Y   V  G+ +SF +S   
Sbjct: 759 ARVMRSSPQFGFTLAAYELFKNMFNISDDKQPTKNEKSTEDYNDSVGTGYPSSFFSSMKY 818

Query: 138 ---------PIEHIRIRLQTQTGSGATAEFKG 160
                    P E+   R+   T +     FK 
Sbjct: 819 TPSYSYSNQPTEYFSPRIDPFTSNYLDYYFKS 850

>Kwal_23.4731
          Length = 314

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 129/294 (43%), Gaps = 36/294 (12%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---VKVIKDLIKNEGP-- 73
           D T + ++++AG A G    +   P D  K+RLQ    +T++    +VIK +I++     
Sbjct: 9   DFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADS 68

Query: 74  ---MGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF---------------DEAASQH 115
                 Y+G    L+G      L FG+    K   + +               D+A    
Sbjct: 69  NVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPS 128

Query: 116 LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---G 172
           L    Y       G   + L +PI  I+ R+ + T S A+  +K   D I+K+  +    
Sbjct: 129 L----YLASAALSGLGTAILTNPIWVIKTRIMS-TSSQASERYKTTWDGIRKVYAHEGFS 183

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYEALIGHQ--VKSGI-QRKDIPAWKLCLFGAASGTLL 229
              RGL P++   + G  +YF  Y++L  HQ   + GI + + +   +     + S  L 
Sbjct: 184 GFWRGLVPSLFGVAQGA-IYFTIYDSL-RHQYFARRGITEDEKMGNLENIAITSVSKMLS 241

Query: 230 WTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            T VYP  ++KS +Q+      ++      + ++I  ++G+ GL+KG +  +LR
Sbjct: 242 VTAVYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLR 295

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 76/188 (40%), Gaps = 17/188 (9%)

Query: 112 ASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK---- 167
           AS    L +  I G+A G   +    P++ +++RLQ    +  +  +K  I  I +    
Sbjct: 7   ASDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKA 66

Query: 168 -LRVNGQLMRGLTPTMLRESHGCGVYFLTYE-----------ALIGHQVKSGIQRKDIPA 215
              V  +  RGL   ++  S   G+YF  Y            A +    +S  Q+     
Sbjct: 67  DSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMG 126

Query: 216 WKLCLFGAA-SGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLF 274
             L L  AA SG     +  P+ VIK+ + + + +  +         R + A +G SG +
Sbjct: 127 PSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFW 186

Query: 275 KGFAPTML 282
           +G  P++ 
Sbjct: 187 RGLVPSLF 194

>Scas_709.9
          Length = 365

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 114/273 (41%), Gaps = 22/273 (8%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETST-------NAVKVIKDLIKNEGPMGFYKGT 80
           L+G   G    ++  P D TK RLQ     +         +  +  ++ +EG  G YKG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
           +  ++G      + F V E  K  +         +   + +    +  G  ++ L +PI 
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLY----PRVLPNSDFISHSCSAITAGAASTVLTNPIW 184

Query: 141 HIRIRLQTQTGSGAT-AEFKGPIDCIKKLRVNG---QLMRGLTPTMLRESHGCGVYFLTY 196
            ++ RL  QT  G +   ++G ID  KK+        L  GL P+M    H   ++F  Y
Sbjct: 185 VVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLH-VAIHFPVY 243

Query: 197 EALIGHQVKSGI------QRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKT 250
           E L        I      Q   +   +L +  +AS  L   + YP +++++ MQ  + K 
Sbjct: 244 EKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKL 303

Query: 251 PKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
             + + +L + +     +G+ G + GFA  +LR
Sbjct: 304 LISKHKLLDLIKRTYRYEGLLGFYSGFATNLLR 336

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 70.5 bits (171), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 113/263 (42%), Gaps = 16/263 (6%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSET-STNAVKVIKDLIKNEGPMGFYKGTLTPLVGVG 88
           G A GI  V+   P D TKVRLQ +       V++++ ++KNEG +G Y G    L+   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 89  ACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQT 148
              + +FG+ +A+K      D+  +    L    + G  GG   +F     + I IR+Q 
Sbjct: 73  TYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNF----ADLINIRMQN 128

Query: 149 QTG--SGATAEFKGPID-CIKKLRVNGQ---LMRGLTPTMLRESHGCGVYFLTYEALIGH 202
            +         +K  ID  +K  +  G     + G  P M+R         +TY+     
Sbjct: 129 DSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKNF 188

Query: 203 QV-KSGIQ-RKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTV 260
            V K  +  +K+       L      T   T+  P DVIK+++   + K   N ++   +
Sbjct: 189 LVTKYNMDPKKNSTHLTSSLLAGFVAT---TVCSPADVIKTIVMNAHKKPGHNHDSSFKI 245

Query: 261 GRTIIARQGVSGLFKGFAPTMLR 283
               I ++G S +F+G+ P+  R
Sbjct: 246 LMEAINKEGPSFMFRGWVPSFTR 268

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 214 PAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGL 273
           P W    +G A+G       +PLD+ K  +Q   +  P     I+ + R+I+  +G+ GL
Sbjct: 9   PWW----YGGAAGIFAVMNTHPLDLTKVRLQAAPIPKP----TIVQMLRSILKNEGIVGL 60

Query: 274 FKGFAPTMLR 283
           + G + ++LR
Sbjct: 61  YAGLSASLLR 70

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 127/308 (41%), Gaps = 55/308 (17%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE---------------------------- 55
           + +L+AG   G+ + L   P DT KVR+Q  +                            
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 56  TSTNAVK------VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT-F 108
            +T A+K        +++   EG +  YKG    ++G+   ++++F   E    F+ T  
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRTLL 127

Query: 109 DEAASQHLSLLQYYICGVAGGFTNSFL-ASPIEHIRIRLQTQ--------TGSGATAEFK 159
            +  +  +S    +I GV  G T + L  +P+E ++IRLQ Q             T   +
Sbjct: 128 ADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQ 187

Query: 160 GPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGH-QVKSGIQRKDIPAWKL 218
                IK+  ++  L RG++ T  R++   G  F  Y  L    Q   G +   +P+W+ 
Sbjct: 188 AGYTIIKEEGISA-LYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTE--TLPSWET 244

Query: 219 CLFGAASGTLLWTMVYPLDVIKSVMQTD---NLKTPKNGNNILTVGRTIIARQGVSGLFK 275
              G  SG +      PLD IK+ +Q D   + K       I  +G  ++  +G   L+K
Sbjct: 245 SCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYK 304

Query: 276 GFAPTMLR 283
           G  P ++R
Sbjct: 305 GITPRVMR 312

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 83/211 (39%), Gaps = 26/211 (12%)

Query: 27  LLAGTAGGIAQ-VLVGQPFDTTKVRLQTSETS----------TNAVKVIKDLIKNEGPMG 75
            +AG   G+ + VLV  P +  K+RLQ    +          TNAV+    +IK EG   
Sbjct: 141 FIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISA 200

Query: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFL 135
            Y+G               F V   ++ F   +    ++ L   +    G+  G    F 
Sbjct: 201 LYRGVSLTAARQATNQGANFTVYSKLREFLQEYH--GTETLPSWETSCIGLISGAIGPFS 258

Query: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMR---------GLTPTMLRES 186
            +P++ I+ RLQ    +     FKG     +   +  QL++         G+TP ++R +
Sbjct: 259 NAPLDTIKTRLQKDKST----SFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVA 314

Query: 187 HGCGVYFLTYEALIGHQVKSGIQRKDIPAWK 217
            G  V F  YE +  H    G+  K  P  K
Sbjct: 315 PGQAVTFTVYEFVRRHLENLGVFSKPTPKPK 345

>Scas_379.2
          Length = 301

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 114/288 (39%), Gaps = 24/288 (8%)

Query: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SETSTN 59
           T E  T + ID  E+  D+  +   LLAG   GI +  V  P D  K R+Q+  +++++N
Sbjct: 3   TSEISTAEEID-YEALPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSN 61

Query: 60  AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLL 119
            +  +  +   EG +  +KG  + ++G G   ++ F   E  K++    DE   Q    L
Sbjct: 62  MLSQMAKISTAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYL--IDEKDMQTHQPL 119

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMR 176
           +  + G         L +P + ++ R+Q  T +          +  K++  N        
Sbjct: 120 KTALSGTVATIAADALMNPFDTLKQRMQLNTNTTV-------WNVTKQIYKNEGFSAFYY 172

Query: 177 GLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPL 236
               T+          F+ YE+      K      D      CL G  SG     +  PL
Sbjct: 173 SYPTTLAMNIPFAAFNFMIYES----ATKFFNPTNDYNPLVHCLSGGLSGATCAAITTPL 228

Query: 237 DVIKSVMQ-----TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAP 279
           D IK+V+Q     + +L+  K  N      + I    G  G ++G  P
Sbjct: 229 DCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQP 276

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 87/203 (42%), Gaps = 15/203 (7%)

Query: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV 61
           T E+    LID  E      + +K  L+GT   IA   +  PFDT K R+Q + T+T   
Sbjct: 99  TYEYTKKYLID--EKDMQTHQPLKTALSGTVATIAADALMNPFDTLKQRMQLN-TNTTVW 155

Query: 62  KVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQY 121
            V K + KNEG   FY    T L       +  F + E+  +FF+  ++      + L +
Sbjct: 156 NVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYESATKFFNPTND-----YNPLVH 210

Query: 122 YICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-----LRVNGQ--L 174
            + G   G T + + +P++ I+  LQ +     + +     +  +K      +V+G    
Sbjct: 211 CLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGF 270

Query: 175 MRGLTPTMLRESHGCGVYFLTYE 197
            RGL P +        + +  YE
Sbjct: 271 WRGLQPRVFANMPATAIAWTAYE 293

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 116/283 (40%), Gaps = 34/283 (12%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS------TNAVKVIKDLIKNEG 72
            N    K LLAG   G+    +  P DT K+RLQ +  +      +  ++V + +IKNEG
Sbjct: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEG 71

Query: 73  PMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTN 132
              F+KG +   +      S QF       R+   F   A  H SL    + G   G T+
Sbjct: 72  IRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLH-SL----VVGAFAGITS 126

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVY 192
           S ++ P + +R RL       + +  +   D I KL       +G   +M   +    + 
Sbjct: 127 SIVSYPFDVLRTRLVANNQMHSMSITREVRD-IWKLEGLPGFFKGSIASMTTITLTASIM 185

Query: 193 FLTYEALIGHQVKSGIQRKDIPA---WKLCLFGAASGT----LLWTMVYPLDVIKSVMQT 245
           F TYE +   ++      K   A   W+L     ++GT    +   + +PL+ I+  MQ 
Sbjct: 186 FGTYETI---RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQF 242

Query: 246 DNLKTPK------------NGNNILTVGRTIIARQGVSGLFKG 276
            N K  +             G     +G  I+ ++GVS L++G
Sbjct: 243 MNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 7/152 (4%)

Query: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSET--STN 59
           + +F +  L +   +P      +  L+ G   GI   +V  PFD  + RL  +    S +
Sbjct: 91  SAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS 150

Query: 60  AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQH---- 115
             + ++D+ K EG  GF+KG++  +  +    S+ FG  E ++ +    ++  + H    
Sbjct: 151 ITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWE 210

Query: 116 LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQ 147
           L+ L +   G  GG     +  P+E IR R+Q
Sbjct: 211 LATLNHS-AGTIGGVIAKIITFPLETIRRRMQ 241

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 9/74 (12%)

Query: 211 KDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKN-----GNNILTVGRTII 265
           +++ AWK  L GA SG L  ++  P+D IK  +Q     TP N     G+ ++ V R++I
Sbjct: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL----TPANGLKPFGSQVMEVARSMI 67

Query: 266 ARQGVSGLFKGFAP 279
             +G+   +KG  P
Sbjct: 68  KNEGIRSFWKGNIP 81

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 133/296 (44%), Gaps = 31/296 (10%)

Query: 12  DDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST----NAVKVIKDL 67
           + +++ + N   I  +  G  G +++ +V  P +  K+ LQ   ++T      V  +K +
Sbjct: 6   NYIQTVYKNDGFIAFVAGGVGGAVSRTVV-SPVERVKILLQVQSSTTAYNGGLVHAVKQV 64

Query: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK-RFFHTFDEAASQHLSLLQYYICGV 126
            K EG  G ++G     + +    ++Q+ V E  K R FH   ++  + L   +  + G 
Sbjct: 65  YKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERLVGGA 123

Query: 127 AGGFTNSFLASPIEHIRIRLQTQTGSGATAEFK---------GPIDCIKKL-RVNGQL-- 174
            GG  +  +  P++ +R RL  QT + A              G ++ ++++ R  G L  
Sbjct: 124 LGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRG 183

Query: 175 -MRGLTPTMLRESHGCGVYFLTYE---ALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLW 230
             RG+ PT L       + F  YE   ALI H   +G     + A KL + GA SG +  
Sbjct: 184 WYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAG----SVAAAKLAI-GAVSGGIAQ 238

Query: 231 TMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTI--IARQ-GVSGLFKGFAPTMLR 283
           T+VYP D+++   Q   +   + G    +V   +  I RQ G+ G +KG    +++
Sbjct: 239 TVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVK 294

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 44/102 (43%), Gaps = 13/102 (12%)

Query: 17  PHD----NTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-----SETSTNAVKVIKDL 67
           PHD    +    K  +   +GGIAQ +V  PFD  + R Q      SE       V   L
Sbjct: 214 PHDYDAGSVAAAKLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADAL 272

Query: 68  I---KNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFH 106
               + EG  G+YKG    LV V   +++Q+ V E +    H
Sbjct: 273 WTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELISENMH 314

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 70/164 (42%), Gaps = 21/164 (12%)

Query: 4   EFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST----- 58
           EF   ++    +S H+  R  + L+ G  GG A VLV  P D  + RL     +      
Sbjct: 96  EFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHR 155

Query: 59  ----------NAVKVIKDLIKNEGPM-GFYKGTLTPLVGVGACVSLQFGVNEAMKRFF-H 106
                       V++++ + + EG + G+Y+G     +GV   V+L F + E +K    H
Sbjct: 156 SKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPH 215

Query: 107 TFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQT 150
            +D  +     L    I  V+GG   + +  P + +R R Q  T
Sbjct: 216 DYDAGSVAAAKLA---IGAVSGGIAQT-VVYPFDLLRRRFQVLT 255

>Scas_589.10
          Length = 316

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 127/296 (42%), Gaps = 59/296 (19%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSETSTNAVKVIKD------------L 67
           I   ++G   G+++ ++  P D  K R Q        +T++V V K             +
Sbjct: 14  IYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKI 73

Query: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA-----MKRFFHTFDEAASQHLSLLQYY 122
           +K EG    YKG   PL+      +++F  NE      MK+F     E  S  ++LL   
Sbjct: 74  LKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKF--KLKEVTST-VTLL--- 127

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLT 179
             G   G T S +  P E ++IRLQ      A ++++ PI C + +  N  L     G  
Sbjct: 128 -AGTFAGITESLIVVPFELVKIRLQ-----DAQSDYRSPIRCTRTIIENQGLFGIYAGFE 181

Query: 180 PTMLRESHGCGVYFLTYEALIGHQVKSGIQR-KDIPAWKLC----LFGAASGTLLWTMVY 234
            T+ R +    ++  +Y  LI  QVK  I R K    ++      L GA +G +   +  
Sbjct: 182 STIWRNT----IWNASYFGLI-FQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSV 236

Query: 235 PLDVIKSVMQTDNLKTPKNG-------NNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           P DV+K+ MQ    K   +G        ++  + RT    +G+ G++KG  P + R
Sbjct: 237 PFDVVKTRMQGS--KKTSSGMCYGWAWQSVFLIYRT----EGIKGIYKGILPIICR 286

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 85/177 (48%), Gaps = 5/177 (2%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-VKVIKDLIKNEGPMGFYKGTLTPLV 85
           LLAGT  GI + L+  PF+  K+RLQ +++   + ++  + +I+N+G  G Y G  + + 
Sbjct: 126 LLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIW 185

Query: 86  GVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIR 145
                 +  FG+   +K+F     ++ ++   +   ++ G   G  + FL+ P + ++ R
Sbjct: 186 RNTIWNASYFGLIFQVKKFIPR-AKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTR 244

Query: 146 LQ--TQTGSGATAEFKG-PIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEAL 199
           +Q   +T SG    +    +  I +      + +G+ P + R   G G+  + +  +
Sbjct: 245 MQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGV 301

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 80/184 (43%), Gaps = 22/184 (11%)

Query: 115 HLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATA----------EFKGPIDC 164
            L  +  +I G   G + + +  P++ ++ R Q Q    A A          E    + C
Sbjct: 10  KLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSC 69

Query: 165 IKK-LRVNG--QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLF 221
           + K L+  G   L +G++P +L E     V F + E      +K   + K++ +    L 
Sbjct: 70  LSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKK-FKLKEVTSTVTLLA 128

Query: 222 GAASGTLLWTMVYPLDVIKSVMQ--TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAP 279
           G  +G     +V P +++K  +Q    + ++P      +   RTII  QG+ G++ GF  
Sbjct: 129 GTFAGITESLIVVPFELVKIRLQDAQSDYRSP------IRCTRTIIENQGLFGIYAGFES 182

Query: 280 TMLR 283
           T+ R
Sbjct: 183 TIWR 186

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 49/116 (42%), Gaps = 12/116 (10%)

Query: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN----- 59
           F   + I   +S      +  D L G   G     +  PFD  K R+Q S+ +++     
Sbjct: 199 FQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYG 258

Query: 60  -AVKVIKDLIKNEGPMGFYKGTLTPLV-----GVGACVSLQFGVNEAMKRFFHTFD 109
            A + +  + + EG  G YKG L P++     G G  + +  GVNE  +   H F 
Sbjct: 259 WAWQSVFLIYRTEGIKGIYKGIL-PIICRYGPGGGLLLVVFNGVNELFRMSDHYFQ 313

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 66.2 bits (160), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 130/317 (41%), Gaps = 50/317 (15%)

Query: 13  DLESPHDNTRVIKDLLAG----TAGGIAQVL---VGQPFDTTKV----RLQTSETSTNA- 60
           DL S  D T +I D + G     AGGI+ V+      PFD  KV    R   S T  N+ 
Sbjct: 184 DLSSEGDMT-LINDFIKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNST 242

Query: 61  -------------------VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAM 101
                              VK I  L +  G   FY G     + V    S++FG  E  
Sbjct: 243 EDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEIT 302

Query: 102 KRFFHTFDEAA-SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKG 160
           K+     +    ++ LS L  +I G   G    F   PI+ ++ R+Q    +   AE KG
Sbjct: 303 KKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQC---APLNAELKG 359

Query: 161 P---IDCIKKLRVNGQL---MRGLTPTML----RESHGCGVYFLTYEALIGHQVKS-GIQ 209
               I   K++   G L    RG+T  +L      +   G + +  +  I  + K    +
Sbjct: 360 RKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKK 419

Query: 210 RKDIPAWKLCLF--GAASGTLLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIA 266
            +D+    L +   GA SGT   T+VYP++++++ +Q       P   +    V    I 
Sbjct: 420 EEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQ 479

Query: 267 RQGVSGLFKGFAPTMLR 283
           R+G  GLFKG  PT+ +
Sbjct: 480 REGYPGLFKGLVPTLAK 496

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 94/220 (42%), Gaps = 27/220 (12%)

Query: 4   EFPTPQLIDDLESPHDNTRVIKDL------LAGTAGGIAQVLVGQPFDTTKVRLQTSETS 57
           +F + ++   L +  +N +  KDL      +AG   G+       P DT K R+Q +  +
Sbjct: 295 KFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLN 354

Query: 58  TN------AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEA 111
                    ++  K++    G   FY+G    ++G+    +L  G    +K+++ +   +
Sbjct: 355 AELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYIS---S 411

Query: 112 ASQHLSL------LQYYICGVAGGFTNSFLAS---PIEHIRIRLQTQTGSGATAEFKGPI 162
            ++ L+       L   +    G F+ +F A+   PI  +R RLQ Q        + G  
Sbjct: 412 KAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFR 471

Query: 163 DCI-KKLRVNGQ--LMRGLTPTMLRESHGCGVYFLTYEAL 199
           D + K ++  G   L +GL PT+ +      + +L YE L
Sbjct: 472 DVLLKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENL 511

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 129/281 (45%), Gaps = 24/281 (8%)

Query: 18  HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---ETSTNAVKVIKDLI-KNEGP 73
           H+ T + +++++G   G    +   P D  K+RLQ S     +T    +I+D+  + +  
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWG 62

Query: 74  MGFYKGTLTPLVGVGACVSLQFGVNEAMK--RFFHTFDEAAS----QHLSLLQYYICGVA 127
              Y+G    L+G     +L FG     K     H  +E+A+    + L    Y +   +
Sbjct: 63  RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGS 122

Query: 128 GGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNGQL--MRGLTPTMLR 184
            G   + L +PI  I+ R+   + +G    +K   D + KL +  G L   RG+ P++L 
Sbjct: 123 SGIATAVLTNPIWVIKTRIMATSRAG---PYKSTFDGVYKLYQTEGVLAFWRGVVPSLLG 179

Query: 185 ESHGCGVYFLTYEALIGHQVKSGIQRKD--IPAWKLCLFGAASGTLLWTMVYPLDVIKSV 242
            S G  +YF  Y+ L  H + S   + +  +   ++      S  +  T VYP  ++KS 
Sbjct: 180 VSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSK 238

Query: 243 MQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           +Q  +   P   + I  + +T+ +R+G+ G ++G +  +LR
Sbjct: 239 LQ--DFGAP---SGITQLVQTVYSREGIRGFYRGLSANLLR 274

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 27/60 (45%)

Query: 43  PFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
           PF   K +LQ     +   ++++ +   EG  GFY+G    L+       + F V E +K
Sbjct: 231 PFQLLKSKLQDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 120/268 (44%), Gaps = 31/268 (11%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN-AVKVIKDLIKNEGPMGFYKGTLTPLVG 86
           +AG+ GG A + V  P  T    LQT E      ++ IK++    G +G++ G  + + G
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLESAVYG 75

Query: 87  VGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRL 146
           +     + +   E   +   T      Q+LS  +  +     G   +  ++PI     R+
Sbjct: 76  MATTNFVYYYFYEWCAKTARTL--TTKQYLSTWESILASTIAGSMTAVASNPIWVANTRM 133

Query: 147 QTQTGSGATAEFKGPIDCIKKLRVNG--QLMRGLTPTMLRESHGCGVYFLTYEALIGHQV 204
                + +T   +  ID +K    +G   L+ GL P ++  S+   + +  YE L    +
Sbjct: 134 TVAKSNHST--LRTVIDIVK---TDGPLTLLNGLKPALVLVSNPI-IQYTVYEQLKNLVL 187

Query: 205 KSGIQRKDI--PAWKLCLFG----AASGTLLWTMVYPLDVIKS---VMQTDNLKTPKNGN 255
           +  +QRK +  P+W   L      AA+GT      YP   +K+   +MQ D    PK+  
Sbjct: 188 R--LQRKKVLSPSWAFLLGAIGKLAATGT-----TYPYITLKTRMHLMQND----PKHQK 236

Query: 256 NILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++ ++   I+ + GVSGL+ G A  +++
Sbjct: 237 SMWSLIVEIVKKDGVSGLYNGVAVKLVQ 264

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPL 84
           + +LA T  G    +   P      R+  ++++ + ++ + D++K +GP+    G    L
Sbjct: 107 ESILASTIAGSMTAVASNPIWVANTRMTVAKSNHSTLRTVIDIVKTDGPLTLLNGLKPAL 166

Query: 85  VGVGACVSLQFGVNEAMKRF 104
           V V   + +Q+ V E +K  
Sbjct: 167 VLVSNPI-IQYTVYEQLKNL 185

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 110/303 (36%), Gaps = 54/303 (17%)

Query: 8   PQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS---------T 58
           P+L  D E+  +N  ++  L AG   GI +  +  P D  K R+Q   T+         +
Sbjct: 4   PEL--DYEALPENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPS 61

Query: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSL 118
           N +  I  +   EG +  +KG  + ++G G   ++ F   E  K      D    Q    
Sbjct: 62  NMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCKS--RLIDPEDRQTHQP 119

Query: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGL 178
           L+  + G         L +P + I+ RLQ             P D + K  V        
Sbjct: 120 LKTALSGTLATVAADALMNPFDTIKQRLQLH-----------PSDSMTKCAVR------- 161

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQV--------------KSGIQRKDIPAWKLCLFGAA 224
               + +  G   +F +Y   I   +              K      +   W  CL G  
Sbjct: 162 ----MYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYNPWIHCLCGGI 217

Query: 225 SGTLLWTMVYPLDVIKSVMQ---TDNLKTP--KNGNNILTVGRTIIARQGVSGLFKGFAP 279
           SG     +  PLD +K+V+Q    D++++   K  +        I    G SG F+G  P
Sbjct: 218 SGATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKP 277

Query: 280 TML 282
            ++
Sbjct: 278 RII 280

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 120/283 (42%), Gaps = 32/283 (11%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQT-------SETSTNAVKVIKD------LIKNE 71
           K++++G   G    +V  P D  K+RLQ        S       ++IKD      L+K  
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 72  GPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF-DEAASQH-------LSLLQYYI 123
                Y+G    ++G      L FG+    K   ++   E A Q+       ++   Y +
Sbjct: 74  -----YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLV 128

Query: 124 CGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTML 183
              A G   + L +P+  I+ R+ +   S         I  I          RGL P++ 
Sbjct: 129 SAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLF 188

Query: 184 RESHGCGVYFLTYEALIGHQV--KSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKS 241
             + G  +YF  Y+ L    +  ++ IQ + + A +     + S  +  + VYPL ++K+
Sbjct: 189 GVTQGA-LYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKT 247

Query: 242 VMQTDNLKTPKNGNNIL-TVGRTIIARQGVSGLFKGFAPTMLR 283
            +QT   +T  N N+ + ++ R+I    G++G +KG    ++R
Sbjct: 248 NLQT--FRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVR 288

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 26/64 (40%), Gaps = 4/64 (6%)

Query: 43  PFDTTKVRLQTSETSTNAVKVIKDLIKN----EGPMGFYKGTLTPLVGVGACVSLQFGVN 98
           P    K  LQT  T  N    +  LI++     G  GFYKG    LV       + FGV 
Sbjct: 241 PLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVY 300

Query: 99  EAMK 102
           E  K
Sbjct: 301 EHFK 304

>Kwal_55.20868
          Length = 380

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 125/293 (42%), Gaps = 41/293 (13%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIK-------DLIKNE 71
           D+T  I  L    AG +A V V  P D  K RLQ     +N     K        +I++E
Sbjct: 73  DDTE-ITALSGAMAGFLAGVTVC-PLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDE 130

Query: 72  GPMGFYKGTLTPLVGVGACVSLQFGVNEAMK----RFFHTFDEAASQHLSLLQYYICGVA 127
           G  G YKG +  ++G      + F V E  K    R F +FD         + +    + 
Sbjct: 131 GARGLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFD--------FISHSASALT 182

Query: 128 GGFTNSFLASPIEHIRIRLQTQTG-SGATAEFKGPIDCIKKLRVNGQL---MRGLTPTML 183
            G  ++ L +P+  ++ RL  QT  +  +  +    D   K+     L     GL P++L
Sbjct: 183 AGTVSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL 242

Query: 184 RESHGCGVYFLTYEAL--IGHQVKSGIQRKD--IPAWKLCLFGAASGTLLWTMVYPLDVI 239
              H   ++F  YE L    H   S  + +D  +   +L +  +AS  +  T+ YP +++
Sbjct: 243 GLFH-VAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEIL 301

Query: 240 KSVMQ-----TDNL----KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++ MQ     TD L    KT ++G  ++ + +     +G+ G + GF   + R
Sbjct: 302 RTRMQLKAYPTDPLAALQKTSRHG--LIRLIKHTYKSEGLRGFYSGFTANLAR 352

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 114/284 (40%), Gaps = 19/284 (6%)

Query: 8   PQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE----TSTNAVKV 63
           P  + D E+   +  +   L+AG   GI +  V  P D  K R+Q++     ++ N +  
Sbjct: 18  PMDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQ 77

Query: 64  IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYI 123
           I  +  +EG +  +KG  + ++G G   ++ FG  E  K+  +  D + +Q     +  I
Sbjct: 78  ISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKK--NLIDSSDTQTHHPFKTAI 135

Query: 124 CGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTML 183
            G      +  L +P + I+ R+Q  T +      K     I +             T++
Sbjct: 136 SGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQ----IYQSEGLAAFYYSYPTTLV 191

Query: 184 RESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVM 243
                    F+ YE+       S      I     CL G+ SG+    +  PLD IK+V+
Sbjct: 192 MNIPFAAFNFVIYESSTKFLNPSNEYNPLI----HCLCGSISGSTCAAITTPLDCIKTVL 247

Query: 244 -----QTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
                QT +L+  +  +        I    G  G ++G+ P ++
Sbjct: 248 QIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIV 291

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 85/205 (41%), Gaps = 19/205 (9%)

Query: 2   TEEFPTPQLID--DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN 59
           T EF    LID  D ++ H      K  ++G     A   +  PFDT K R+Q + TS +
Sbjct: 111 TYEFCKKNLIDSSDTQTHHP----FKTAISGACATTASDALMNPFDTIKQRIQLN-TSAS 165

Query: 60  AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLL 119
             +  K + ++EG   FY    T LV      +  F + E+  +F +  +E      + L
Sbjct: 166 VWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNE-----YNPL 220

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-----LRVNGQ- 173
            + +CG   G T + + +P++ I+  LQ +     + E     D   K      +V G  
Sbjct: 221 IHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWK 280

Query: 174 -LMRGLTPTMLRESHGCGVYFLTYE 197
              RG  P ++       + +  YE
Sbjct: 281 GFWRGWKPRIVANMPATAISWTAYE 305

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 124/308 (40%), Gaps = 35/308 (11%)

Query: 1   MTEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST-- 58
           + +  P P  +  +     N   +  L  G AG +++ +V  PF+  K+ LQ   ++T  
Sbjct: 4   LAQVLPQPSYVKSILKNDSN---VAFLAGGLAGAVSRTVV-SPFERVKILLQVQNSTTAY 59

Query: 59  --NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR-FFHTFDEAASQH 115
               V  ++ + + EG  G ++G     + +    ++QF V EA K+ FFH       + 
Sbjct: 60  NQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQ 119

Query: 116 LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTG-------SGATAEFKGP----IDC 164
           L   Q    G   G  +     P++ +R RL  QT        S A    K P    + C
Sbjct: 120 LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLC 179

Query: 165 IKKLRVNG--QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFG 222
                  G   L RG+ PT L       + F  YE      +  G        +KL + G
Sbjct: 180 RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF-KEFMPEGTDNTLANFYKLSI-G 237

Query: 223 AASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG-------NNILTVGRTIIARQGVSGLFK 275
           A SG +  T+ YP D+++   Q   +   + G       + ++T+G+T    +G  G +K
Sbjct: 238 ALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKT----EGFRGYYK 293

Query: 276 GFAPTMLR 283
           G    + +
Sbjct: 294 GLTANLFK 301

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 11/100 (11%)

Query: 19  DNT--RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV-----KVIKDLI--- 68
           DNT     K  +   +GG+AQ  V  PFD  + R Q      N +      V+  LI   
Sbjct: 225 DNTLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283

Query: 69  KNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF 108
           K EG  G+YKG    L  V    ++ + V E +    H +
Sbjct: 284 KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323

>Scas_716.29
          Length = 316

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 126/303 (41%), Gaps = 39/303 (12%)

Query: 11  IDDLESPHDNTR------VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----TSETSTN 59
           IDD +   D+ R      V + L+AG+  G+    V  P DT K+RLQ     T +  + 
Sbjct: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63

Query: 60  AVKVIKDLIKNEGPM-GFYKGTLTPLVGVGACVSLQF-GVNEAMKRFFHTFDEAASQHLS 117
            +K++K +I NEG +  F+KG +      G  + + + G   +   F++      S    
Sbjct: 64  LLKMMKGMILNEGGLRSFWKGNVP-----GTMMYVLYGGAQFSSYSFYNNLFGETSDMNG 118

Query: 118 LLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG--QLM 175
            LQ  + G   G T+SF++ P + +R R         ++   G   C +   + G     
Sbjct: 119 QLQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHG---CKEIWNMEGIPGFF 175

Query: 176 RGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYP 235
           RG T +M   +    + F TYE+ I        +  D   +      + SG     + YP
Sbjct: 176 RGCTASMFTITLSASILFGTYES-IKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYP 234

Query: 236 LDVIKSVMQTDN---------------LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPT 280
           LD I+  +Q  N               +     G + + +G  I+ ++G+  L++G + +
Sbjct: 235 LDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMS 294

Query: 281 MLR 283
           + +
Sbjct: 295 LCK 297

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 115/293 (39%), Gaps = 36/293 (12%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKV----RLQTSETSTNA--------------------VK 62
            +AG   G+       PFD  KV    R   S T  N+                    +K
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 63  VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAA-SQHLSLLQY 121
               L +  G   FY G    +V V    +++FG  E  KR     +    +  LS L  
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 122 YICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQL---MRGL 178
           YI G  GG    F   PI+ ++ R+Q    +    +    +   K++   G +    RG+
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCL-------FGAASGTLLWT 231
              ++       +   T+ AL    +K   ++  +P  ++ +        GA SGT+  T
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGAT 442

Query: 232 MVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           +VYP++++++ +Q       P   N    V +  I R+G  GLFKG  P + +
Sbjct: 443 LVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAK 495

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 88/206 (42%), Gaps = 23/206 (11%)

Query: 14  LESPHDNTRV--IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK------VIK 65
           LE+  D + +  +   +AG  GG+A      P DT K R+Q +  +TN  K        K
Sbjct: 308 LENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAK 367

Query: 66  DLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT---------FDEAASQHL 116
           ++ +  G   FY+G    ++G+    +L  G   A+K+++            DE    +L
Sbjct: 368 EMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNL 427

Query: 117 SLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-LRVNGQ-- 173
            +L     G   G   + L  PI  +R RLQ Q        + G  D +KK ++  G   
Sbjct: 428 IVLP---MGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQG 484

Query: 174 LMRGLTPTMLRESHGCGVYFLTYEAL 199
           L +GL P + +      + +L YE L
Sbjct: 485 LFKGLVPNLAKVCPAVSISYLCYENL 510

 Score = 31.2 bits (69), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 39/96 (40%), Gaps = 10/96 (10%)

Query: 17  PHDNTRVIKDLLA---GTAGGIAQVLVGQPFDTTKVRLQTS------ETSTNAVKVIKDL 67
           P D   +I +L+    G   G     +  P +  + RLQ         T      V+K  
Sbjct: 418 PEDEV-IISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKT 476

Query: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR 103
           I+ EG  G +KG +  L  V   VS+ +   E +KR
Sbjct: 477 IQREGYQGLFKGLVPNLAKVCPAVSISYLCYENLKR 512

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 90/205 (43%), Gaps = 16/205 (7%)

Query: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA- 60
           T EF   QLID  +   +  + +K  ++G A  +A   +  PFDT K RLQ    S+++ 
Sbjct: 115 TYEFCKEQLIDAKD--FNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSS 172

Query: 61  -VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLL 119
             ++  ++ KNEGPM F+    T L       +L F + E+  +FF+      +   +  
Sbjct: 173 MWRMAFNIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFN-----PTNAYNPW 227

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE-------FKGPIDCIKKLRVNG 172
            + +CG   G T + + +P++ I+  LQ +       E       FK     I +     
Sbjct: 228 IHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWK 287

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYE 197
              RGL P ++       + + +YE
Sbjct: 288 GFWRGLQPRVISNIPATAISWTSYE 312

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 110/296 (37%), Gaps = 33/296 (11%)

Query: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-SETSTNA----------- 60
           D E+  D   +   L+AG   GI +  +  P D  K R+Q  SE    A           
Sbjct: 10  DYEALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAA 69

Query: 61  ---------VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEA 111
                    ++ I  +   EG +  ++G  + ++G G   ++ F   E  K      D  
Sbjct: 70  SGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKE--QLIDAK 127

Query: 112 ASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN 171
                  L+  + GVA       L +P + I+ RLQ Q+ S  ++ ++   + I K    
Sbjct: 128 DFNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN-IYKNEGP 186

Query: 172 GQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWT 231
                    T+        + F+ YE+      K          W  CL G  +G     
Sbjct: 187 MAFFYSYPTTLAMNIPFAALNFVIYES----STKFFNPTNAYNPWIHCLCGGIAGATCAA 242

Query: 232 MVYPLDVIKSVMQ-----TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           +  PLD IK+V+Q     T ++++ K  N      + I    G  G ++G  P ++
Sbjct: 243 VTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVI 298

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 118/264 (44%), Gaps = 22/264 (8%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSET-STNAVKVIKDLIKNEGPMGFYKGTLTPLVGVG 88
           G  GGI   +   P D  KVRLQT+       V++   +++NEG  G Y G    ++   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 89  ACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYI-CGVAGGFTNSFLASPIEHIRIRLQ 147
              + +FGV + +K  +        ++L+ + Y + C +  G     + +P + + IR+Q
Sbjct: 75  TYTTARFGVYDFVKERY-----IPKEYLNSMLYLLPCSMFSGAVGGLIGNPADVVNIRMQ 129

Query: 148 TQTGSGAT--AEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGVYFLTYEALIGH 202
             +   A     +K   D + K+       +L  G  P ++R         +TY+    +
Sbjct: 130 NDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNY 189

Query: 203 QVKS-GIQRKDIPAWKLCLFGAA--SGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILT 259
            V++ G+ + +    K   F ++  +G +  T+  P DVIK+ +   +  +  +   IL 
Sbjct: 190 LVQNVGLDKDN----KSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDSAVRILL 245

Query: 260 VGRTIIARQGVSGLFKGFAPTMLR 283
                + ++G S +F+G+ P+ +R
Sbjct: 246 ---DAVKQEGPSFMFRGWLPSFVR 266

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 14  LESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN--AVKVIKDLIKNE 71
           L+  + +T     LLAG    +    V  P D  K R+  +   ++  AV+++ D +K E
Sbjct: 196 LDKDNKSTHFASSLLAG----LVATTVCSPADVIKTRVMNAHKHSHDSAVRILLDAVKQE 251

Query: 72  GPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR 103
           GP   ++G L   V +G    L F   E +++
Sbjct: 252 GPSFMFRGWLPSFVRLGPNTILIFLTVEQLRK 283

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/187 (19%), Positives = 67/187 (35%), Gaps = 15/187 (8%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSET--------STNAVKVIKDLIKNEGPMGFY 77
            + +G  GG    L+G P D   +R+Q   +          NA   +  +   EG    +
Sbjct: 107 SMFSGAVGG----LIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLF 162

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLAS 137
            G    LV      S Q    +  K +            +   ++   +  G   + + S
Sbjct: 163 TGWQPNLVRGILMTSSQVVTYDIAKNYL--VQNVGLDKDNKSTHFASSLLAGLVATTVCS 220

Query: 138 PIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
           P + I+ R+         +  +  +D +K+      + RG  P+ +R      + FLT E
Sbjct: 221 PADVIKTRVMNAHKHSHDSAVRILLDAVKQ-EGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

Query: 198 ALIGHQV 204
            L  H+V
Sbjct: 280 QLRKHRV 286

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 113/275 (41%), Gaps = 25/275 (9%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQT---------SETSTNAVKVIKDLIKNEGPMGFYK 78
           ++G   G    ++  PFD  K RLQ          S+           + K+EG  G YK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASP 138
           G    ++G    + + F V +    F   +      H   L      +  G  ++   +P
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYD----FCRKYSVDIFPHSPFLSNASSAITAGAISTVATNP 158

Query: 139 IEHIRIRLQTQTGSGA-TAEFKGPIDCIKKL---RVNGQLMRGLTPTMLRESHGCGVYFL 194
           I  ++ RL  QTG G  +  +KG ID  +K+        L  GL P +L   +   + F 
Sbjct: 159 IWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLN-VAIQFP 217

Query: 195 TYEAL---IGHQVKSGIQRKDIPA---WKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNL 248
            YE L    G+   + +   D+ +    KL L    S  +  T+ YP +++++ MQ  + 
Sbjct: 218 LYENLKIRFGYSESTDVS-TDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSD 276

Query: 249 KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
                  ++L + +    ++G +G + GFA  ++R
Sbjct: 277 LPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVR 311

>Kwal_27.12081
          Length = 369

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 119/290 (41%), Gaps = 55/290 (18%)

Query: 39  LVGQPFDTTKVRLQTS-----------ETSTNAVK-----------VIKDLIKNEGPMGF 76
           +V  PFD  K RLQ+              S+N V            +I +L K EG    
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 77  YKGTLTPLVGVGACVSLQF----GVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTN 132
           +KG    LVGV    S+ F       +   R F+  +EA   HL      I     G+  
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHL------ISAATAGWAT 181

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQ----LMRGLTPTMLRESHG 188
           S   +PI  I+ RLQ    +G T ++K   DC+K + +  +    L +GL+ + L    G
Sbjct: 182 STATNPIWLIKTRLQLDK-AGHTRQYKNSWDCLKHI-IQKEGFFGLYKGLSASYLGSVEG 239

Query: 189 CGVYFLTYEAL-----------IGHQVKSGIQRKDIPAWKLCLFGAASGT---LLWTMVY 234
             + +L YE +            GH +  G +       + C    ++G    L   + Y
Sbjct: 240 I-LQWLLYEQMKQMIKMRSIEKFGH-ISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTY 297

Query: 235 PLDVIKSVMQTDNLKTPK-NGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           P +V+++ ++   L+  K     ++   R II  +G++ ++ G  P +LR
Sbjct: 298 PHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLR 347

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 76/196 (38%), Gaps = 25/196 (12%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETS-----TNAVKVIKDLIKNEGPMGFYKGTL 81
           L++    G A      P    K RLQ  +        N+   +K +I+ EG  G YKG  
Sbjct: 171 LISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLS 230

Query: 82  TPLVGVGACVSLQFGVNEAMK---------RFFHTFDEAASQHLSLLQYYICGVAGG--- 129
              +G    + LQ+ + E MK         +F H  +   +    + ++  C  +G    
Sbjct: 231 ASYLGSVEGI-LQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEW--CQRSGSAGL 287

Query: 130 --FTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIK---KLRVNGQLMRGLTPTMLR 184
             F  S +  P E +R RL+         ++ G I   +   K      +  GLTP +LR
Sbjct: 288 AKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLR 347

Query: 185 ESHGCGVYFLTYEALI 200
                 + F T+E +I
Sbjct: 348 TVPNSIIMFGTWELVI 363

>Scas_558.2
          Length = 289

 Score = 62.0 bits (149), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 102/267 (38%), Gaps = 23/267 (8%)

Query: 21  TRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGT 80
           T  +  LL+G A G +  LV  P DT K RLQ                +N G  G Y+G 
Sbjct: 4   TAFVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAK----------GGFFQNGGYHGIYRGL 53

Query: 81  LTPLVGVGACVSLQFGVNEAMK--------RFFHTFDEAASQHLSLLQYYICGVAGGFTN 132
            + +V      SL F   ++MK        R  ++    +   +  + + I    G    
Sbjct: 54  GSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAA 113

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVY 192
             +  P E I+ R Q  + + +   F+  +    +  +   L RG + T++RE     + 
Sbjct: 114 CLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQ 173

Query: 193 FLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPK 252
           F  YE +         +   +  WK  + G+ +G +      PLD +K+ +  +    P 
Sbjct: 174 FPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSIP- 232

Query: 253 NGNNILTVGRTIIARQGVSGLFKGFAP 279
               I ++ R I   +G    F G  P
Sbjct: 233 ----IKSLIRNIYKEEGFKIFFSGIYP 255

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 6/112 (5%)

Query: 4   EFPTPQLIDDLESPHDNT----RVIKDLLAGT-AGGIAQVLVGQPFDTTKVRLQTSETST 58
           +FP  + +    + +DN     +  K  + G+ AGGIA      P D  K RL  ++ S 
Sbjct: 173 QFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATT-TPLDFLKTRLMLNKDSI 231

Query: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDE 110
               +I+++ K EG   F+ G     + + A  ++  GV E M     + +E
Sbjct: 232 PIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGGAIFLGVYETMHFMLQSLEE 283

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 107/288 (37%), Gaps = 31/288 (10%)

Query: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSET---------STNAVKV 63
           D E+  D+  +   L+AG   GIA+  V  P D  K RLQ              +  ++ 
Sbjct: 8   DYEALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQ 67

Query: 64  IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAAS-QHLSLLQYY 122
           +  +   EG M  +KG  + L+G G   ++ F   E +K F    DEA S       +  
Sbjct: 68  LSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFL--IDEATSTSKYHFFKTA 125

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL--RVNGQLMRGLTP 180
             G         L +P + I+ R+Q  T            D  K++  +   Q      P
Sbjct: 126 FSGATATIAADALMNPFDVIKQRIQLNTNISV-------WDTAKRIYSKEGFQAFYSSYP 178

Query: 181 TMLRESHGCGVY-FLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVI 239
           T L  +     + F  Y+    +   SG+    I     CL G  SG     +  PLD I
Sbjct: 179 TTLAINIPFAAFNFGIYDTATRYFNPSGVYNPFIH----CLCGGISGAACAGLTTPLDCI 234

Query: 240 KSVMQTD-----NLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           K+ +Q       +++  K  +      R I    G  G + G  P +L
Sbjct: 235 KTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRIL 282

>Scas_582.7
          Length = 329

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 115/298 (38%), Gaps = 53/298 (17%)

Query: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ------TSETSTNAVKVIKD 66
           D E+   +  +   LLAG   GI +     P D  K R+Q      T +TST+ +K I  
Sbjct: 26  DYEALPAHAPLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISK 85

Query: 67  LIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGV 126
           +   EG +  +KG  + ++G G   ++ F   E  K   H   ++  +    ++  + G 
Sbjct: 86  ISTMEGSLALWKGVQSVILGAGPAHAVYFATYEFTKA--HLIPDSQRETHQPIKVAVSGA 143

Query: 127 AGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQL-----MRGLT-- 179
                + F  +P + I+ R+Q              I  +KK +V         + GL+  
Sbjct: 144 TATVASDFFMNPFDTIKQRMQ--------------ISDLKKEKVYNVAKKIYNLEGLSAF 189

Query: 180 ----PTMLRESHGCGVY-FLTYEALIG-----HQVKSGIQRKDIPAWKLCLFGAASGTLL 229
               PT +  +     + F+ YE+        H     I          CL G  SG + 
Sbjct: 190 YYSYPTTIAMNIPFAAFNFMIYESASKFFNPLHHYNPLIH---------CLCGGISGAIA 240

Query: 230 WTMVYPLDVIKSVMQTD-----NLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
             +  PLD IK+V+Q       +L+  K  N        I+   G  G ++G  P +L
Sbjct: 241 AAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRIL 298

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 83/204 (40%), Gaps = 15/204 (7%)

Query: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV 61
           T EF    LI D  S  +  + IK  ++G    +A      PFDT K R+Q S+     V
Sbjct: 116 TYEFTKAHLIPD--SQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQISDLKKEKV 173

Query: 62  -KVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
             V K +   EG   FY    T +       +  F + E+  +FF+        H + L 
Sbjct: 174 YNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYESASKFFNPL-----HHYNPLI 228

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-----LRVNGQ-- 173
           + +CG   G   + + +P++ I+  +Q +  S  + E     +  KK     L V G   
Sbjct: 229 HCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKG 288

Query: 174 LMRGLTPTMLRESHGCGVYFLTYE 197
             RGL P +L       + +  YE
Sbjct: 289 FWRGLQPRILANMPATAISWTAYE 312

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 123/292 (42%), Gaps = 35/292 (11%)

Query: 9   QLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA------VK 62
           QL+DD +        +   LAG   GI       P D  K RLQ     +        V 
Sbjct: 79  QLLDDTQ-----VTAVSGALAGFVSGIMVC----PLDVAKTRLQAQGAGSGERYYRGIVG 129

Query: 63  VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYY 122
            +  ++++EG  G YKG    ++G      L F V E  K+ + ++          + + 
Sbjct: 130 TLSAILRDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGG-----FVSHA 184

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQTG-SGATAEFKGPIDCIKKL-RVNG--QLMRGL 178
              +  G  ++ L +PI  ++ RL  Q+  S  +  ++  +D  +K+ R  G      GL
Sbjct: 185 ASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGL 244

Query: 179 TPTMLRESHGCGVYFLTYEAL--IGHQVKSGI--QRKD---IPAWKLCLFGAASGTLLWT 231
            P++    H   ++F  YE L    H+       QR D   +   +L +    S  +   
Sbjct: 245 VPSLFGLFH-VAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASV 303

Query: 232 MVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           + YP +++++ MQ  +   P +  N+L  GR I A +G  G + GFA  ++R
Sbjct: 304 ITYPHEILRTRMQVRHSGVPPSLLNLL--GR-IRASEGYVGFYSGFATNLVR 352

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 86/195 (44%), Gaps = 24/195 (12%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQT----SETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           LLA    G A   V  P    K RLQ     ++T  N++  IK ++KNEG +G YKG   
Sbjct: 173 LLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSA 232

Query: 83  PLVGVGACVSLQFGVNEAMKR---------FFHTFDEAASQHLSLLQYYICGVAGG---- 129
             +G    + LQ+ + E MKR         F H  ++A S    + ++  C  +G     
Sbjct: 233 SYLGSVEGI-LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEW--CQRSGSAGLA 289

Query: 130 -FTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-LRVNG--QLMRGLTPTMLRE 185
            F  S +  P E +R RL+         ++ G +   +  ++  G   +  GLTP +LR 
Sbjct: 290 KFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRT 349

Query: 186 SHGCGVYFLTYEALI 200
                + F T+E +I
Sbjct: 350 VPNSIIMFGTWELVI 364

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 116/292 (39%), Gaps = 64/292 (21%)

Query: 43  PFDTTKVRLQT----SETSTNAVK----------------------VIKDLIKNEGPMGF 76
           PFD  K RLQ+    ++  + A++                      +I ++ + EG    
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 77  YKGTLTPLVGVGACVSLQF----GVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTN 132
           +KG    LVGV    S+ F       +   R  +   EA   HL      +     G+  
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHL------LAAATAGWAT 183

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG---QLMRGLTPTMLRESHGC 189
           S + +PI  ++ RLQ       T  +K  +DCIK +  N     L +GL+ + L    G 
Sbjct: 184 STVTNPIWLVKTRLQLD--KAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGI 241

Query: 190 GVYFLTYEAL-----------IGHQVKSGIQRKD-IPAWKLCLFGAASGTLLWT---MVY 234
            + ++ YE +            GH  +      D +  W  C    ++G   +    + Y
Sbjct: 242 -LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEW--CQRSGSAGLAKFVASIVTY 298

Query: 235 PLDVIKSVMQ---TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           P +V+++ ++   T+N K    G  ++   R II  +G+  ++ G  P +LR
Sbjct: 299 PHEVVRTRLRQAPTENGKLKYTG--LVQSFRVIIKEEGLVSMYSGLTPHLLR 348

>Scas_578.3*
          Length = 524

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 121/312 (38%), Gaps = 42/312 (13%)

Query: 13  DLESPHDNTRVIKDLLAG----TAGGIAQVL---VGQPFDTTKV----RLQTSETSTNA- 60
           DL S  D T +I D + G     AGG++ V+      P D  KV    R   S T  N  
Sbjct: 192 DLSSEGDMT-LINDFIKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPK 250

Query: 61  -----------------VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR 103
                            +K I+ L +  G   FY G    +  +    S++FG  E  KR
Sbjct: 251 MHLRIQGLNLAKIRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKR 310

Query: 104 FFHTFD-EAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPI 162
                  +     LS LQ Y+ G   G        PI+ ++ R+Q     G        I
Sbjct: 311 LMANLSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLI 370

Query: 163 DCIKKLRVNGQL---MRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLC 219
              K++   G +    RG+    L       +   T+ AL    +K   ++ +IP   + 
Sbjct: 371 STAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVM 430

Query: 220 L-------FGAASGTLLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIARQGVS 271
           L        GA SGT+  T VYP++++++ +Q       P        V    + R+GV 
Sbjct: 431 LSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVP 490

Query: 272 GLFKGFAPTMLR 283
           G +KG  PT+++
Sbjct: 491 GFYKGLVPTLVK 502

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 29/219 (13%)

Query: 4   EFPTPQLIDDLESPHDNTRVIKDL-------LAGTAGGIAQVLVGQPFDTTKVRLQTSET 56
           +F T +L   L +     +++ DL         G AG +AQ+ +  P DT K R+Q +  
Sbjct: 301 KFGTFELAKRLMANLSGDKLVNDLSKLQTYVAGGIAGVMAQISI-YPIDTLKFRIQCAPL 359

Query: 57  STNA------VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDE 110
             N       +   K++ K  G   FY+G L   +G+    +L  G   A+K+++    +
Sbjct: 360 EGNLKGNALLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYI---K 416

Query: 111 AASQHLS------LLQYYICGVAGGFTNSFLAS---PIEHIRIRLQTQTGSGATAEFKGP 161
             S+ L+      +L Y +    G F+ +  A+   PI  +R RLQ Q        + G 
Sbjct: 417 RQSKKLNIPEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGF 476

Query: 162 IDC-IKKLRVNGQ--LMRGLTPTMLRESHGCGVYFLTYE 197
            D  ++ L+  G     +GL PT+++      + +L YE
Sbjct: 477 RDVFMQTLKREGVPGFYKGLVPTLVKVCPAVSIGYLCYE 515

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 33/81 (40%), Gaps = 10/81 (12%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTS------ETSTNAVKVIKDLIKNEGPMGFYKGTL 81
            +GT G  A      P +  + RLQ         T T    V    +K EG  GFYKG +
Sbjct: 442 FSGTVGATAVY----PINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLV 497

Query: 82  TPLVGVGACVSLQFGVNEAMK 102
             LV V   VS+ +   E  K
Sbjct: 498 PTLVKVCPAVSIGYLCYEKFK 518

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/318 (22%), Positives = 123/318 (38%), Gaps = 63/318 (19%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-------------- 60
           E  H N   I  L    AG +A V+V  P D  K RLQ      N               
Sbjct: 96  EEGHFNDTEITALSGALAGFLAGVIVC-PLDVAKTRLQAQGLQLNGPVTRPVGSVATTFG 154

Query: 61  -------VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK----RFFHTFD 109
                     +  ++++E   G YKG +  ++G      + F V E  K    R+F+  +
Sbjct: 155 GKYYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSE 214

Query: 110 EAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSG--ATAEFKGPIDC-IK 166
                    L + +  +  G  ++ L +PI  ++ RL  Q+G        +K  +D  IK
Sbjct: 215 --------FLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIK 266

Query: 167 KLRVNG--QLMRGLTPTMLRESHGCGVYFLTYEAL--IGHQVKSGIQRKD---------- 212
             +V G      GL P++    H   ++F  YE L  + H   SG   ++          
Sbjct: 267 IYKVEGIKSFYSGLIPSLFGLLH-VAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNP 325

Query: 213 -------IPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTII 265
                      +L +    S  +  T+ YP +++++ +Q  +   P    +I ++ RT  
Sbjct: 326 QTTGSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKP----SIKSIIRTTY 381

Query: 266 ARQGVSGLFKGFAPTMLR 283
           A++G+ G + GF   M R
Sbjct: 382 AKEGIRGFYSGFLTNMFR 399

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 128/317 (40%), Gaps = 50/317 (15%)

Query: 13  DLESPHDNTRVIKDLLAG----TAGGIAQVL---VGQPFDTTKVRL-------------- 51
           DL S  D T +I D + G     AGGI+ V+      PFD  KV L              
Sbjct: 211 DLSSEGDVT-LINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSK 269

Query: 52  ----------QTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAM 101
                       ++ S+   K +K L +  G   FY G    ++ V    S++FG  E  
Sbjct: 270 TDLLAKNPNADINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVT 329

Query: 102 KRFFHTFDEAA-SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQ----TGSGATA 156
           K+     +    ++ LS    YI G   G    F   PI+ ++ R+Q         G   
Sbjct: 330 KKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNL 389

Query: 157 EFKGPIDCIKK--LRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIP 214
            F+   D  ++  LR+     RG+T  ++       +   T+ AL    +    +  ++P
Sbjct: 390 LFQTAKDMFREGGLRL---FYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLP 446

Query: 215 AWKLCL-------FGAASGTLLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIA 266
             ++ L        GA SGT+  ++VYP++++++ +Q       P   N    V    + 
Sbjct: 447 QDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLE 506

Query: 267 RQGVSGLFKGFAPTMLR 283
           R+G  GLFKG  PT+ +
Sbjct: 507 REGYQGLFKGLVPTLAK 523

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 90/211 (42%), Gaps = 19/211 (9%)

Query: 7   TPQLIDDLESPHDNTRVIK--DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---- 60
           T +++  LE   D   + K    +AG   G+A      P DT K R+Q +   T      
Sbjct: 329 TKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNN 388

Query: 61  --VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSL 118
              +  KD+ +  G   FY+G    +VG+    +L  G   A+K+++    +A + +L  
Sbjct: 389 LLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIA-KQAKTLNLPQ 447

Query: 119 LQYYICGVA----GGFTNSFLAS---PIEHIRIRLQTQTGSGATAEFKGPIDC-IKKLRV 170
            Q  +  +     G F+ +  AS   PI  +R RLQ Q        + G  D  +K L  
Sbjct: 448 DQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLER 507

Query: 171 NGQ--LMRGLTPTMLRESHGCGVYFLTYEAL 199
            G   L +GL PT+ +      + +L YE L
Sbjct: 508 EGYQGLFKGLVPTLAKVCPAVSISYLCYENL 538

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 6/83 (7%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETST-----NAVK-VIKDLIKNEGPMGFYKGTLTP 83
           G   G     V  P +  + RLQ   T       N  K V+   ++ EG  G +KG +  
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPT 520

Query: 84  LVGVGACVSLQFGVNEAMKRFFH 106
           L  V   VS+ +   E +K+F +
Sbjct: 521 LAKVCPAVSISYLCYENLKKFMN 543

>Kwal_33.14050
          Length = 314

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 110/300 (36%), Gaps = 52/300 (17%)

Query: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-----------SETSTNAV 61
           D ES   N  +   L AG   GI +  +  P D  K R+Q            ++  +N V
Sbjct: 6   DYESLPTNAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIV 65

Query: 62  KVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQY 121
           + I  +   EG M  +KG  + ++G G   ++ F   E  K +    D    Q    L+ 
Sbjct: 66  QQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYL--IDPQDFQTHQPLKT 123

Query: 122 YICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPT 181
              G+A       L +P + I+ R+Q +T S             +   V  ++ R     
Sbjct: 124 AASGIAATVAADLLMNPFDTIKQRMQLRTFSKD-----------RMWSVASRIYR----- 167

Query: 182 MLRESHGCGVYFLTYEALIGHQVKSGIQRKDI--PAWKL------------CLFGAASGT 227
               + G   +F +Y   I   +        I   A K             CL G  SG 
Sbjct: 168 ----NEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFFNPENTYNPLIHCLCGGISGA 223

Query: 228 LLWTMVYPLDVIKSVMQ---TDNLKTP--KNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
               +  PLD IK+V+Q   ++++  P  +  +        I    G SG ++G  P ++
Sbjct: 224 TCAAITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRII 283

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 84/207 (40%), Gaps = 21/207 (10%)

Query: 2   TEEFPTPQLIDDLESPHD--NTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN 59
           T E     LID    P D    + +K   +G A  +A  L+  PFDT K R+Q    S +
Sbjct: 101 TYEMCKSYLID----PQDFQTHQPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKD 156

Query: 60  AV-KVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSL 118
            +  V   + +NEG   F+    T +       +  F + E+  +FF+          + 
Sbjct: 157 RMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFFNP-----ENTYNP 211

Query: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE--------FKGPIDCIKKLRV 170
           L + +CG   G T + + +P++ I+  LQ + GS +  +        F      I K+  
Sbjct: 212 LIHCLCGGISGATCAAITTPLDCIKTVLQVR-GSESVVDPLFRQADTFSRAASAISKVYG 270

Query: 171 NGQLMRGLTPTMLRESHGCGVYFLTYE 197
                RGL P ++       + +  YE
Sbjct: 271 WSGFWRGLKPRIISNMPATAISWTAYE 297

>Scas_667.4
          Length = 308

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 118/285 (41%), Gaps = 22/285 (7%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA----------VKVI 64
           E   ++   I  L+ G +  +A+     P +  K+ +Q  +               ++  
Sbjct: 6   EVKKESNFAIDFLMGGVSAAVAKT-AASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECF 64

Query: 65  KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYIC 124
           +   K EG + F++G    ++      +L F   + +K  F    E              
Sbjct: 65  QRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASG 124

Query: 125 GVAGGFTNSFLASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKK-LRVNGQ--LMRGL 178
           G AGG +  F+ S +++ R RL     S   G + ++KG ID  K+ L  +G   L RG 
Sbjct: 125 GAAGGLSLLFVYS-LDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGF 183

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238
            P+++      G+YF  Y++L    +   ++   + ++   L G    T   T  YPLD 
Sbjct: 184 LPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASF---LLGWIVTTGASTASYPLDT 240

Query: 239 IKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++  M   + +  K  +      R ++A +GVS LFKG    +LR
Sbjct: 241 VRRRMMMTSGQAVKY-DGAFDCFRKVVAAEGVSSLFKGCGANILR 284

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 73/174 (41%), Gaps = 19/174 (10%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---------VKVIKDLIKNEGPMGFYKGT 80
           G AGG++ + V    D  + RL     S+           + V K  +  +G  G Y+G 
Sbjct: 125 GAAGGLSLLFV-YSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGF 183

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
           L  +VG+     L FG+ +++K    T     S   S L  +I    G  T S+   P++
Sbjct: 184 LPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLLGWIV-TTGASTASY---PLD 239

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            +R R+     SG   ++ G  DC +K+        L +G    +LR   G GV
Sbjct: 240 TVRRRMMMT--SGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGV 291

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 87/205 (42%), Gaps = 19/205 (9%)

Query: 2   TEEFPTPQLIDDLESPHD--NTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN 59
           T EF   +LI    SP D    + +K  L+GT   IA   +  PFDT K RLQ  +T+  
Sbjct: 101 TYEFCKARLI----SPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQL-DTNLR 155

Query: 60  AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLL 119
              V K + +NEG   FY    T L       +  F + E+  +FF+          + L
Sbjct: 156 VWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFN-----PQNSYNPL 210

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-----LRVNGQ- 173
            + +CG   G T + L +P++ I+  LQ +     + E     +   +     L V+G  
Sbjct: 211 IHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWK 270

Query: 174 -LMRGLTPTMLRESHGCGVYFLTYE 197
              RGL P ++       + +  YE
Sbjct: 271 GFWRGLKPRIVANIPATAISWTAYE 295

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 110/289 (38%), Gaps = 39/289 (13%)

Query: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS----ETSTNAVKVIKDLI 68
           D E+   +  +   LLAG   GI +  +  P D  K R+Q +      ST  +  I  + 
Sbjct: 13  DYEALPSHAPLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKIS 72

Query: 69  KNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK-RFFHTFDEAASQHLSLLQYYICGVA 127
             EG M  +KG  + ++G G   ++ FG  E  K R     D    Q    ++  + G  
Sbjct: 73  TMEGSMALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQP---MKTALSGTI 129

Query: 128 GGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRG--------LT 179
                  L +P + ++ RLQ  T              ++   V  Q+ +           
Sbjct: 130 ATIAADALMNPFDTVKQRLQLDTN-------------LRVWNVTKQIYQNEGFAAFYYSY 176

Query: 180 PTMLRESHGCGVY-FLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238
           PT L  +     + F+ YE+      K    +        CL G  SG     +  PLD 
Sbjct: 177 PTTLAMNIPFAAFNFMIYES----ASKFFNPQNSYNPLIHCLCGGISGATCAALTTPLDC 232

Query: 239 IKSVMQ-----TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           IK+V+Q     T +++  K+ N      R I+   G  G ++G  P ++
Sbjct: 233 IKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIV 281

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 101/244 (41%), Gaps = 12/244 (4%)

Query: 50  RLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD 109
           R   ++  +  VK    L +  G   FY G    ++ V    +++FG  E  KR     +
Sbjct: 226 RADPAKIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLE 285

Query: 110 EAASQ-HLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL 168
                  LS L  Y+ G  GG    F   PI+ ++ R+Q              I   K +
Sbjct: 286 GCGETGELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDM 345

Query: 169 RVNGQL---MRGLTPTMLRESHGCGVYFLTYEAL----IGHQVKS-GIQRKDIPAWKLCL 220
              G L    RGL   +L       +   T+ AL    I  +  + GI   ++    L +
Sbjct: 346 YREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVV 405

Query: 221 F--GAASGTLLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIARQGVSGLFKGF 277
              GA SGT+  T+VYP++++++ +Q       P   +    V R  + R+G+ GL+KG 
Sbjct: 406 LPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGL 465

Query: 278 APTM 281
            PT+
Sbjct: 466 VPTL 469

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 83/187 (44%), Gaps = 15/187 (8%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA------VKVIKDLIKNEGPMGFYKGTL 81
           +AG  GGI       P DT K R+Q +   T        +K  KD+ +  G   FY+G  
Sbjct: 300 VAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLG 359

Query: 82  TPLVGVGACVSLQFGVNEAMKRFFHTFDEAA---SQHLSLLQYYICGVAGGFTNSFLAS- 137
             ++GV    +L  G   A+KR++ T    A   S++  ++   +    G F+ +  A+ 
Sbjct: 360 VGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVGATV 419

Query: 138 --PIEHIRIRLQTQTGSGATAEFKGPIDCIKK-LRVNG--QLMRGLTPTMLRESHGCGVY 192
             PI  +R RLQ Q        + G  D  +K ++  G   L +GL PT+ +      + 
Sbjct: 420 VYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAIS 479

Query: 193 FLTYEAL 199
           +L YE L
Sbjct: 480 YLCYENL 486

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 9/94 (9%)

Query: 19  DNTRVIKDLLA---GTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK------VIKDLIK 69
           +N  V+ +L+    G   G     V  P +  + RLQ   T  +  +      V +  ++
Sbjct: 395 ENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQ 454

Query: 70  NEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR 103
            EG  G YKG +  L  V   V++ +   E +KR
Sbjct: 455 REGLPGLYKGLVPTLAKVCPAVAISYLCYENLKR 488

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 110/264 (41%), Gaps = 21/264 (7%)

Query: 20  NTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKG 79
           ++  +  L++G A G +  +V  P DT K RLQ                 N G  G Y+G
Sbjct: 2   DSTFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAK----------GGFFHNGGYRGIYRG 51

Query: 80  TLTPLVGVGACVSLQFGVNEAMKRFFHTF---DEAASQHLSLLQYYICGVAGGFTNSFLA 136
             + +V      SL F   ++MK+          A+ Q   +L + +    G  +   + 
Sbjct: 52  LGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVR 111

Query: 137 SPIEHIRIRLQTQTGSGATAEFKGPI-DCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLT 195
            P E I+ R QT   + +    +  + D   +  V G L RG   T++RE     + F  
Sbjct: 112 VPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRG-LYRGWWTTIMREIPFTCIQFPL 170

Query: 196 YEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGN 255
           YE L   +  +  + + + AW+  + G+ +G +      PLDV+K+ M     + P    
Sbjct: 171 YEYL-KKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVP---- 225

Query: 256 NILTVGRTIIARQGVSGLFKGFAP 279
            +L + RT+   +G    F+G  P
Sbjct: 226 -MLHLARTLFREEGARVFFRGIGP 248

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 76/172 (44%), Gaps = 21/172 (12%)

Query: 117 SLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMR 176
           + L   + G A G +   +  PI+ ++ RLQ + G      ++G             + R
Sbjct: 4   TFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNGGYRG-------------IYR 50

Query: 177 GLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQR----KDIPAWKLCLFGAASGTLLWTM 232
           GL   ++  + G  ++F+TY+++   Q++  + R    + +      +  ++ G +   +
Sbjct: 51  GLGSAVVASAPGASLFFVTYDSM-KQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACL 109

Query: 233 V-YPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           V  P +VIK   QT +  T  +   +  + R       V GL++G+  T++R
Sbjct: 110 VRVPAEVIKQRTQTHH--TNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMR 159

 Score = 31.2 bits (69), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%)

Query: 43  PFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
           P D  K R+   E     + + + L + EG   F++G     + + A  ++  GV EA+ 
Sbjct: 209 PLDVLKTRMMLHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVH 268

Query: 103 RFF 105
             F
Sbjct: 269 SLF 271

>Scas_702.10
          Length = 302

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 110/265 (41%), Gaps = 23/265 (8%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV-KVIKDLIKNEGPMGFYKGTLTPLVGVG 88
           G A GI   ++  P D  KVRLQ +      + +++  +++NE  MG Y G    ++   
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 89  ACVSLQFGVNEAMKRFF----HTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRI 144
              +++FG  + MK       H  D       S+    I G+ G F +      + +IR+
Sbjct: 76  TYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFAD------VVNIRM 129

Query: 145 RLQTQTGSGATAEFKGPIDCIKKLRVN----GQLMRGLTPTMLRESHGCGVYFLTYEALI 200
           +  +         ++  ID + K+ ++      L+ G  P M+R         +TY+   
Sbjct: 130 QNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFK 189

Query: 201 GHQVK--SGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNIL 258
            + V   S   +K+       L      T   T+  P DVIK+ +   +    ++   IL
Sbjct: 190 NYLVTKLSFDPKKNSTHLSASLLAGLVAT---TICSPADVIKTRIMNAHKTESESAIKIL 246

Query: 259 TVGRTIIARQGVSGLFKGFAPTMLR 283
           T   + I ++G S +F+G+ P   R
Sbjct: 247 T---SAIKKEGPSFMFRGWLPIFTR 268

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 14/73 (19%)

Query: 214 PAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGR---TIIARQGV 270
           P W    +G A+G     M +PLD+ K  +Q   L  P       T+GR   TI+  + V
Sbjct: 12  PWW----YGGAAGIFACVMTHPLDLAKVRLQAAPLPKP-------TLGRMLTTILRNENV 60

Query: 271 SGLFKGFAPTMLR 283
            GL+ G +  +LR
Sbjct: 61  MGLYSGLSAAVLR 73

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 2/79 (2%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSET--STNAVKVIKDLIKNEGPMGFYKGTLTPL 84
           L A    G+    +  P D  K R+  +    S +A+K++   IK EGP   ++G L   
Sbjct: 207 LSASLLAGLVATTICSPADVIKTRIMNAHKTESESAIKILTSAIKKEGPSFMFRGWLPIF 266

Query: 85  VGVGACVSLQFGVNEAMKR 103
             +G    L F   E +K+
Sbjct: 267 TRLGPFTMLIFFAIEQLKK 285

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 58.5 bits (140), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 100/265 (37%), Gaps = 20/265 (7%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYK 78
           D++  +  L +G A G +  L   P DT K RLQ                 N G  G Y+
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAK----------GGFFANGGYKGVYR 51

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRF----FHTFDEAASQHLSLLQYYICGVAGGFTNSF 134
           G  + ++      SL F   ++MK +       +  + +Q    L +      G  +   
Sbjct: 52  GLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACL 111

Query: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFL 194
           +  P E I+ R QT   + +   F   +       V   L RG   T++RE     + F 
Sbjct: 112 VRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFP 171

Query: 195 TYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG 254
            YE L     K   Q    P W+  + G+ +G +      PLDV+K+ +   +   P   
Sbjct: 172 LYEFLKKTWAKRNGQDHVAP-WQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIP--- 227

Query: 255 NNILTVGRTIIARQGVSGLFKGFAP 279
             +  + + I A +G    F G  P
Sbjct: 228 --VAQLAKNIYAEEGFKVFFSGVGP 250

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 115/280 (41%), Gaps = 25/280 (8%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLI----KNEGPMGFYKGTLT 82
           L  G AG I++ +V  PF+  K+ LQ   ++T   K + D I    K E   G ++G   
Sbjct: 28  LAGGIAGAISRTVV-SPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGL 86

Query: 83  PLVGVGACVSLQFGVNEAMKR-FFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEH 141
             + V    ++QF V E  K+  FH   +   + L+  Q    G   G  +     P++ 
Sbjct: 87  NCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDL 146

Query: 142 IRIRLQTQTGS------GATAEFKGPIDCIKKLRV----NGQLM---RGLTPTMLRESHG 188
           +R RL  QT +         ++   P    K L       G +M   RG+ PT L     
Sbjct: 147 VRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPY 206

Query: 189 CGVYFLTYEAL--IGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTD 246
             + F  YE L       ++G        +KL + GA SG +  T+ YP D+++   Q  
Sbjct: 207 VALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM-GAISGGVAQTITYPFDLLRRRFQVL 265

Query: 247 NLKTPKNG---NNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            +   + G   N++     TI   +G  G +KG    + +
Sbjct: 266 AMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 74/194 (38%), Gaps = 25/194 (12%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRL--QTSETSTNAVKVIKDLIK--------------N 70
           L +G   G   V+   P D  + RL  QT+  S  +     D+ K               
Sbjct: 127 LFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEE 186

Query: 71  EGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHL--SLLQYYICGVAG 128
            G MG Y+G     +G+   V+L F V E +K F  + DE  +  +  SL +  +  ++G
Sbjct: 187 GGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPS-DENGNSSMRDSLYKLSMGAISG 245

Query: 129 GFTNSFLASPIEHIRIRLQTQTGSGATAEFK-----GPIDCIKKLRVNGQLMRGLTPTML 183
           G   + +  P + +R R Q     G    F        +  I K        +GLT  + 
Sbjct: 246 GVAQT-ITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLF 304

Query: 184 RESHGCGVYFLTYE 197
           +      V +L YE
Sbjct: 305 KVVPSTAVSWLVYE 318

>Kwal_27.12481
          Length = 304

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 115/285 (40%), Gaps = 22/285 (7%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSET----------STNAVKVI 64
           +S   +   +  L+ G +  +++     P +  K+ +Q  +            T   +  
Sbjct: 3   DSKKQSNFAVDFLMGGVSAAVSKT-AAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECF 61

Query: 65  KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYIC 124
           K    NEG   F++G    ++      +L F   + +K  F    E              
Sbjct: 62  KRTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASG 121

Query: 125 GVAGGFTNSFLASPIEHIRIRLQTQTG---SGATAEFKGPIDCIKK-LRVNG--QLMRGL 178
           G AGG +  F+ S +++ R RL   +     G   +F G +D  KK L  +G   L RG 
Sbjct: 122 GAAGGLSLMFVYS-LDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238
            P+++      G+YF  Y++L    +   ++   + ++   L G A  T   T  YPLD 
Sbjct: 181 LPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASF---LLGWAVTTGASTASYPLDT 237

Query: 239 IKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++  M   + +  K  N      R I+A +G+  LFKG    +LR
Sbjct: 238 VRRRMMMTSGQAVKY-NGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 70/174 (40%), Gaps = 19/174 (10%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---------VKVIKDLIKNEGPMGFYKGT 80
           G AGG++ + V    D  + RL                  V V K  + ++G  G Y+G 
Sbjct: 122 GAAGGLSLMFV-YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
           L  +VG+     L FG  +++K    T     S   S L  ++ G A     S  + P++
Sbjct: 181 LPSVVGIVVYRGLYFGGYDSLKPLLLT----GSLEGSFLASFLLGWAVTTGASTASYPLD 236

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            +R R+     SG   ++ G  D  +K+        L +G    +LR   G GV
Sbjct: 237 TVRRRMMMT--SGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 111/263 (42%), Gaps = 20/263 (7%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV-KVIKDLIKNEGPMGFYKGTLTPLVGVG 88
           G A GI   +V  P D  KVRLQ +      + ++++ ++ NEG +G Y G    ++   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 89  ACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQT 148
              +++FG  + +K      ++  +    L      G  GG   +F  + + +IR++  +
Sbjct: 80  TYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNF--ADVVNIRMQNDS 137

Query: 149 QTGSGATAEFKGPIDCIKKL-RVNG---QLMRGLTPTMLRESHGCGVYFLTYEALIGHQV 204
              +     +K  ID + K+ R  G    L  G  P M+R         +TY+    + V
Sbjct: 138 ALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLV 197

Query: 205 KSGIQRKDIPAWKLCLFGAAS---GTLLWTMVYPLDVIKS-VMQTDNLKTPKNGNNILTV 260
                + D  A K      AS   G +  T+  P DV+K+ +M       P      L +
Sbjct: 198 ----TKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPA-----LKI 248

Query: 261 GRTIIARQGVSGLFKGFAPTMLR 283
               + ++G S +F+G+ P+  R
Sbjct: 249 LADAVRKEGPSFMFRGWLPSFTR 271

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 5/92 (5%)

Query: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-SETSTNAVKVIKDLIKNE 71
           D ++  + T +   LLAG    +    V  P D  K R+   S     A+K++ D ++ E
Sbjct: 201 DFDASKNYTHLTASLLAG----LVATTVCSPADVMKTRIMNGSGDHQPALKILADAVRKE 256

Query: 72  GPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR 103
           GP   ++G L     +G    L F   E +K+
Sbjct: 257 GPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKK 288

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 214 PAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGL 273
           P W    +G A+G     + +PLD+ K  +Q   +  P     +  +  +I+A +GV GL
Sbjct: 16  PWW----YGGAAGIFATMVTHPLDLAKVRLQAAPMPKP----TLFRMLESILANEGVVGL 67

Query: 274 FKGFAPTMLR 283
           + G +  +LR
Sbjct: 68  YSGLSAAVLR 77

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 122/306 (39%), Gaps = 50/306 (16%)

Query: 17  PHDNTRVIKDLLAGTAGGIA----QVLVGQPFDTTKVRLQTSE--------TSTNAVKVI 64
           P D + V   + +G AGGIA    + LV  P D  K+  QTS         +    V+  
Sbjct: 10  PVDKSSVDYIVKSGLAGGIAGSCAKTLVA-PLDRIKILFQTSNPQFAQFAGSMGGLVRAS 68

Query: 65  KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYIC 124
           K ++ ++GP GF++G    L+ +    +++F   E ++    +      +H S  +  + 
Sbjct: 69  KYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIR----SVVIPTWRHESHWRRLLS 124

Query: 125 GVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQL---------- 174
           G   G  + F+  P++ +R+RL   T     A+ +  + CI   R +  L          
Sbjct: 125 GSLAGLCSVFVTYPLDLVRVRLAYVT-ERHDAKVRKIMACIYNERPSEALRKWYIPQWFA 183

Query: 175 -----MRGLTPTMLRESHGCGVYFLTYEA---LIGHQV----------KSGIQRKDIP-- 214
                 RG TPT++      GV F  ++    +  H +           S    + +P  
Sbjct: 184 HWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLK 243

Query: 215 AWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTP--KNGNNILTVGRTIIARQGVSG 272
            W   + G  +G    T  YP ++I+  +Q   +  P  ++   I  + + I    G  G
Sbjct: 244 TWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRG 303

Query: 273 LFKGFA 278
            F G +
Sbjct: 304 FFVGLS 309

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 220 LFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNN---ILTVGRTIIARQGVSGLFKG 276
           L G  +G+   T+V PLD IK + QT N +  +   +   ++   + I+A  G  G F+G
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQG 83

Query: 277 FAPTMLR 283
            + T+LR
Sbjct: 84  HSATLLR 90

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 101/231 (43%), Gaps = 14/231 (6%)

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
           V   K    +EG + F++G    ++      +L F   + +K  F  F +    +     
Sbjct: 57  VDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFG-FRKEVDGYAKWFA 115

Query: 121 YYIC--GVAGGFTNSFLASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKK-LRVNG-- 172
             +   G AGG +  F+ S +++ R RL   + S   G   +F G +D  KK L  +G  
Sbjct: 116 GNLASGGAAGGLSLLFVYS-LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIA 174

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTM 232
            L RG  P+++      G+YF  Y++L    +   ++   I ++   L G A  T   T 
Sbjct: 175 GLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASF---LLGWAVTTGASTA 231

Query: 233 VYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            YPLD ++  M   + +  K  +      R I+A +GV  LFKG    +LR
Sbjct: 232 SYPLDTVRRRMMMTSGQAVKY-DGAFDAFRKIVAAEGVKSLFKGCGANILR 281

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 86/187 (45%), Gaps = 33/187 (17%)

Query: 118 LLQYYICGVAGGFTNSFLASPIEHIRIRLQTQT-----GSGATAEFKGPIDCIKKLRVNG 172
           L+ + + GV+   + +  A+PIE +++ +Q Q      GS     + G +DC K+   + 
Sbjct: 10  LINFMMGGVSAAVSKT-AAAPIERVKLLIQNQDEMLKQGS-LDRRYNGIVDCFKRTAASE 67

Query: 173 ---QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQ-----RKDIPAWKLCLFG-- 222
                 RG T  ++R       YF T +AL     K  I+     RK++  +     G  
Sbjct: 68  GVISFWRGNTANVIR-------YFPT-QAL-NFAFKDKIKAMFGFRKEVDGYAKWFAGNL 118

Query: 223 ---AASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG----NNILTVGRTIIARQGVSGLFK 275
               A+G L    VY LD  ++ +  D+    K G    N ++ V +  +A  G++GL++
Sbjct: 119 ASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYR 178

Query: 276 GFAPTML 282
           GF P+++
Sbjct: 179 GFLPSVV 185

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 72/174 (41%), Gaps = 19/174 (10%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---------VKVIKDLIKNEGPMGFYKGT 80
           G AGG++ + V    D  + RL     S            V V K  + ++G  G Y+G 
Sbjct: 122 GAAGGLSLLFV-YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
           L  +VG+     L FG+ +++K    T     +   S +  ++ G A     S  + P++
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLLT----GNLESSFIASFLLGWAVTTGASTASYPLD 236

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            +R R+     SG   ++ G  D  +K+        L +G    +LR   G GV
Sbjct: 237 TVRRRMMMT--SGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 31/186 (16%)

Query: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKV------------I 64
           PH    V  ++ AG   GI   +VG P    K R+Q   + +NA+K+            +
Sbjct: 123 PHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQ---SYSNAIKIGEQTHYTSMSNGL 179

Query: 65  KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD---EAASQHLSLLQY 121
             + K EG +G ++G    ++  GA  S+Q  +    K F    D   E  + H  LL  
Sbjct: 180 ATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALH--LLSS 237

Query: 122 YICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCI-KKLRVN--GQLMRGL 178
            + G+  G     + +P + +  R+  Q G+     +KGPIDC+ K +++   G L +G 
Sbjct: 238 TVTGLGVG----IVMNPWDVVLTRVYNQKGN----TYKGPIDCMFKTIKIEGIGALYKGF 289

Query: 179 TPTMLR 184
              + R
Sbjct: 290 GAQLFR 295

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 111/275 (40%), Gaps = 31/275 (11%)

Query: 32  AGGIAQ---VLVGQPFDTTKVRLQ-TSETSTNAVKVIKD-------LIKNEGPMGFYKGT 80
           AGG+A    V V  PF+  K R+Q   E S    ++ ++       + KNEG  G  +G 
Sbjct: 29  AGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGL 88

Query: 81  LTPLVGVGACVSLQFGVNEAM-----KRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFL 135
           ++  V        + G  E +     K FF   D    Q++++      G   G   + +
Sbjct: 89  VSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAV--NVTAGATSGIIGAIV 146

Query: 136 ASPIEHIRIRLQTQTGS-------GATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHG 188
            SP+  ++ R+Q+ + +         T+   G     KK  V G L RG+   +LR   G
Sbjct: 147 GSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLG-LFRGVDAAILRTGAG 205

Query: 189 CGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNL 248
             V    Y       +++ I  K+  A  L L    +G  +  ++ P DV+ + +     
Sbjct: 206 SSVQLPIYNTTKNFLLQNDIM-KEGTALHL-LSSTVTGLGVGIVMNPWDVVLTRVYNQKG 263

Query: 249 KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            T K   + +      I  +G+  L+KGF   + R
Sbjct: 264 NTYKGPIDCMF---KTIKIEGIGALYKGFGAQLFR 295

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 80/197 (40%), Gaps = 31/197 (15%)

Query: 109 DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE--FKGPIDCI- 165
           +++A+Q +S +  +I G         + +P E ++ R+Q Q    AT +  ++ P   + 
Sbjct: 14  EKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALG 73

Query: 166 ---KKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLF- 221
              K   V G L RGL    + +    G     YE +     K+     D    +     
Sbjct: 74  VIFKNEGVKG-LQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVN 132

Query: 222 ---GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGR------------TIIA 266
              GA SG +   +  PL ++K+ MQ+ +        N + +G             TI  
Sbjct: 133 VTAGATSGIIGAIVGSPLFLVKTRMQSYS--------NAIKIGEQTHYTSMSNGLATIFK 184

Query: 267 RQGVSGLFKGFAPTMLR 283
           ++GV GLF+G    +LR
Sbjct: 185 KEGVLGLFRGVDAAILR 201

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 101/259 (38%), Gaps = 21/259 (8%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLV 85
            LL+G A G +  LV  P DT K RLQ                 N G  G Y+G  + +V
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAK----------GGFFANGGYKGIYRGLGSAVV 56

Query: 86  GVGACVSLQFGVNEAMK-----RFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
                 SL F   + MK          + + + Q +    + +    G      +  P E
Sbjct: 57  ASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAE 116

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALI 200
            ++ R Q  + + +    +  +    K  +   L RG + T++RE     + F  YE L 
Sbjct: 117 VVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYLK 176

Query: 201 GHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTV 260
               K+  Q +  P WK  + G+ +G +      PLD +K+ +   N  T   G+ I+ +
Sbjct: 177 KTWAKANGQSQVEP-WKGAICGSIAGGIAAATTTPLDFLKTRLML-NKTTASLGSVIIRI 234

Query: 261 GRTIIARQGVSGLFKGFAP 279
            R     +G +  F G  P
Sbjct: 235 YR----EEGPAVFFSGVGP 249

>Kwal_26.7653
          Length = 325

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKV------------I 64
           PH    V  ++++G   GI   ++G P    K R+Q   + +NA+++            +
Sbjct: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGL 180

Query: 65  KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD---EAASQHLSLLQY 121
             + + EG  G Y+G    ++  GA  S+Q  +    K F    D   E    HL     
Sbjct: 181 SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL----- 235

Query: 122 YICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC-IKKLRVN--GQLMRGL 178
            +     GF    + +P + I  R+  Q G+     +KGP+DC +K +R+   G L +G 
Sbjct: 236 -VASTVSGFGVGVVMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGF 290

Query: 179 TPTMLR 184
              + R
Sbjct: 291 EAQIFR 296

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 82/193 (42%), Gaps = 23/193 (11%)

Query: 109 DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE--FKGPIDCIK 166
           D+ A+Q +S    +I G         + +PIE ++ R+Q Q    A A+  +K P+  +K
Sbjct: 15  DKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALK 74

Query: 167 KLRVNG---QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWK------ 217
            +  N     L +GL+   + +    G     YE      ++S + +   PA        
Sbjct: 75  VIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEP-----IRSVLNKTFYPAMDPHKVQN 129

Query: 218 ---LCLFGAASGTLLWTMVYPLDVIKSVMQTDN----LKTPKNGNNILTVGRTIIARQGV 270
                + GA SG +   M  PL +IK+ MQ+ +    +    +  +I     +I   +G 
Sbjct: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189

Query: 271 SGLFKGFAPTMLR 283
            GL++G    +LR
Sbjct: 190 KGLYRGVDAAILR 202

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 77/178 (43%), Gaps = 18/178 (10%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---------VKVIKDLIKNEGPMGF 76
           +L +G A G   +L     D  + RL     S+             V K  +K++G  G 
Sbjct: 119 NLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGL 178

Query: 77  YKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA 136
           Y+G +  +VG+     L FG+ +++K    T     S   S L  ++ G       S  +
Sbjct: 179 YRGFMPSVVGIVVYRGLYFGMFDSLKPLVLT----GSLDGSFLASFLLGWVVTTGASTCS 234

Query: 137 SPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            P++ +R R+     SG   ++ G IDC+KK+  +   G L +G    +LR   G GV
Sbjct: 235 YPLDTVRRRMMMT--SGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV 290

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 111/282 (39%), Gaps = 22/282 (7%)

Query: 18  HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE----------TSTNAVKVIKDL 67
            +    I  L+ G +  IA+     P +  K+ +Q  +            +  V   K  
Sbjct: 8   QETNFAINFLMGGVSAAIAKT-AASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRT 66

Query: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVA 127
            K EG + F++G    ++      +L F   + +K  F    E              G A
Sbjct: 67  AKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAA 126

Query: 128 GGFTNSFLASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKK-LRVNG--QLMRGLTPT 181
           G  +  F+ S ++  R RL     S   G   +F G  D  KK L+ +G   L RG  P+
Sbjct: 127 GALSLLFVYS-LDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPS 185

Query: 182 MLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKS 241
           ++      G+YF  +++L    +   +    + ++   L G    T   T  YPLD ++ 
Sbjct: 186 VVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASF---LLGWVVTTGASTCSYPLDTVRR 242

Query: 242 VMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            M   + +  K  N  +   + I+A +GV  LFKG    +LR
Sbjct: 243 RMMMTSGQAVKY-NGAIDCLKKIVASEGVGSLFKGCGANILR 283

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 120/279 (43%), Gaps = 33/279 (11%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSETSTNAVKVIKDLIKNEGPMGFYKGT 80
           K  +AG   G  +  V  PF+  K RLQ     S+ S N + +I +  K +G    Y G 
Sbjct: 11  KSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGC 70

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA-SPI 139
              +VG  A   ++F   + +K       +  +  LS  +  I G+  G   S +A +P 
Sbjct: 71  PAFIVGNTAKAGVRFLGFDTIKNLLR---DPKTGELSGPRGVIAGLGAGLLESVVAVTPF 127

Query: 140 EHIRIRLQTQTGSGATAEF----KGPID----CIKKLRVNGQLMRGLTPTMLRESHGCGV 191
           E I+  L     S AT ++    KG +      ++K  ++G L RG+ P  +R++    V
Sbjct: 128 EAIKTALIDDKQS-ATPKYHNNGKGMLRNYTALVRKQGLSG-LYRGVLPVSMRQAANQAV 185

Query: 192 YFLTYEALIGHQVKSGIQR-----KDIPAWKLCLF--GAASGTLLWTMVYPLDVIKSVMQ 244
               Y     +++K  +Q      KD P      F  GA SG +      P+D +K+ MQ
Sbjct: 186 RLGCY-----NKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQ 240

Query: 245 TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           + + K   +  N  T   TI   +G+   +KG  P + R
Sbjct: 241 SLDSKRYSSTINCFT---TIFKEEGLKAFWKGATPRLGR 276

>Kwal_23.3042
          Length = 542

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/314 (25%), Positives = 125/314 (39%), Gaps = 44/314 (14%)

Query: 13  DLESPHDNTRVIKDLLAG----TAGGIAQVL---VGQPFDTTKVRLQTSETSTNAVKVIK 65
           DL S  D T +I D + G     AGG++ V+      PFD  KV L      ++     K
Sbjct: 208 DLSSEGDVT-LINDFIRGFGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSK 266

Query: 66  DLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVN--------EAMKRF------FHTFDEA 111
           D+I  + P        +PLV     +  Q G+          AMK F      F +F+ A
Sbjct: 267 DIILEKNPNADLSKIKSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELA 326

Query: 112 A-----------SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKG 160
                       +  LS    Y+ G  GG        PI+ ++ R+Q    +  +   + 
Sbjct: 327 KRLMAQLEGVQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQL 386

Query: 161 PIDCIKKLRVNGQL---MRGLTPTMLRESHGCGVYFLTYEAL----IGHQVK-SGIQRKD 212
            I   K +   G L    RG+T  ++       +   T+ AL    I  Q + +G+    
Sbjct: 387 LISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQ 446

Query: 213 IPAWKL--CLFGAASGTLLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIARQG 269
           +    +   L GA SGT+  T VYP++++++ +Q       P   N    V    + R+G
Sbjct: 447 VTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREG 506

Query: 270 VSGLFKGFAPTMLR 283
             GLFKG  P + +
Sbjct: 507 YQGLFKGLVPNLAK 520

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 80/190 (42%), Gaps = 21/190 (11%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA------VKVIKDLIKNEGPMGFYKGTL 81
           LAG  GG+   L   P DT K R+Q +  +T +      +   KD+ K  G   FY+G  
Sbjct: 349 LAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGIT 408

Query: 82  TPLVGVGACVSLQFGVNEAMKRFFHTF---------DEAASQHLSLLQYYICGVAGGFTN 132
             ++G+    ++  G   A+K+++            D+    ++ +L   + G   G   
Sbjct: 409 VGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVL---LMGAFSGTVG 465

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDC-IKKLRVNGQ--LMRGLTPTMLRESHGC 189
           +    P+  +R RLQ Q        + G  D  +K ++  G   L +GL P + +     
Sbjct: 466 ATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAV 525

Query: 190 GVYFLTYEAL 199
            + +L YE L
Sbjct: 526 SISYLCYENL 535

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 6/83 (7%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK------VIKDLIKNEGPMGFYKGT 80
           LL G   G        P +  + RLQ   T  +  +      V+   ++ EG  G +KG 
Sbjct: 455 LLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

Query: 81  LTPLVGVGACVSLQFGVNEAMKR 103
           +  L  V   VS+ +   E +KR
Sbjct: 515 VPNLAKVCPAVSISYLCYENLKR 537

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 112/302 (37%), Gaps = 58/302 (19%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA--------VKVIKDLIKNEGPMGFYK 78
           L  G +G  A+ L+  P D  K+  QTS              V+  K +  N+G  GF++
Sbjct: 38  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQ 96

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASP 138
           G    L+ +    +++F   E ++       E  S    L    + G   G  + F+  P
Sbjct: 97  GHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRRL----VSGSLAGLCSVFITYP 152

Query: 139 IEHIRIRLQTQT-------GSGATAEFKGPIDC--IKKLRVNG------QLMRGLTPTML 183
           ++ +R+RL  +T       G      +K P     IK   +           RG  PT+L
Sbjct: 153 LDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVL 212

Query: 184 RESHGCGVYFLTYEALIGHQV-KSGI---------------------QRKDIPAWKLCLF 221
                 GV F  ++ L  H V KS                       QR+ +  W   + 
Sbjct: 213 GMIPYAGVSFFAHDLL--HDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELIS 270

Query: 222 GAASGTLLWTMVYPLDVIKSVMQTDNLKTPK-----NGNNILTVGRTIIARQGVSGLFKG 276
           G  +G    T  YP ++I+  +Q   L +PK        +I  +   I   +GV G F G
Sbjct: 271 GGLAGMASQTAAYPFEIIRRRLQVSAL-SPKTMYDHKFQSISEIAHIIFKERGVRGFFVG 329

Query: 277 FA 278
            +
Sbjct: 330 LS 331

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 220 LFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNIL---TVGRTIIARQGVSGLFKG 276
           L G  SG+   T++ PLD IK + QT N    K   +++      + I    GV G F+G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 277 FAPTMLR 283
            + T+LR
Sbjct: 98  HSATLLR 104

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 9/93 (9%)

Query: 22  RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV---------KVIKDLIKNEG 72
           R   +L++G   G+A      PF+  + RLQ S  S   +         ++   + K  G
Sbjct: 263 RTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERG 322

Query: 73  PMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFF 105
             GF+ G     + V   V+  F V E MK  F
Sbjct: 323 VRGFFVGLSIGYIKVTPMVACSFFVYERMKWNF 355

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 76/178 (42%), Gaps = 18/178 (10%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---------VKVIKDLIKNEGPMGF 76
           +L +G A G   +L     D  + RL     S+           + V K  +K++G  G 
Sbjct: 130 NLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGL 189

Query: 77  YKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA 136
           Y+G L  +VG+     L FG+ +++K    T     S   S L  ++ G       S  +
Sbjct: 190 YRGFLPSVVGIVVYRGLYFGMYDSLKPLLLT----GSLEGSFLASFLLGWVVTTGASTCS 245

Query: 137 SPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            P++ +R R+     SG   ++ G  DC++K+      G L +G    +LR   G GV
Sbjct: 246 YPLDTVRRRMMMT--SGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV 301

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 116/281 (41%), Gaps = 22/281 (7%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE------TSTNAVKVIKDLIK--- 69
           ++  +I  L+ G +  +A+     P +  K+ +Q  +      T       I D  K   
Sbjct: 20  ESNFLIDFLMGGVSAAVAKT-AASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTA 78

Query: 70  -NEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAG 128
             EG + F++G    ++      +L F   + +K  F    E              G AG
Sbjct: 79  TQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAG 138

Query: 129 GFTNSFLASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKK-LRVNG--QLMRGLTPTM 182
             +  F+ S +++ R RL   + S   G   +F G ID  KK L+ +G   L RG  P++
Sbjct: 139 ALSLLFVYS-LDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSV 197

Query: 183 LRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSV 242
           +      G+YF  Y++L    +   ++   + ++   L G    T   T  YPLD ++  
Sbjct: 198 VGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASF---LLGWVVTTGASTCSYPLDTVRRR 254

Query: 243 MQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           M   + +  K  +      R I+A +GV  LFKG    +LR
Sbjct: 255 MMMTSGQAVKY-DGAFDCLRKIVAAEGVGSLFKGCGANILR 294

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 113/280 (40%), Gaps = 41/280 (14%)

Query: 32  AGGIAQ---VLVGQPFDTTKVRLQ-TSETSTNAVKVIKD-------LIKNEGPMGFYKGT 80
           AGG+A    V V  P +  K+R+Q   E S +A KV K+       + KNEG  G  KG 
Sbjct: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG- 86

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHL----------SLLQYYICGVAGGF 130
                 + A    Q G+N +   F+     + +Q            S+      G A G 
Sbjct: 87  ------LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGI 140

Query: 131 TNSFLASPIEHIRIRLQTQT-------GSGATAEFKGPIDCIKKLRVNGQLMRGLTPTML 183
             + + SP+  ++ RLQ+ +        +  T  + G +   K   V G L RG+   +L
Sbjct: 141 IGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG-LFRGIDAAIL 199

Query: 184 RESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVM 243
           R   G  V    Y       VK+ +  KD PA  L      SG  +  ++ P DVI + +
Sbjct: 200 RTGAGSSVQLPIYNTAKNILVKNDLM-KDGPALHLTA-STISGLGVAVVMNPWDVILTRI 257

Query: 244 QTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
                   K   + L      +  +GV+ L+KGFA  + R
Sbjct: 258 YNQKGDLYKGPIDCLV---KTVRIEGVTALYKGFAAQVFR 294

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 81/191 (42%), Gaps = 25/191 (13%)

Query: 9   QLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-SE-----TSTNAVK 62
           QL    + PH    V  ++ +G A GI   ++G P    K RLQ+ SE       T+   
Sbjct: 114 QLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTG 173

Query: 63  VIKDLI---KNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD---EAASQHL 116
           V   L+   K EG  G ++G    ++  GA  S+Q  +    K      D   +  + HL
Sbjct: 174 VWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHL 233

Query: 117 SLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC-IKKLRVNG--Q 173
           +       GVA       + +P + I  R+  Q G      +KGPIDC +K +R+ G   
Sbjct: 234 TASTISGLGVA------VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTA 283

Query: 174 LMRGLTPTMLR 184
           L +G    + R
Sbjct: 284 LYKGFAAQVFR 294

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 89/197 (45%), Gaps = 31/197 (15%)

Query: 109 DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE--FKGPIDCIK 166
           ++ A+Q +S    ++ G         + +PIE I+IR+Q Q    A+A   +K PI  + 
Sbjct: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72

Query: 167 KLRVN---GQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWK------ 217
            +  N     L +GL    + +    G     YE      ++S + +   P  +      
Sbjct: 73  VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEP-----IRSSLNQLFFPDQEPHKVQS 127

Query: 218 --LCLF-GAASGTLLWTMVYPLDVIKSVMQTDN------LKTPKNG--NNILTVGRTIIA 266
             + +F GAASG +   +  PL ++K+ +Q+ +       +T   G  N ++T+ +T   
Sbjct: 128 VGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKT--- 184

Query: 267 RQGVSGLFKGFAPTMLR 283
            +GV GLF+G    +LR
Sbjct: 185 -EGVKGLFRGIDAAILR 200

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 115/289 (39%), Gaps = 23/289 (7%)

Query: 11  IDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---------- 60
           + + + P  N   I  L+ G +  +A+     P +  K+ +Q  +               
Sbjct: 1   MSETKKPQSNF-AIDFLMGGVSAAVAKT-AASPIERVKLLIQNQDEMIKQGSLDHRYKGI 58

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
           V   +   + EG + F++G    ++      +L F   + +K  F    E          
Sbjct: 59  VDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGN 118

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKKLRVN---GQL 174
               G+AGG +  F+ S +++ R RL     S   G   +F G +D  KK   +     L
Sbjct: 119 LASGGIAGGLSLMFVYS-LDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGL 177

Query: 175 MRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVY 234
            RG  P+++      G+YF  Y++     +   ++   I ++   L G    T   T  Y
Sbjct: 178 YRGFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASF---LLGWVVTTGASTASY 234

Query: 235 PLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           PLD ++  M   + +  K     +   + I+A +GVS LFKG    +LR
Sbjct: 235 PLDTVRRRMMMTSGQAVKY-KGAMDCLQKIVAAEGVSSLFKGCGANILR 282

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 76/174 (43%), Gaps = 19/174 (10%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---------VKVIKDLIKNEGPMGFYKGT 80
           G AGG++ + V    D  + RL     S+           V V K  I ++G  G Y+G 
Sbjct: 123 GIAGGLSLMFV-YSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
           L  ++G+     L FG+ ++ K    T     S   S L  ++    G  T S+   P++
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVV-TTGASTASY---PLD 237

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            +R R+     SG   ++KG +DC++K+        L +G    +LR   G GV
Sbjct: 238 TVRRRMMMT--SGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGV 289

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 123/314 (39%), Gaps = 44/314 (14%)

Query: 13  DLESPHDNTRVIKDLLAG----TAGGIAQVL---VGQPFDTTKV----RLQTSETSTNA- 60
           DL S  D T +I D + G     AGG + V+      PFD  KV    R   S T  N+ 
Sbjct: 179 DLSSEGDVT-LINDFIRGFGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSK 237

Query: 61  -------------------VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAM 101
                              +K    L +  G   FY G    ++ V    +++FG  E  
Sbjct: 238 DKVLMKNPNADISKIKSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELA 297

Query: 102 KRFF-HTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKG 160
           K+   H      +  LS    YI G  GG    F   PI+ ++ R+Q      A    + 
Sbjct: 298 KQLMAHLEGVHHTSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNEL 357

Query: 161 PIDCIKKLRVNGQL---MRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWK 217
            I   +++  +G L    RG+T  ++       +   T+ AL    +    +   +P  +
Sbjct: 358 LISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQ 417

Query: 218 LCL-------FGAASGTLLWTMVYPLDVIKSVMQTD-NLKTPKNGNNILTVGRTIIARQG 269
           + +        GA SGT+  T+VYP++++++ +Q       P        V    + R+G
Sbjct: 418 VTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREG 477

Query: 270 VSGLFKGFAPTMLR 283
             GLFKG  P + +
Sbjct: 478 YQGLFKGLVPNLAK 491

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 6/80 (7%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTS------ETSTNAVKVIKDLIKNEGPMGFYKGTLTP 83
           G   G     V  P +  + RLQ         T T    V+   ++ EG  G +KG +  
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPN 488

Query: 84  LVGVGACVSLQFGVNEAMKR 103
           L  V   VS+ +   E  KR
Sbjct: 489 LAKVCPAVSISYLCYENFKR 508

>Scas_718.24
          Length = 337

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 117/285 (41%), Gaps = 23/285 (8%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE------TSTNAVKVIKDLI 68
           E P  N   I  L+ G +  +A+     P +  K+ +Q         T     K I D  
Sbjct: 36  EKPQSNF-AIDFLMGGVSAAVAKT-AASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCF 93

Query: 69  K----NEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYIC 124
           +     EG + F++G    ++      +L F   + +K  F    E              
Sbjct: 94  RRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLASG 153

Query: 125 GVAGGFTNSFLASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKK-LRVNG--QLMRGL 178
           G AGG +  F+ S ++  R RL   + S   G + +F G ID  KK L+ +G   L RG 
Sbjct: 154 GAAGGLSLLFVYS-LDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 179 TPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238
            P+++      G+YF  Y+++    +   ++   + ++   L G    T   T  YPLD 
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASF---LLGWVVTTGASTCSYPLDT 269

Query: 239 IKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++  M   + +  K         + I+A +GV+ LFKG    +LR
Sbjct: 270 VRRKMMMTSGQAVKY-KGAFDCFKKIVAAEGVASLFKGCGANILR 313

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 75/174 (43%), Gaps = 19/174 (10%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETSTNA---------VKVIKDLIKNEGPMGFYKGT 80
           G AGG++ + V    D  + RL     S+           + V K  +K++G  G Y+G 
Sbjct: 154 GAAGGLSLLFV-YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
           L  +VG+     L FG+ +++K    T     S   S L  ++ G       S  + P++
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLLT----GSLEGSFLASFLLGWVVTTGASTCSYPLD 268

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            +R ++     SG   ++KG  DC KK+        L +G    +LR   G GV
Sbjct: 269 TVRRKMMMT--SGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGV 320

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 111/279 (39%), Gaps = 39/279 (13%)

Query: 32  AGGIAQ---VLVGQPFDTTKVRLQ-TSETSTNAVKVIKD-------LIKNEGPMGFYKGT 80
           AGG+A    V V  PFD  K R+Q   E   NA KV  +       + KNEG  G  KG 
Sbjct: 26  AGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGL 85

Query: 81  LTPLVGVGACVSLQFGVNEAMK-----RFFHTFDEAASQHLSLLQYYICGVAGGFTNSFL 135
            +  +   A    + G  E ++      F+   +    QH+ +      G   G   +F+
Sbjct: 86  ASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGI--NVAAGATSGVVGAFI 143

Query: 136 ASPIEHIRIRLQTQTGS-------GATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHG 188
            SP+  ++ R+Q+ + +         T+ F G     +   + G L RG+   MLR   G
Sbjct: 144 GSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKG-LFRGVDAAMLRTGIG 202

Query: 189 CGV----YFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQ 244
             V    Y +    L+ H + +      + +  +  FG       W +V    + +   Q
Sbjct: 203 SAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWDVV----LTRVYNQ 258

Query: 245 TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
             NL +      I TV       +G+S L+KGF   +LR
Sbjct: 259 KGNLYSGPIDCFIKTV-----RNEGLSALYKGFGAQILR 292

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 81/198 (40%), Gaps = 29/198 (14%)

Query: 6   PTPQLIDDLESPHDNTRVIK----DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS---- 57
           P   +++++  P+  +  ++    ++ AG   G+    +G P    K R+Q+   +    
Sbjct: 105 PIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIG 164

Query: 58  -----TNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD--- 109
                T+A   +  + ++EG  G ++G    ++  G   ++Q  +    K F    D   
Sbjct: 165 QQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMN 224

Query: 110 EAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC-IKKL 168
           +    HL      +     GF      +P + +  R+  Q G+     + GPIDC IK +
Sbjct: 225 DGTGLHL------LSSTIAGFGVGVAMNPWDVVLTRVYNQKGN----LYSGPIDCFIKTV 274

Query: 169 RVNG--QLMRGLTPTMLR 184
           R  G   L +G    +LR
Sbjct: 275 RNEGLSALYKGFGAQILR 292

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 74/184 (40%), Gaps = 36/184 (19%)

Query: 126 VAGGFTNSF---LASPIEHIRIRLQTQTGSGATAE--FKGPIDCIKKLRVN---GQLMRG 177
           VAGG        + +P + ++ R+Q Q    A A   +  PI     +  N     L +G
Sbjct: 25  VAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKG 84

Query: 178 LTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKL------CLFGAASGTLLWT 231
           L    L +    G     YE + G  + + +   ++ + K+         GA SG +   
Sbjct: 85  LASAYLYQIALNGSRLGFYEPIRG--ILNNVFYPNVESHKVQHIGINVAAGATSGVVGAF 142

Query: 232 MVYPLDVIKSVMQTDNLKTPKNGNNILTVGR------------TIIARQGVSGLFKGFAP 279
           +  PL ++K+ MQ+ +        N + +G+            TI   +G+ GLF+G   
Sbjct: 143 IGSPLFLVKTRMQSYS--------NAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDA 194

Query: 280 TMLR 283
            MLR
Sbjct: 195 AMLR 198

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 118/280 (42%), Gaps = 33/280 (11%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSETSTNAVKVIKDLIKNEGPMGFYKG 79
           +   LAG+  G A+  +  PF+  K RLQ     S+ S N + +I    K +G    Y G
Sbjct: 13  LHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVG 72

Query: 80  TLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA-SP 138
               ++G  A   ++F   + +K       ++ +  LS  +  I G+  G   S  A +P
Sbjct: 73  CPAFIIGNTAKAGIRFLGFDTIKDMLR---DSETGELSGTRGVIAGLGAGLLESVAAVTP 129

Query: 139 IEHIRIRLQTQTGSGATAEF----KGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCGV 191
            E I+  L     S AT ++    +G +     L R  G   L RG+ P  +R++    V
Sbjct: 130 FEAIKTALIDDKQS-ATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAV 188

Query: 192 YFLTYEALIGHQVKSGIQR-----KDIPAWKLCLF--GAASGTLLWTMVYPLDVIKSVMQ 244
               Y     +++K+ IQ      KD P      F  GA SG +      PLD +K+ MQ
Sbjct: 189 RLGCY-----NKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQ 243

Query: 245 T-DNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           + D+ K     N       TI   +G+   +KG  P + R
Sbjct: 244 SLDSTKYSSTMNCF----ATIFKEEGLKTFWKGATPRLGR 279

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 135/336 (40%), Gaps = 67/336 (19%)

Query: 1   MTEEFPTPQLIDDLESPHDNTRVIK---DLLAGTAGGIAQVLVGQPFDTTKVRLQTS--- 54
           + + FP P  +   +S   N + +K     +AG  GG+A  +V  PFD  K RLQ+    
Sbjct: 29  LKDAFPPP--VQRADSSQQNIKEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQ 86

Query: 55  -----------ETSTNAVK-----------VIKDLIKNEGPMGFYKGTLTPLVGVGACVS 92
                          N +            +I ++ +NEG    +KG    LVGV    S
Sbjct: 87  AAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARS 146

Query: 93  LQF----GVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQT 148
           + F       E   +  +   EA   HL      +     G+  S   +PI  ++ RLQ 
Sbjct: 147 INFFTYGTTKEIYSKTLNNGQEAVWIHL------MAAATAGWATSTATNPIWLVKTRLQL 200

Query: 149 QTGSGATAEFKGPIDCIKKLRVNGQ----LMRGLTPTMLRESHGCGVYFLTYEALIGHQV 204
              +G T ++K   DC+K + V  +    L +GL+ + L    G  + ++ YE +  H +
Sbjct: 201 DK-AGTTKKYKNSWDCLKNV-VQKEGILGLYKGLSASYLGSVEGI-LQWVLYEQM-KHII 256

Query: 205 KSGIQRK-------------DIPAWKLCLFGAASGTLLWT---MVYPLDVIKSVMQTDNL 248
           K     K              I  W  C    ++G   +    + YP +V+++ ++   L
Sbjct: 257 KQRSMEKFGNISEVEKSTSDKIKEW--CQRSGSAGLAKFVASIITYPHEVVRTRLRQAPL 314

Query: 249 KTPK-NGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           +  K     ++   R II  +G++ ++ G  P +LR
Sbjct: 315 ENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLR 350

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 78/194 (40%), Gaps = 21/194 (10%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQ-----TSETSTNAVKVIKDLIKNEGPMGFYKGTL 81
           L+A    G A      P    K RLQ     T++   N+   +K++++ EG +G YKG  
Sbjct: 174 LMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLS 233

Query: 82  TPLVGVGACVSLQFGVNEAMKRF--------FHTFDEAASQHLSLLQYYI--CGVAG--G 129
              +G    + LQ+ + E MK          F    E        ++ +    G AG   
Sbjct: 234 ASYLGSVEGI-LQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAK 292

Query: 130 FTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIK---KLRVNGQLMRGLTPTMLRES 186
           F  S +  P E +R RL+         ++ G +  I+   K      +  GLTP +LR  
Sbjct: 293 FVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTV 352

Query: 187 HGCGVYFLTYEALI 200
               + F T+E +I
Sbjct: 353 PNSIIMFGTWELVI 366

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 110/296 (37%), Gaps = 46/296 (15%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA--------VKVIKDLIKNEGPMGFYK 78
           L  G +G  A+ L+  P D  K+  QTS    +          +  K +  N+G  GF++
Sbjct: 23  LAGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQ 81

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGF-------T 131
           G    L+ +    +++F   E ++       E  S    L    + G+   F       T
Sbjct: 82  GHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLASGSLAGLCSVFITYPLDLT 141

Query: 132 NSFLASPIEHIRIRL----QTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESH 187
              LA   EH R++L    +T     A+      +   K         RG  PT+L    
Sbjct: 142 RVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIP 201

Query: 188 GCGVYFLTYEALIGHQVKSGI---------------------QRKDIPAWKLCLFGAASG 226
             GV F  ++ LI   +KS +                     Q+  +  W   + G  SG
Sbjct: 202 YAGVSFFAHD-LIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSG 260

Query: 227 TLLWTMVYPLDVIKSVMQTDNLKTPKNGNN----ILTVGRTIIARQGVSGLFKGFA 278
            L  T  YPL++I+  +Q   L   K  ++    I ++ R I   +G  G F G +
Sbjct: 261 ILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLS 316

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 220 LFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNIL---TVGRTIIARQGVSGLFKG 276
           L G  SG+   T++ PLD IK + QT N    K   +++      + I    G+ G F+G
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQG 82

Query: 277 FAPTMLR 283
            + T+LR
Sbjct: 83  HSVTLLR 89

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 36/90 (40%), Gaps = 9/90 (10%)

Query: 22  RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST--------NAVKVIKDLIKNE-G 72
           R   +L+AG   GI       P +  + RLQ S  S          ++  I  +I  E G
Sbjct: 248 RTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKG 307

Query: 73  PMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
             GF+ G     + V   V+  F V E MK
Sbjct: 308 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 114/277 (41%), Gaps = 31/277 (11%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSETSTNAVKVIKDLIKNEGPMGFYKGTL 81
             LAG+  G  +  +  PF+  K RLQ     S+ S N + +I +  KN G    Y G  
Sbjct: 93  SFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCP 152

Query: 82  TPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA-SPIE 140
             +VG  A   ++F   + +K       +  +  LS  +  + G+  G   S +A +P E
Sbjct: 153 AFIVGNTAKAGIRFLGFDTIKNLLR---DKKTGELSGFRGVVAGLGAGLLESVVAVTPFE 209

Query: 141 HIRIRLQTQTGSGATAEF----KGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGVYF 193
            I+  L       A  ++    KG +    KL  +     L RG+ P  +R++    V  
Sbjct: 210 AIKTAL-IDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRL 268

Query: 194 LTYEALIGHQVKSGIQR-----KDIPAWKLCLF--GAASGTLLWTMVYPLDVIKSVMQTD 246
             Y     +++K+ +Q      KD P      F  GA SG +      P+D +K+ MQ+ 
Sbjct: 269 GCY-----NKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSL 323

Query: 247 NLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           N     +  N      TI   +G+   +KG  P + R
Sbjct: 324 NAGQYSSTINCFA---TIFKEEGLKTFWKGATPRLGR 357

>Kwal_26.7972
          Length = 358

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 123/324 (37%), Gaps = 65/324 (20%)

Query: 12  DDLESPHDNTRVIKD-----LLAGTAGGIA----QVLVGQPFDTTKVRLQTSE------- 55
           DD   P  N  V K      L +G AGGIA    + L+  P D  K+  QTS        
Sbjct: 8   DDSMVPSKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIA-PLDRIKILFQTSNPHYLKYS 66

Query: 56  -TSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQ 114
            ++   ++    +  ++G  GFY+G    L+ +    +++F   E ++ F     E  + 
Sbjct: 67  GSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETH 126

Query: 115 HLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQL 174
              L      G   G  + F+  P++ IR+RL   T   +  +    I  I   R +  L
Sbjct: 127 ARRLAS----GSMAGLCSVFMTYPLDLIRVRLAYVTDR-SRIKMLPVIKQIYTERASESL 181

Query: 175 ----------------MRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGI---------- 208
                            RG TPT+L      GV F  ++ L G  ++SG           
Sbjct: 182 TSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHD-LCGDILRSGALSPYSVLPIS 240

Query: 209 -----------QRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNI 257
                        + +  W   + G  +G    T  YP ++I+  +Q  ++ +P + +N 
Sbjct: 241 DEELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQV-SVVSPTSIHNF 299

Query: 258 LTVG---RTIIARQGVSGLFKGFA 278
            T+    R I   +G  G F G +
Sbjct: 300 QTIPDMIRIIYKERGWRGFFVGLS 323

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 19/111 (17%)

Query: 14  LESPHDNTRVIK---DLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSETSTNAVKVIKDL 67
           + S   ++R +K   +L+AG   G+A      PF+  + RLQ    S TS +  + I D+
Sbjct: 246 IRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDM 305

Query: 68  I----KNEGPMGFYKG------TLTPLVGVGACVSLQFGVNEAMKRFFHTF 108
           I    K  G  GF+ G       +TP+V   AC   +   NE +  +  T+
Sbjct: 306 IRIIYKERGWRGFFVGLSIGYIKVTPMV---ACSFFRLRKNEVVSEYLRTY 353

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 220 LFGAASGTLLWTMVYPLDVIKSVMQTDN---LKTPKNGNNILTVGRTIIARQGVSGLFKG 276
           L G  +G+   T++ PLD IK + QT N   LK   +   ++  G  I A  G+ G ++G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 277 FAPTMLR 283
            + T++R
Sbjct: 92  HSATLIR 98

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 117/305 (38%), Gaps = 45/305 (14%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---ETSTNAVKVIKDLIKNE 71
           +S  D + +   +++G  GG          DT K R Q +   +   N +   + +   E
Sbjct: 45  DSDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEE 104

Query: 72  G-PMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGF 130
           G   G Y G +  ++G     ++ FG  E  KR   T  E   Q    + +   G  G F
Sbjct: 105 GVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKR---TMIEDW-QINDTITHLSAGFLGDF 160

Query: 131 TNSFLASPIEHIRIRLQTQT-------GSGAT-AEFKGPIDCIKKLRVNGQLMRGLTPTM 182
            +SF+  P E ++ RLQ Q         SG   +  +  I  + K      L  G   T+
Sbjct: 161 ISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATL 220

Query: 183 LRESHGCGVYFLTYEALIGHQVKSGIQRKD-------IPAWKLCLFGAASGTLLWTMVYP 235
            R+     + F  YE     Q+   I++KD       IP     L GA +G L   +  P
Sbjct: 221 ARDLPFSALQFAFYEKF--RQLAFKIEQKDGRDGELSIP--NEILTGACAGGLAGIITTP 276

Query: 236 LDVIKSVMQTDNLKTPKN------------------GNNILTVGRTIIARQGVSGLFKGF 277
           +DV+K+ +QT    +  N                   N+I    RT+   +GV G F G 
Sbjct: 277 MDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGV 336

Query: 278 APTML 282
            P  +
Sbjct: 337 GPRFV 341

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 116/282 (41%), Gaps = 37/282 (13%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLV- 85
           L+ G AGG++  +  QP D  K R Q ++  T   + +K L   + P   ++GTL   + 
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQQTKGGT-LWQTVKSL---DTPWQLWRGTLPSAIR 63

Query: 86  -GVGACVSLQ----FGVNEAMKRFFHTFDEAA---SQHLSLLQYYICGVAGGF---TNSF 134
             VG+ + L          A ++ F T D      S +L  L  Y   V G F   T  +
Sbjct: 64  TSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGY 123

Query: 135 LASPIEHIRIRLQ-TQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYF 193
           +  PI  I++R + T     + AE    I   + +R      RG  PT LR++   G+Y 
Sbjct: 124 ITMPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIR---GFFRGFGPTCLRDAPYSGLYV 180

Query: 194 LTYEALIGHQV-----KSGIQRKD---IPAWKLCLFGAASGTLLWTMV----YPLDVIKS 241
           L YE L  H +     KS +Q        A+      + S  L  +M      P D IK+
Sbjct: 181 LLYEKL-KHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKT 239

Query: 242 VMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            MQ +    P       +   TI+ ++    +F G +  + R
Sbjct: 240 RMQLE----PTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTR 277

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 111/277 (40%), Gaps = 40/277 (14%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK----VIKDLIKNEGPMGFYKGTL 81
            ++AG+  G+   +   P DT K+R Q      +  K     ++ ++K EG    +KG +
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNI 80

Query: 82  TPLVGVGACVSLQFG----VNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLAS 137
                     ++QFG     N      F  F +         Q    G   G T+S ++ 
Sbjct: 81  PATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQG-------QTLTVGALAGMTSSVVSY 133

Query: 138 PIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQL---MRGLTPTMLRESHGCGVYFL 194
           P++ +R RL     S  T+  +   +C +++ +N  +     G++  M   +    + FL
Sbjct: 134 PLDLLRTRLIANRTSHRTSVAE---EC-RQMWLNEGVRGFFTGISTAMTTVTLSTAIMFL 189

Query: 195 TYEA--LIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPK 252
           TYE   ++    +     + + A      G  +G +  TMV+P+D ++  MQ  N K   
Sbjct: 190 TYETVNIVCENHEKEFWSRPVSASS----GIIAGFVSKTMVFPIDTLRRRMQVMNSKRTV 245

Query: 253 NGNNILTVGR------------TIIARQGVSGLFKGF 277
           +      V               I+ ++GVS L++G 
Sbjct: 246 HFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGL 282

 Score = 28.1 bits (61), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 205 KSGIQRKDIPAW-KLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRT 263
           K  +++ +  +W    + G+ SG        P+D +K   Q   ++  K    I +  RT
Sbjct: 7   KDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKY-KGIASTVRT 65

Query: 264 IIARQGVSGLFKGFAP 279
           I+  +G+  L+KG  P
Sbjct: 66  IMKEEGLRALWKGNIP 81

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 123/295 (41%), Gaps = 39/295 (13%)

Query: 17  PHD--NTRVIKDLLAGTAGGIAQVLVGQPFDTTKVR-----LQTSETSTNAVKVIKDLIK 69
           P D   TR+  D+        A+ L+    +TT+ R     LQ +      V +I ++ +
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALM---MNTTRPRIVNLTLQAATHFKETVSIIGNVYR 132

Query: 70  NEGPMGFYKGTLTPLVGVGACVSLQF----GVNEAMKRFFHTFDEAASQHLSLLQYYICG 125
            EG    +KG    LVGV    S+ F       +   + F+   EA   HL      +  
Sbjct: 133 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHL------MAA 186

Query: 126 VAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK-LRVNG--QLMRGLTPTM 182
              G+  +   +PI  ++ R+Q    +G T  +K   DC+K  LR  G   L RGL+ + 
Sbjct: 187 ATAGWATATATNPIWMVKTRVQLDK-AGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASY 245

Query: 183 LRESHGCGVYFLTYEALIGHQVKSGIQR------------KDIPAWKLCLFGAASGTLLW 230
           L    G  + +L YE L     K  I++              I  W     GA     + 
Sbjct: 246 LGSVEGI-LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMA 304

Query: 231 TMV-YPLDVIKSVMQTDNLKTPK-NGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++V YP +V+++ ++   L+  K     ++   R II  +G++ ++ G  P ++R
Sbjct: 305 SIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMR 359

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 73/179 (40%), Gaps = 23/179 (12%)

Query: 43  PFDTTKVRLQ-----TSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGV 97
           P    K R+Q      + T  N+   +K +++NEG  G Y+G     +G    + LQ+ +
Sbjct: 199 PIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGI-LQWLL 257

Query: 98  NEAMKRF--------FHTFDEAASQHLSLLQYYICGVAGG-----FTNSFLASPIEHIRI 144
            E +K          F   DE+       ++ + C  +GG     F  S +  P E +R 
Sbjct: 258 YEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQW-CQRSGGAGLAKFMASIVTYPHEVVRT 316

Query: 145 RLQTQTGSGATAEFKGPIDCIK---KLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALI 200
           RL+         ++ G +   +   K      +  GLTP ++R      + F T+E +I
Sbjct: 317 RLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVI 375

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 32/190 (16%)

Query: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKV--------- 63
           D ES H    V  ++ AG A GI   ++G P    K RLQ   + +NA+K+         
Sbjct: 115 DQES-HKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQ---SYSNAIKIGEQTHYTGV 170

Query: 64  ---IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFF---HTFDEAASQHLS 117
              +K +   EG  G ++G    ++  GA  S+Q  +    K F       ++  S HL+
Sbjct: 171 WNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLT 230

Query: 118 LLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC-IKKLRVNG--QL 174
                  GVA       + +P + I  R+  Q G      +KGPIDC +K +++ G   L
Sbjct: 231 ASTISGLGVA------VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITAL 280

Query: 175 MRGLTPTMLR 184
            +G    + R
Sbjct: 281 YKGFEAQVFR 290

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 15/189 (7%)

Query: 109 DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE--FKGPIDCIK 166
            ++A+Q +S    +  G         + +PIE ++IR+Q Q    A  +  +  P   + 
Sbjct: 9   QKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMG 68

Query: 167 KLRVNGQ---LMRGLTPTMLRESHGCGVYFLTYE---ALIGHQVKSGIQRKDIPAWKLCL 220
            +  N     L +GL    + +    G     YE   A++        +   + +  + +
Sbjct: 69  VVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINV 128

Query: 221 F-GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVG-----RTIIARQGVSGLF 274
           F GAASG +   M  PL ++K+ +Q+ +    K G      G     +TI   +GV GLF
Sbjct: 129 FAGAASGIIGAVMGSPLFLVKTRLQSYS-NAIKIGEQTHYTGVWNGLKTIYMTEGVKGLF 187

Query: 275 KGFAPTMLR 283
           +G    +LR
Sbjct: 188 RGIDAAILR 196

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 121/293 (41%), Gaps = 47/293 (16%)

Query: 17  PHDNTRV--IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEG-- 72
           PH + +   +  LL   + GI ++ V  P DT   RL ++ T   + + +  +I  +   
Sbjct: 2   PHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFS 61

Query: 73  -PMGFYKGTLTPLVGVGACVSL-----QFG----VNEAM-----KRFFHTFDEAASQHLS 117
            P+G    TL P +G  A   +     ++G     NE +     K F + F E   + + 
Sbjct: 62  EPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMR 121

Query: 118 LLQYYICGVAGGFTN--SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG--Q 173
                    AG        +  P++ ++I+ QT   S     FKG    IK LR  G   
Sbjct: 122 ------SAAAGSLIGIGEIVLLPLDVLKIKRQTNPES-----FKGR-GFIKILRDEGLFN 169

Query: 174 LMRGLTPTMLRESHGCGVYF----LTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLL 229
           L RG   T  R + G    F       E ++G  +K   Q      +   + GA S  ++
Sbjct: 170 LYRGWGWTAARNAPGSFALFGGNAFAKEYILG--LKDYSQATWSQNFISSIVGACSSLIV 227

Query: 230 WTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
                PLDVIK+ +Q  N   P++G   L + +  +  +GV+  FKG  P +L
Sbjct: 228 SA---PLDVIKTRIQNRNFDNPESG---LRIVKNTLKNEGVTAFFKGLTPKLL 274

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           ++ ++   G  + ++V  P D  K R+Q    +   + ++++K+ +KNEG   F+KG   
Sbjct: 212 QNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTP 271

Query: 83  PLVGVGACVSLQFGVNEAM 101
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>Scas_717.20
          Length = 356

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 108/301 (35%), Gaps = 56/301 (18%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV--------KVIKDLIKNEGPMGFYK 78
           L  G +G  A+ L+  P D  K+  QTS               +  K +  N+G  GF++
Sbjct: 37  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQ 95

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASP 138
           G    L+ +    +++F   E ++       E  S    L+     G   G  + F   P
Sbjct: 96  GHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRLMS----GSLAGLCSVFTTYP 151

Query: 139 IEHIRIRLQTQTG-----------------SGATAEFKGPIDCIKKLRVNGQLMRGLTPT 181
           ++ IR+RL   T                  +  T E KG I        N    RG TPT
Sbjct: 152 LDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCN--FYRGYTPT 209

Query: 182 MLRESHGCGVYFLTYEAL---IGHQVKSGI-----------------QRKDIPAWKLCLF 221
           +L      GV F  ++ L   + H + +                   QR  +  W   L 
Sbjct: 210 VLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELLS 269

Query: 222 GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNN----ILTVGRTIIARQGVSGLFKGF 277
           G  +G    T  YP ++I+  +Q   L   +  ++    I  + + I   +G  G F G 
Sbjct: 270 GGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGL 329

Query: 278 A 278
           +
Sbjct: 330 S 330

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 9/90 (10%)

Query: 22  RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV---------KVIKDLIKNEG 72
           R   +LL+G   G+A      PF+  + RLQ S  S + +         ++ K + K  G
Sbjct: 262 RTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERG 321

Query: 73  PMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
             GF+ G     + V   V+  F V E MK
Sbjct: 322 WRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 220 LFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNIL---TVGRTIIARQGVSGLFKG 276
           L G  SG+   T++ PLD IK + QT N    K   +++      + I    G+ G F+G
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQG 96

Query: 277 FAPTMLR 283
            + T++R
Sbjct: 97  HSVTLMR 103

>Kwal_55.21338
          Length = 323

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 98/241 (40%), Gaps = 15/241 (6%)

Query: 43  PFDTTKVRLQTSETSTNAVKV---IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNE 99
           P      +LQT +     + +   IKD+ + +G MGF+ G  + L G      + +   E
Sbjct: 42  PLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYE 101

Query: 100 AMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFK 159
           A  R         +Q L+  +  + G   G  N+  A+P+     R+  Q     T    
Sbjct: 102 ASSRC--VLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGT--LS 157

Query: 160 GPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLC 219
              D +K   ++G L +GL P ++   +   + +  YE L    + S   R   P+W   
Sbjct: 158 TIFDIVKDEGISG-LFKGLNPALILVINPI-IQYTVYEQLKNWILSSRQTRTLSPSWAFI 215

Query: 220 LFGAASGTLLWT-MVYPLDVIKSVMQ---TDNLKTPKNGNNILTVGRTIIARQGVSGLFK 275
           L   A G L  T   YP   +K+ M         T     ++L++   II + G+ GL++
Sbjct: 216 L--GAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYR 273

Query: 276 G 276
           G
Sbjct: 274 G 274

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 12/151 (7%)

Query: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNGQL--MRGLTPTMLRESHGCGV 191
           L  P+  +  +LQTQ   G         D IK + R +G +    GL   +   +    V
Sbjct: 39  LTYPLIVVTTKLQTQDAKGEKLSLA---DTIKDIYRKDGAMGFFAGLESALFGTTLSNFV 95

Query: 192 YFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTP 251
           Y+  YEA     V      + +   +  L G+ +G+L  T   PL V  + M        
Sbjct: 96  YYYCYEA-SSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQ----- 149

Query: 252 KNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           K+    L+    I+  +G+SGLFKG  P ++
Sbjct: 150 KSDRGTLSTIFDIVKDEGISGLFKGLNPALI 180

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 50/123 (40%), Gaps = 3/123 (2%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPL 84
           + +L G+  G        P      R+   ++    +  I D++K+EG  G +KG L P 
Sbjct: 120 ESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTIFDIVKDEGISGLFKG-LNPA 178

Query: 85  VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRI 144
           + +     +Q+ V E +K +        ++ LS    +I G  G    +    P   ++ 
Sbjct: 179 LILVINPIIQYTVYEQLKNWI--LSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKA 236

Query: 145 RLQ 147
           R+ 
Sbjct: 237 RMH 239

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 113/277 (40%), Gaps = 28/277 (10%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVG 86
           L+AG+  G+       P DT K++LQ +  + NA  V+ +++K EG  GF+KG +   + 
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKREGIRGFWKGNVPGSIM 77

Query: 87  VGACVSLQFGVNEAMKRFFH-TFDEAASQHLSLLQYYIC--GVAGGFTNSFLASPIEHIR 143
                  QFG    +  F     D   S  L     Y C  G   G T+S  + P + +R
Sbjct: 78  YIIYGGAQFGSYTYIGSFLRGGLDLNISPQL-----YSCLVGSLAGMTSSLASYPFDVLR 132

Query: 144 IRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEAL-IGH 202
            R    +  G   + +  I  I           G   +M+       + F  YE++ I  
Sbjct: 133 TRFAANS-QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFT 191

Query: 203 QVKSGIQRKDIPAWKLC-LFGAASGTLLWTMVYPLDVIKSVMQTDN-------------- 247
           + +S +  +  P   L  L G  SG       +PLD ++  +Q  N              
Sbjct: 192 EERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKD 251

Query: 248 -LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
             K+ KN    L VG +++ ++G   L++G   ++++
Sbjct: 252 IYKSYKN-RRFLGVGISMVQQEGPLSLYRGVTMSLIK 287

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 83/194 (42%), Gaps = 23/194 (11%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLI---KNEGPMGFYKGTLTPL 84
           L G+  G+   L   PFD  + R   + +    +K+  +++    +EG MGF+ G  + +
Sbjct: 112 LVGSLAGMTSSLASYPFDVLRTRF-AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSM 170

Query: 85  VGVGACVSLQFGVNEAMKRFFHTFDEAASQH--LSLLQYYICGVAGGFTNSFLASPIEHI 142
           + +G   ++ FGV E++K F     + + +    +LL   + G   GFT+     P++ +
Sbjct: 171 INIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLN-ELAGPISGFTSKLATFPLDTV 229

Query: 143 RIRLQTQTGSGAT---AEFKGPI-DCIKKLRVNG------------QLMRGLTPTMLRES 186
           R R+Q +          EF   I    K  R  G             L RG+T ++++  
Sbjct: 230 RRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSV 289

Query: 187 HGCGVYFLTYEALI 200
               +   +YE  +
Sbjct: 290 PSTAISLWSYELFM 303

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 52.8 bits (125), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 97/258 (37%), Gaps = 21/258 (8%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLV 85
            LL+G A G +  LV  P DT K RLQ                +N G  G Y+G  + +V
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAK----------GGFFRNGGYRGVYRGLGSAVV 57

Query: 86  GVGACVSLQFGVNEAMK---RFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHI 142
                 SL F   +  K   R F      +S    ++ +      G      +  P E +
Sbjct: 58  ASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVRVPAEVV 117

Query: 143 RIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGH 202
           + R QT     +    +  +       V   L RG + T++RE     + F  YE +   
Sbjct: 118 KQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYM--K 175

Query: 203 QVKSGIQRKD-IPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVG 261
           +V + +   D +  WK  + G+ +G +      PLD +K+ +       P     + T+ 
Sbjct: 176 KVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIP-----LGTLV 230

Query: 262 RTIIARQGVSGLFKGFAP 279
            TI   +G    F G  P
Sbjct: 231 STIYKEEGFKVFFSGVGP 248

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 102/266 (38%), Gaps = 21/266 (7%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYK 78
           D+   I  L++G A G +  L   P DT K RLQ                 N G  G Y+
Sbjct: 2   DSQMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAK----------GGFFANGGYKGVYR 51

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFF-----HTFDEAASQHLSLLQYYICGVAGGFTNS 133
           G  + +V      SL F   ++MK +          +   Q    L + +    G  +  
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISAC 111

Query: 134 FLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYF 193
            +  P E I+ R QT   + +    +  +       +   L RG + T++RE     + F
Sbjct: 112 MVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQF 171

Query: 194 LTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKN 253
             YE +     +   + +  P W+  + G  +G +      PLDV+K+ +   +      
Sbjct: 172 PLYEYMKKRWAEVQGKERAAP-WQGSVCGCIAGGIAAAATTPLDVLKTRIMLHH-----K 225

Query: 254 GNNILTVGRTIIARQGVSGLFKGFAP 279
             + L + +T++  +GV   F G  P
Sbjct: 226 SVSALHLAKTMLQEEGVKVFFSGVGP 251

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%)

Query: 43  PFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
           P D  K R+     S +A+ + K +++ EG   F+ G     + + A  ++  GV E + 
Sbjct: 212 PLDVLKTRIMLHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

Query: 103 RFF 105
             F
Sbjct: 272 SLF 274

>Scas_721.27
          Length = 374

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 79/320 (24%), Positives = 129/320 (40%), Gaps = 66/320 (20%)

Query: 18  HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT------------SETSTNAVKVIK 65
           H N +     +AG  GG+A  +V  PFD  K RLQ+            + T+ +  K+  
Sbjct: 47  HPNVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIAN 106

Query: 66  DLI-----------------KNEGPMGFYKGTLTPLVGVGACVSLQF----GVNEAMKRF 104
            L+                 K EG    +KG    LVGV    S+ F       E   + 
Sbjct: 107 SLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKA 166

Query: 105 FHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC 164
           F+   E    HL      +     G+  S   +PI  I+ R+Q    +G T ++K   DC
Sbjct: 167 FNNGQETPLIHL------MSAATAGWATSTATNPIWMIKTRVQLDK-AGTTRKYKNSWDC 219

Query: 165 IKK-LRVNG--QLMRGLTPTMLRESHGCGVYFLTYEAL-----------IGHQVKSGIQR 210
           +K  L+  G   L RGL+ + L    G  + +L YE +            GH+ +    R
Sbjct: 220 LKTVLKSEGIYGLYRGLSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSR 278

Query: 211 KD-IPAWKLCLFGAASGT---LLWTMVYPLDVIKSV---MQTDNLKTPKNGNNILTVGRT 263
            + I  W  C    ++G    +   + YP +V+++    M  +N K    G  ++   R 
Sbjct: 279 TEKIKEW--CQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTG--LVQSFRV 334

Query: 264 IIARQGVSGLFKGFAPTMLR 283
           II  +G++ ++ G  P ++R
Sbjct: 335 IIKEEGLASMYSGLTPHLMR 354

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 118/284 (41%), Gaps = 31/284 (10%)

Query: 19  DNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYK 78
           +  R    L+ G +GG+   ++ QPFD  K RLQ  +TST    + K L   E P   ++
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTST----LWKTLKSIETPSQLWR 58

Query: 79  GTLTPLV--GVGACVSLQF--GVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNS- 133
           G L   +   VG+ + L     + +A+ +  +T     S +L  L  Y    +G  T + 
Sbjct: 59  GALPSCIRTSVGSAMYLTMLNSIRQAISKGKNT-GSTGSSYLPQLNMYENMFSGAVTRAL 117

Query: 134 --FLASPIEHIRIRLQTQTGSGATAEFK-GPIDCIKKLRVNGQLMRGLTPTMLRESHGCG 190
              +  PI  I++R ++      +  +    I   + LR      RG   T LR++   G
Sbjct: 118 TGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLR---GFFRGFGATALRDAPYAG 174

Query: 191 VYFLTYE---ALIGHQVKSGIQRKD----IPAWKLCLFGAAS----GTLLWTMVYPLDVI 239
           +Y L Y+    L+   + S + + +       +   L   +S      +  ++  P D +
Sbjct: 175 LYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTV 234

Query: 240 KSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           K+ MQ +    P   ++  +    I  ++ V  LF G +  + R
Sbjct: 235 KTRMQLE----PAKFHSFTSTFWHIATKESVRNLFAGISLRLTR 274

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 84/205 (40%), Gaps = 19/205 (9%)

Query: 2   TEEFPTPQLIDDLESPHD--NTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN 59
           T EF   +LID    P D    + IK  ++G A       +  PFD  K R+Q + T  +
Sbjct: 93  TYEFSKSKLID----PQDMHTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLN-TRES 147

Query: 60  AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLL 119
              V K++   EG   FY    T LV      +  F + E+  +F +  +E      +  
Sbjct: 148 VWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFMNPSNE-----YNPF 202

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE-------FKGPIDCIKKLRVNG 172
            + I G   G T + + +P++ I+  LQ +     + E       F+     I K+    
Sbjct: 203 IHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWK 262

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYE 197
             +RGL P ++       + + +YE
Sbjct: 263 GFLRGLKPRVIANMPATAISWTSYE 287

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 93/265 (35%), Gaps = 18/265 (6%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIK---NEGPMGFYKGTLT 82
            LLAG   GI +  V  P D  K R+Q+S +      +IK + K    EG +  +KG  +
Sbjct: 19  QLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQS 78

Query: 83  PLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHI 142
            ++G G   ++ F   E  K      D         ++  I G+A       L +P + I
Sbjct: 79  VILGAGPAHAVYFATYEFSKS--KLIDPQDMHTHQPIKTAISGMAATTVADALMNPFDVI 136

Query: 143 RIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGH 202
           + R+Q  T        K     I               T++         F  YE+    
Sbjct: 137 KQRMQLNTRESVWHVTKN----IYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKF 192

Query: 203 QVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKN-----GNNI 257
              S      I     C+ G  SG     +  PLD IK+V+Q    +T  N      N  
Sbjct: 193 MNPSNEYNPFI----HCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTF 248

Query: 258 LTVGRTIIARQGVSGLFKGFAPTML 282
                 I    G  G  +G  P ++
Sbjct: 249 QRAASAIYKIHGWKGFLRGLKPRVI 273

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 119/275 (43%), Gaps = 34/275 (12%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNE---GPMGFYKGTLTP 83
           ++   + GI ++ V  P DT   RL ++ T     + + D++  E    P G    TL P
Sbjct: 13  VVGSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREHASKPFGQRLFTLFP 72

Query: 84  LVGVGACVSL-----QFG----VNEAMKRFFHT-FDEAASQHL-SLLQYYICGVAGGFTN 132
            +G  A   +     ++G     NE + + F   FD A  +     L+    G   G   
Sbjct: 73  GLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALRSATAGSLIGIGE 132

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQ-LMRGLTPTMLRESHGCGV 191
             L  P++ ++I+ QT   S     F+G    ++ LR  G  L RG   T  R + G   
Sbjct: 133 IVLL-PLDVLKIKRQTNPES-----FRGR-GFLRILRDEGMGLYRGWGWTAARNAPGSFA 185

Query: 192 YF----LTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDN 247
            F       E ++G  +K   Q      +   +FGA++  ++     PLDVIK+ +Q+ N
Sbjct: 186 LFGGNAFAKEYILG--LKDYSQATWGQNFVSSIFGASASLIVSA---PLDVIKTRIQSRN 240

Query: 248 LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
            ++ ++G    T+ +  +  +G +  FKG  P +L
Sbjct: 241 FESAESG---FTIVKNTLKNEGATAFFKGLTPKLL 272

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           ++ ++   G  A ++V  P D  K R+Q+   E++ +   ++K+ +KNEG   F+KG   
Sbjct: 210 QNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTP 269

Query: 83  PLVGVGACVSLQFGVNEAM 101
            L+  G  +   F + + +
Sbjct: 270 KLLTTGPKLVFSFAIAQTL 288

>Kwal_26.7967
          Length = 297

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 118/280 (42%), Gaps = 33/280 (11%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSETSTNAVKVIKDLIKNEGPMGFYKG 79
           +   LAG+  G  +  +  PF+  K RLQ    +S  S N + +I    K +G    Y G
Sbjct: 10  LHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVG 69

Query: 80  TLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA-SP 138
               +VG  A   ++F   +A+K       +  +  LS  +  + G+  G   S +A +P
Sbjct: 70  CPAFIVGNTAKAGVRFLGFDAIKNILR---DPTTGELSGPRGIVAGLGAGLLESVVAVTP 126

Query: 139 IEHIRIRLQTQTGSGATAEF----KGPIDCIKKLRVN---GQLMRGLTPTMLRESHGCGV 191
            E I+  L     S A+ ++    +G +     L  +     L RG+ P  +R++    V
Sbjct: 127 FEAIKTALIDDKQS-ASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAV 185

Query: 192 YFLTYEALIGHQVKSGIQ-----RKDIPAWKLCLF--GAASGTLLWTMVYPLDVIKSVMQ 244
               Y     +++K+ IQ      KD P      F  GA SG +      P+D +K+ MQ
Sbjct: 186 RLGCY-----NKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQ 240

Query: 245 T-DNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           + D+ K     N   TV R     +G+   +KG  P + R
Sbjct: 241 SLDSSKYSSTINCFATVFR----EEGLKTFWKGATPRLGR 276

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 116/293 (39%), Gaps = 68/293 (23%)

Query: 43  PFDTTKVRLQT----------SETSTNAVK-----------VIKDLIKNEGPMGFYKGTL 81
           PFD  K RLQ+          +   TN V            +I+++   EG    +KG  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 82  TPLVGVGACVSLQF---GV-NEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLAS 137
             LVGV    S+ F   GV  +   R  +   EA   H      ++ G   G+  S   +
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIH------FLAGATAGWATSTATN 182

Query: 138 PIEHIRIRLQ-TQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRESHGCGVYF 193
           PI  ++ RLQ  +   G +  +K   DC+K +  N  ++   +GL+ + L       + +
Sbjct: 183 PIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESI-LQW 241

Query: 194 LTYEALIGHQVKSGIQRKDIPAW---------------KLCLFGAASGT---LLWTMVYP 235
           + YE     Q+K  I+++ I  +               + C    ++G        + YP
Sbjct: 242 VLYE-----QMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYP 296

Query: 236 LDVIKSVMQTDNLKTPKNGNNILTVG-----RTIIARQGVSGLFKGFAPTMLR 283
            +V+++ ++    + PK    +   G       II  +G + ++ G  P ++R
Sbjct: 297 HEVVRTRLR----QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMR 345

>Scas_721.129
          Length = 323

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 31/188 (16%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKV----------- 63
           E  H   +V  ++ AG + GI   ++G P    K R+Q   + ++A+K+           
Sbjct: 119 EESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQ---SYSDAIKIGEQTHYRNVWN 175

Query: 64  -IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD---EAASQHLSLL 119
            +  + + EG  G ++G    ++  GA  S+Q  +    K F    D   +    HL+  
Sbjct: 176 GLSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTAS 235

Query: 120 QYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC-IKKLRVNG--QLMR 176
                GVA       + +P + I  R+  Q G+     +KGP+DC +K +R  G   L +
Sbjct: 236 TISGLGVA------VVMNPWDVILTRIYNQKGN----LYKGPVDCFVKTVRTEGISALYK 285

Query: 177 GLTPTMLR 184
           G    +LR
Sbjct: 286 GFQAQILR 293

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 119/276 (43%), Gaps = 33/276 (11%)

Query: 32  AGGIAQ---VLVGQPFDTTKVRLQ-TSETSTNAVKVIKD-------LIKNEGPMGFYKGT 80
           AGG+A    V    P +  K+R+Q   E +    KV ++       + +NEG  G  KG 
Sbjct: 27  AGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKGL 86

Query: 81  LTPLV---GV-GACVSLQFGVNEAMKRFFHTFDEAAS-QHLSLLQYYICGVAGGFTNSFL 135
           +   +   G+ G+ +     +  A+   F+  +E+   Q +S+      G + G   + +
Sbjct: 87  VAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSI--NVAAGASSGIIGAVI 144

Query: 136 ASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGC 189
            SP+  ++ R+Q+ + +   G    ++   + +  + R  G   L RG+   +LR   G 
Sbjct: 145 GSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGS 204

Query: 190 GVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVM--QTDN 247
            V    Y       +K+ +  KD P   L      SG  +  ++ P DVI + +  Q  N
Sbjct: 205 SVQLPIYNTAKNFLLKNDLM-KDGPGLHLTA-STISGLGVAVVMNPWDVILTRIYNQKGN 262

Query: 248 LKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           L        + TV RT    +G+S L+KGF   +LR
Sbjct: 263 LYKGPVDCFVKTV-RT----EGISALYKGFQAQILR 293

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 81/192 (42%), Gaps = 21/192 (10%)

Query: 109 DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE--FKGPIDCIK 166
           ++ A+Q +S    +I G           +PIE ++IR+Q Q    A  +  ++ PI  + 
Sbjct: 12  EKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMG 71

Query: 167 KLRVNG---QLMRGLTPTMLRESHGCGVYFLTYEALIG--------HQVKSGIQRKDIPA 215
            +  N     L +GL    + +    G     YE +          ++    IQ+  I  
Sbjct: 72  VIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINV 131

Query: 216 WKLCLFGAASGTLLWTMVYPLDVIKSVMQ--TDNLKTPKNGN--NILTVGRTIIARQGVS 271
                 GA+SG +   +  PL ++K+ MQ  +D +K  +  +  N+     TI   +G  
Sbjct: 132 AA----GASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFK 187

Query: 272 GLFKGFAPTMLR 283
           GLF+G    +LR
Sbjct: 188 GLFRGIDAAILR 199

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 110/274 (40%), Gaps = 21/274 (7%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSET----------STNAVKVIKDLIKNEGPMG 75
           D L G            P +  K+ +Q  +            T  V+  K    +EG   
Sbjct: 13  DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVAS 72

Query: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFL 135
           F++G    ++      +L F   + +K  F    E              G+AGG +  F+
Sbjct: 73  FWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGLAGGLSLLFV 132

Query: 136 ASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKK-LRVNG--QLMRGLTPTMLRESHGC 189
            S +++ R RL   + S   G   +F G +D  KK L  +G   L RG  P+++      
Sbjct: 133 YS-LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYR 191

Query: 190 GVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLK 249
           G+YF  Y++L    +   ++   + ++   L G A  T   T  YPLD ++  M   + +
Sbjct: 192 GLYFGLYDSLKPLLLTGSLENSFLASF---LLGWAVTTGASTASYPLDTVRRRMMMTSGQ 248

Query: 250 TPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
             K  +      R I+A +G+  LFKG    +LR
Sbjct: 249 AVKY-DGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 59/134 (44%), Gaps = 9/134 (6%)

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQ 120
           V V K  + ++G  G Y+G L  +VG+     L FG+ +++K    T     S   S L 
Sbjct: 161 VDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLT----GSLENSFLA 216

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---GQLMRG 177
            ++ G A     S  + P++ +R R+     SG   ++ G  D  +K+        L +G
Sbjct: 217 SFLLGWAVTTGASTASYPLDTVRRRMMMT--SGQAVKYDGAFDAFRKIVAAEGIKSLFKG 274

Query: 178 LTPTMLRESHGCGV 191
               +LR   G GV
Sbjct: 275 CGANILRGVAGAGV 288

>Kwal_23.4354
          Length = 343

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 90/209 (43%), Gaps = 45/209 (21%)

Query: 116 LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQ---------TGSGAT--AEFKG---- 160
           + L +  +  V G    S + +P++ +RIRLQ Q         T +G T  A  KG    
Sbjct: 9   IGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQ 68

Query: 161 -----PIDC----------------IKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEAL 199
                 + C                I K+     L RGL+ T+L  +    VYF+ YE+L
Sbjct: 69  DICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESL 128

Query: 200 IGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG----- 254
              + KS +Q K  P     + GA +  L  T V PL++ ++ +Q+    +PK+      
Sbjct: 129 ---RDKSRLQDK-YPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMI 184

Query: 255 NNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            +++   R  I++ G   LF+G   T+ R
Sbjct: 185 KDLIKESRYEISKVGYKALFRGLEITLWR 213

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 8/92 (8%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--------ETSTNAVKVIKDLIKNEGPMG 75
           +   + G+ GG    ++  PFD  K R+Q +        + S N  K +  + K+EG   
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAA 311

Query: 76  FYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT 107
            Y G +  ++ +    ++     E  KR F T
Sbjct: 312 LYTGLVPRVIKIAPSCAIMISTYEVCKRLFST 343

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 79/212 (37%), Gaps = 31/212 (14%)

Query: 15  ESPHDNTRV------IKDLLAGTAGGIAQVLVGQPFDTTKVRLQT----SETSTNAVKVI 64
           ES  D +R+      +  L+ G    +       P +  + RLQ+    S  ST A+ +I
Sbjct: 126 ESLRDKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAM-MI 184

Query: 65  KDLIKNE-------GPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAA----- 112
           KDLIK         G    ++G    L       S+ +G  E  K       E +     
Sbjct: 185 KDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSS 244

Query: 113 -SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN 171
            S     +  ++ G  GG   + L  P +  + R+Q  T   +T E K   +  K L   
Sbjct: 245 NSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQI-TYLNSTLEKKPSKNMFKYLNQM 303

Query: 172 ------GQLMRGLTPTMLRESHGCGVYFLTYE 197
                   L  GL P +++ +  C +   TYE
Sbjct: 304 RKSEGLAALYTGLVPRVIKIAPSCAIMISTYE 335

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 118/279 (42%), Gaps = 42/279 (15%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNE---GPMGFYKGTLTP 83
           +L   + GI ++ V  P DT   RL ++ T   +   +  +I  E    P+     TL P
Sbjct: 13  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVFTLFP 72

Query: 84  LVGVGACVSL-----QFG----VNEAMKRFF-----HTFDEAASQHL-SLLQYYICGVAG 128
            +G  A   +     ++G     NE + R F     +TF E   + L S     + G+  
Sbjct: 73  GLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGSMIGIG- 131

Query: 129 GFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG-QLMRGLTPTMLRESH 187
                 +  P++ ++I+ QT   +     FKG    +K L+  G  L RG   T  R + 
Sbjct: 132 ----EIVLLPLDVLKIKRQTNPEA-----FKGR-GFVKILKDEGLGLYRGWGWTAARNAP 181

Query: 188 GCGVYF----LTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVM 243
           G    F       E ++G  +K   Q      +   + GA++  ++     PLDVIK+ +
Sbjct: 182 GSFALFGGNAFAKEYILG--LKDYSQATWSQNFVSSIVGASASLIISA---PLDVIKTRI 236

Query: 244 QTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           Q  N + P++G    T+ +  +  +G S  FKG  P +L
Sbjct: 237 QNKNFENPESG---FTIVKNTLKNEGFSAFFKGLTPKLL 272

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           ++ ++   G  A +++  P D  K R+Q    E   +   ++K+ +KNEG   F+KG   
Sbjct: 210 QNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFSAFFKGLTP 269

Query: 83  PLVGVGACVSLQFGVNEAM 101
            L+  G  +   F + + +
Sbjct: 270 KLLTTGPKLVFSFALAQTL 288

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 80/205 (39%), Gaps = 44/205 (21%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKV-----------RLQTSETSTNA--------------- 60
           L+AGT  GI + L   PF+  K            +L+ ++   NA               
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 61  -----VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQH 115
                +  +K + +  GP  F +GT   +    A  S+QF    A KR     ++ AS  
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASS- 197

Query: 116 LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN---G 172
                  I G+A  FT   +  PI+ ++ R+ +Q    A  E+K  ++C+ ++ V     
Sbjct: 198 ------VITGLATSFTLVAMTQPIDVVKTRMMSQ---NAKTEYKNTLNCMYRIFVQEGMA 248

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYE 197
              +G     ++     G+ F  YE
Sbjct: 249 TFWKGSIFRFMKVGISGGLTFTVYE 273

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 73/191 (38%), Gaps = 36/191 (18%)

Query: 114 QHLSLLQYYICGVAGGFTNSFLASPIEHIRIRL------------QTQTGSGATAEF--- 158
           Q L+     I G   G   S    P E+I+  L            + Q    A A F   
Sbjct: 71  QRLTGYNLLIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKV 130

Query: 159 ---KGPIDCIKKL----------RVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVK 205
                P+  I+KL          R     ++G T T+ R+     + F  Y A      K
Sbjct: 131 ATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAF-----K 185

Query: 206 SGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTII 265
             +Q ++  A  + + G A+   L  M  P+DV+K+ M + N KT     N L     I 
Sbjct: 186 RLLQARNDKASSV-ITGLATSFTLVAMTQPIDVVKTRMMSQNAKT--EYKNTLNCMYRIF 242

Query: 266 ARQGVSGLFKG 276
            ++G++  +KG
Sbjct: 243 VQEGMATFWKG 253

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 102/246 (41%), Gaps = 20/246 (8%)

Query: 43  PFDTTKVRLQTS-ETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGV---GACVSLQFGVN 98
           P D  K RLQ + +   + +   K ++++EG    + G     +G    GAC   ++G  
Sbjct: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGAC---KYGGY 91

Query: 99  EAMKRFFHTFDEAASQHLSLLQYYICGVAGG-FTNSFLASPIEHIRIRLQTQTGSGATAE 157
           E  K+ +       + H      Y+C  A   F    L  P E I+++ QT         
Sbjct: 92  EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNF 151

Query: 158 FKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKD---IP 214
            +G         ++G L +G+TP   R+       F ++E ++   + + + R      P
Sbjct: 152 LEGWSKITAAEGLSG-LYKGITPLWCRQIPYTMCKFTSFERIV-EMIYAKLPRSKQEMSP 209

Query: 215 AWKLCLF---GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVS 271
           + ++ +    G  +G L   + +P DV+ S +  D     K G +++   + I +R G  
Sbjct: 210 SQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKRIYSRIGFG 265

Query: 272 GLFKGF 277
           GL+ G 
Sbjct: 266 GLWNGL 271

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 64/172 (37%), Gaps = 26/172 (15%)

Query: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIK-KLRVNGQLMRGL---TPTMLRESHGCG 190
           L SP  +    L      G T     P+D +K +L+VN QL R       T++R      
Sbjct: 9   LFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSK 68

Query: 191 VYFLTYEALIGHQVKSGIQRKDIPAWK------------------LCLFGAASGTLLW-T 231
           V+       IG+ ++   +      +K                  + L  +AS   L   
Sbjct: 69  VFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADI 128

Query: 232 MVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++ P + IK   QT     P    N L     I A +G+SGL+KG  P   R
Sbjct: 129 LLCPWEAIKVKQQTT---IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCR 177

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 101/258 (39%), Gaps = 35/258 (13%)

Query: 9   QLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---ETSTNAVKVIK 65
            L DD E    ++ +    LAG  GGI         DT K R Q +       + ++  +
Sbjct: 43  NLFDDYE----HSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYR 98

Query: 66  DLIKNEG-PMGFYKGTLTPLVGVGACVSLQFGVNEAMKRF----FHTFDEAASQHLSLLQ 120
            +   EG   G Y G    ++G     ++ F   E  KR     +H  D  +  HL+   
Sbjct: 99  TMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFS--HLT--- 153

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQ-------TGSGATAE-FKGPIDCIKKLRVNG 172
               G  G F +SF+  P E ++ RLQ Q         SG   +  +  I  I +     
Sbjct: 154 ---AGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVA 210

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLF-----GAASGT 227
            L  G   T+ R+     + F  YE     Q    ++ KDI    L +      GA +G 
Sbjct: 211 ALFFGYKATLARDLPFSALQFAFYEKF--RQWAFLLEGKDIYKHDLSISNEIVTGACAGG 268

Query: 228 LLWTMVYPLDVIKSVMQT 245
           L   +  PLDV+K+ +QT
Sbjct: 269 LAGILTTPLDVVKTRVQT 286

>Scas_562.12
          Length = 300

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 113/280 (40%), Gaps = 37/280 (13%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEG---PMGFYKGT 80
           +  LL   + GI ++ V  P DT   RL ++ T       +  +I  E    P+G    T
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFT 70

Query: 81  LTPLVGVGACVSL-----QFG----VNEAM-KRFFHTFDEAASQHL-SLLQYYICGVAGG 129
           L P +G  A   +     ++G     NE + K +   FD A  +     ++    G   G
Sbjct: 71  LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIG 130

Query: 130 FTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG--QLMRGLTPTMLRESH 187
                L  P++ ++I+ QT   +     FKG    +K L+  G   L RG   T  R + 
Sbjct: 131 IGEIVLL-PLDVLKIKRQTNPEA-----FKGR-GFVKILKDEGIFNLYRGWGWTAARNAP 183

Query: 188 GCGVYF----LTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVY-PLDVIKSV 242
           G    F       E ++G      ++     +W      +  G     +V  PLDVIK+ 
Sbjct: 184 GSFALFGGNAFAKEYILG------LEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTR 237

Query: 243 MQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           +Q  +   P+ G   LT+ +     +G++  FKG  P +L
Sbjct: 238 IQNRSFDNPETG---LTIVKNTFKNEGITAFFKGLTPKLL 274

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           ++ ++   G    ++V  P D  K R+Q    +     + ++K+  KNEG   F+KG   
Sbjct: 212 QNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVKNTFKNEGITAFFKGLTP 271

Query: 83  PLVGVGACVSLQFGVNEAM 101
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 117/282 (41%), Gaps = 41/282 (14%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS-TNAVKVIKDLIKNEGPMGFYKG--T 80
           +  LL   + GI ++ V  P DT   RL ++ T  T+  ++   + ++     F K   T
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFT 70

Query: 81  LTPLVGVGACVSL-----QFG----VNEAM-KRFFHTFDEA-ASQHLSLLQYYICGVAGG 129
           L P +G  A   +     ++G     NE + K F   FD A   +    L+    G   G
Sbjct: 71  LFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIG 130

Query: 130 FTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG--QLMRGLTPTMLRESH 187
                L  P++ ++I+ QT   +     FKG    +K L+  G   L RG   T  R + 
Sbjct: 131 IGEIVLL-PLDVLKIKRQTNPEA-----FKGR-GFLKILKDEGIFNLYRGWGWTAARNAP 183

Query: 188 GCGVYF----LTYEALIGHQVKSGIQRKDIPAWKLCLFGA---ASGTLLWTMVYPLDVIK 240
           G    F       E ++G      +Q      W      +   AS +L+ +   PLDVIK
Sbjct: 184 GSFALFGGNAFAKEYILG------LQDYSQATWSQNFISSIVGASASLIVSA--PLDVIK 235

Query: 241 SVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           + +Q  N   P++G  I+   +  +  +G +  FKG  P +L
Sbjct: 236 TRIQNRNFDNPESGFKIV---KNTLKNEGFTAFFKGLTPKLL 274

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           ++ ++   G  A ++V  P D  K R+Q    +   +  K++K+ +KNEG   F+KG   
Sbjct: 212 QNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTP 271

Query: 83  PLVGVGACVSLQFGVNEAM 101
            L+  G  +   F + +++
Sbjct: 272 KLLTTGPKLVFSFALAQSL 290

>Scas_669.6
          Length = 373

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 109/278 (39%), Gaps = 54/278 (19%)

Query: 45  DTTKVRLQTSETS---TNAVKVIKDLIKNEG-PMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           DT K R Q +  +    N     + +   EG   G Y G    ++G     ++ FG  E 
Sbjct: 73  DTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEW 132

Query: 101 MKRFF---HTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE 157
            KR       F++  S HLS       G+ G F +SF+  P E ++ RLQ Q G      
Sbjct: 133 CKRKMIGDLGFNDTVS-HLS------AGLLGDFVSSFVYVPSEVLKTRLQLQ-GRVNNPF 184

Query: 158 FKGPIDCIKKLR------VNGQ----LMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSG 207
           F+   +  + LR      VN +    L  G   T+ R+     + F  YE     Q    
Sbjct: 185 FQSGYN-YRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKF--RQTAFK 241

Query: 208 IQRKDIPAWKLCL-----FGAASGTLLWTMVYPLDVIKSVMQTD---------------N 247
           +++KDI    L +      GA +G L   +  P+DVIK+ +QT                +
Sbjct: 242 LEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAIS 301

Query: 248 LKTPKN------GNNILTVGRTIIARQGVSGLFKGFAP 279
            KT K        N+I    + +   +GV G F G  P
Sbjct: 302 AKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGP 339

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 115/280 (41%), Gaps = 35/280 (12%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSETSTNAVKVIKDLIKNEGPMGFYKGT 80
           K  +AG   G  +  +  PF+  K RLQ    +S+ S N + +I +  K +G    Y G 
Sbjct: 12  KSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVGAIYVGC 71

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA-SPI 139
              +VG  A  + +F   + ++       +  +  LS  +  + G+  G   S +A +P 
Sbjct: 72  PAFIVGNTAKAATRFLGYDTIRNLLK---DKKTGELSGPRGVLAGLGAGLLESVVAVTPF 128

Query: 140 EHIR---------IRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCG 190
           E I+         +R + Q    + A  +  I  +K     G L  G+ P  +R++    
Sbjct: 129 EAIKTVLIDDKQSVRPKYQNNGRSMA--RNYISLVKDEGFRG-LYGGVLPVSMRQAANQA 185

Query: 191 VYFLTYEALIGHQVKSGIQR-----KDIPAWKLCLF--GAASGTLLWTMVYPLDVIKSVM 243
           V    Y     +++K  +Q      KD P      F  GA SG +      P+D +K+ M
Sbjct: 186 VRLGCY-----NKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRM 240

Query: 244 QTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           Q+    T    ++ L    TI   +G+   +KG  P + R
Sbjct: 241 QS---LTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGR 277

>Kwal_27.11419
          Length = 298

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 121 YYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTP 180
           ++I G  GG T++ +  P + ++ RLQ    S         +D ++ +   GQL +G  P
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNL-------LDVVRSIETPGQLWKGTLP 62

Query: 181 TMLRESHGCGVYFLTY----EALIGHQVKSGIQRKD--------IPAWKLCLFGAASGTL 228
           + LR S G  ++  T      A+   +VK GI  K+        +  ++  + GA +   
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVK-GIAGKNGSSSFLPQLSMYENLISGAITRAA 121

Query: 229 LWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           +     P+ V+K   ++    T  N  ++      I   +G+ GLF G   T++R
Sbjct: 122 VGVATMPITVLKVRFES----TMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMR 172

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 118/290 (40%), Gaps = 55/290 (18%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPL-- 84
            + G  GG+   ++ QPFD  K RLQ ++ S+N + V++ +   E P   +KGTL     
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNK-SSNLLDVVRSI---ETPGQLWKGTLPSALR 66

Query: 85  --VGVGACVSLQFGVNEAM--KRFFHTF-DEAASQHLSLLQYYICGVAGGFTNSFLA--- 136
             VG    +S    V  A+  KR         +S  L  L  Y   ++G  T + +    
Sbjct: 67  TSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVAT 126

Query: 137 SPIEHIRIRLQT------QTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCG 190
            PI  +++R ++        G  AT  ++   + I+       L  G   T++R++   G
Sbjct: 127 MPITVLKVRFESTMYNYKSLGEAATHIYRS--EGIRG------LFSGCGATVMRDAPYAG 178

Query: 191 VYFLTYEALIGHQVKSGIQRKDIPAWKL-----------------CLFGAASGTLLWTMV 233
           +Y L YE     Q K  + R  +P W +                  +   +S +L  T+ 
Sbjct: 179 LYVLFYE-----QSKLQLPR-ILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTIT 232

Query: 234 YPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            P D IK+ MQ +    P      +   ++II  +    LF G +  + R
Sbjct: 233 SPFDTIKTRMQLN----PSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSR 278

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 38/84 (45%), Gaps = 2/84 (2%)

Query: 23  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-VKVIKDLIKNEGPMGFYKGTL 81
           +I  + A ++  +A  +   PFDT K R+Q + +     ++  K +I+ E P   + G  
Sbjct: 215 IINSIAAFSSASLATTIT-SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLS 273

Query: 82  TPLVGVGACVSLQFGVNEAMKRFF 105
             L        + +G+ E + + F
Sbjct: 274 LRLSRKALSAGIAWGIYEELVKKF 297

>Kwal_27.11626
          Length = 299

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 116/277 (41%), Gaps = 32/277 (11%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGP---MGFYKGT 80
           I  +L   + GI ++ V  P DT   RL ++ T  ++   +  +I  E     +G    T
Sbjct: 10  IARVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLFT 69

Query: 81  LTPLVGVGACVSL-----QFG----VNEAM-KRFFHTFDEAASQHL-SLLQYYICGVAGG 129
           L P +G  A   +     ++G     NE + K F   FD A  +     L+    G   G
Sbjct: 70  LFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSLIG 129

Query: 130 FTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG-QLMRGLTPTMLRESHG 188
                L  P++ ++I+ QT   S     FKG    IK L+  G  L RG   T  R + G
Sbjct: 130 IGEIVLL-PLDVLKIKRQTNPES-----FKGR-GFIKILKDEGFGLYRGWGWTAARNAPG 182

Query: 189 CGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGA---ASGTLLWTMVYPLDVIKSVMQT 245
              + L        +   G++      W      +   AS +L+ +   PLDVIK+ +Q 
Sbjct: 183 S--FALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSA--PLDVIKTRIQN 238

Query: 246 DNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
            +   P++G  I+   +  +  +G++  FKG  P +L
Sbjct: 239 RHFDNPESGFRIV---QNTLKNEGITAFFKGLTPKLL 272

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           ++ ++   G  A ++V  P D  K R+Q    +   +  +++++ +KNEG   F+KG   
Sbjct: 210 QNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKNEGITAFFKGLTP 269

Query: 83  PLVGVGACVSLQFGVNEAM 101
            L+  G  +   F + +++
Sbjct: 270 KLLTTGPKLVFSFALAQSL 288

>Scas_489.4
          Length = 297

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 114/279 (40%), Gaps = 31/279 (11%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSETSTNAVKVIKDLIKNEGPMGFYKG 79
           +   +AG   G  +  +  PF+  K RLQ    TS  S N + +I +  K +G    Y G
Sbjct: 11  LHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVG 70

Query: 80  TLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA-SP 138
               +VG  A   ++F   + +K       +  +  LS  +  + G+  G   S +A +P
Sbjct: 71  CPAFIVGNTAKAGIRFLGFDTIKNMLR---DPVTGELSGPRGVVAGLGAGLLESVVAVTP 127

Query: 139 IEHIRI-------RLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGV 191
            E I+         L+ +  +      +     ++   + G L RG+ P  +R++    V
Sbjct: 128 FEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMG-LYRGVLPVSMRQAANQAV 186

Query: 192 YFLTYEALIGHQVKSGIQR-----KDIPAWKLCLF--GAASGTLLWTMVYPLDVIKSVMQ 244
               Y     +++K+ +Q      KD P      F  GA SG +      P+D +K+ MQ
Sbjct: 187 RLGCY-----NKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQ 241

Query: 245 TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           +  L   K  + +    + I   +G+   +KG  P + R
Sbjct: 242 S--LDATKYTSTVNCFAK-IFKEEGLKTFWKGATPRLGR 277

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 64/146 (43%), Gaps = 8/146 (5%)

Query: 13  DLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-----VKVIKDL 67
           DL+        I  +  G AG +++ +V  PF+  K+ LQ  ++ST+A     +  +  +
Sbjct: 2   DLKQLAKQESSIAFIAGGVAGAVSRTVV-SPFERVKILLQV-QSSTSAYNHGIINAVGQV 59

Query: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR-FFHTFDEAASQHLSLLQYYICGV 126
            K EG  G ++G     V +    ++QF V E  K+  FH       + L   Q    G 
Sbjct: 60  YKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGA 119

Query: 127 AGGFTNSFLASPIEHIRIRLQTQTGS 152
             G  +     P++ +R RL  QT +
Sbjct: 120 LCGGMSVLATYPLDLVRTRLSIQTAN 145

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 77/176 (43%), Gaps = 20/176 (11%)

Query: 122 YICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCI----KKLRVNGQLMRG 177
           +I G   G  +  + SP E ++I LQ Q  S  +A   G I+ +    K+  V G L RG
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAG-LFRG 71

Query: 178 LTPTMLRESHGCGVYFLTYEALIGH--QVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYP 235
                +R      V F+ YE    H   V   + ++ +  W+    GA  G +     YP
Sbjct: 72  NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYP 131

Query: 236 LDVIKSVM--QTDNL-KTPKNGNNILT--------VGRTIIARQGVSGLFKGFAPT 280
           LD++++ +  QT NL K  K+    +         + +T     G+ GL++G  PT
Sbjct: 132 LDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPT 187

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 77/215 (35%), Gaps = 58/215 (26%)

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQT-----GSGATAEFKGPID-------------- 163
           +   AG F  SF  +P++ +RIRLQ Q        GA +E KG +               
Sbjct: 16  LSACAGSFLTSFFLTPMDVVRIRLQQQVMLPDCSCGAASELKGSVGTEVIYDHVVANKNS 75

Query: 164 --------CIKK-------LRVN---------------GQLMRGLTPTMLRESHGCGVYF 193
                   C +        LR N                 L RGL+ T+L       VYF
Sbjct: 76  PKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYF 135

Query: 194 LTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQT-----DNL 248
             YE    H       R   P+      GA +  +  T V PL++IK+ +Q+      + 
Sbjct: 136 SGYEMFRDHSP----MRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDT 191

Query: 249 KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            T     ++L   R  I   G   LFKG   T+ R
Sbjct: 192 TTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWR 226

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 76/188 (40%), Gaps = 27/188 (14%)

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQT----QTGSGATAEFKGPI-DCIKKLRVNGQ--LM 175
            CG       +   +P+E I+ RLQ+    +  +     FK  + +   ++R  G   L 
Sbjct: 158 FCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLF 217

Query: 176 RGLTPTMLRESHGCGVYFLTYEALIGH---QVKSGIQRKDI-PAWKLCLF----GAASGT 227
           +GL  T+ R+     +Y+ +YE    +          R ++ P W   +     G+ SG+
Sbjct: 218 KGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGS 277

Query: 228 LLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIAR------------QGVSGLFK 275
               + +P DV K+ MQ       K  N +++  + + AR            +G   L+ 
Sbjct: 278 SAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYT 337

Query: 276 GFAPTMLR 283
           G  P +++
Sbjct: 338 GLIPRVMK 345

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 82/225 (36%), Gaps = 33/225 (14%)

Query: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT---SETSTNAV 61
           F   ++  D     D+   +  L  G    +       P +  K RLQ+   S   T   
Sbjct: 135 FSGYEMFRDHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQ 194

Query: 62  KVIKDLIK---NE----GPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR-FFHTFDEAA- 112
            + KDL+K   NE    G    +KG    L       ++ +G  E  K+ F+  F E   
Sbjct: 195 MMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCL 254

Query: 113 SQHLS-----LLQYYICGVAGGFTNSFLASPIEHIRIRLQT---------------QTGS 152
             +LS      +  +I G   G + + L  P +  + R+Q                +   
Sbjct: 255 RWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRV 314

Query: 153 GATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
            A   FK   + IK+    G L  GL P +++ +  C +   TYE
Sbjct: 315 SARGMFKFLYN-IKQTEGYGALYTGLIPRVMKIAPSCAIMISTYE 358

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 36/99 (36%), Gaps = 17/99 (17%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-----------------VKVIKD 66
           I   + G+  G +  L+  PFD  K R+Q +    N                   K + +
Sbjct: 266 INSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

Query: 67  LIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFF 105
           + + EG    Y G +  ++ +    ++     E  KR F
Sbjct: 326 IKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLF 364

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 75/161 (46%), Gaps = 16/161 (9%)

Query: 136 ASPIEHIRIRLQTQT-----GSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRESH 187
           A+PIE +++ +Q Q      GS  T  +KG +DC K+   +  ++   RG T  +LR   
Sbjct: 31  AAPIERVKLLMQNQEEMLKQGSLDT-RYKGILDCFKRTATHEGIVSFWRGNTANVLRYFP 89

Query: 188 GCGVYFLTYEALIGHQVKSGIQRKDIPAWKL-CLF-GAASGTLLWTMVYPLDVIKSVMQT 245
              + F  ++  I   +    +R     W    LF G A+G L    VY LD  ++ +  
Sbjct: 90  TQALNF-AFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAA 148

Query: 246 D----NLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           D       + +  N +L V +  +   G+ GL++GF P++L
Sbjct: 149 DARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVL 189

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 16/148 (10%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRL--------QTSETSTNAV-KVIKDLIKNEGPMGFYKGT 80
           G AGG++ + V    D  + RL         TS+   N +  V K  +K +G +G Y+G 
Sbjct: 126 GAAGGLSLLFV-YSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGF 184

Query: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
           +  ++G+     L FG+ ++ K    T     S   S L  ++    G  T S+   P++
Sbjct: 185 VPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVI-TMGASTASY---PLD 240

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKL 168
            +R R+     SG T ++ G +DC++K+
Sbjct: 241 TVRRRMMMT--SGQTIKYDGALDCLRKI 266

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 70/265 (26%), Positives = 112/265 (42%), Gaps = 34/265 (12%)

Query: 45  DTTKVRLQTSETST---NAVKVIKDLIKNEG-PMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           DT K R Q + ++    N +   + +I  EG   G Y G    ++G     ++ F   E 
Sbjct: 77  DTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYEY 136

Query: 101 MKRFF---HTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSG---- 153
            KR        +E  S HL+       G  G F +SF+  P E ++ RLQ Q        
Sbjct: 137 TKRKMIGEWGINETFS-HLT------AGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFF 189

Query: 154 -ATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCGVYFLTYEAL--IGHQVKSG 207
            +   +K   D +  + R  G   L  G   T+ R+    G+ F  YE    +   V++ 
Sbjct: 190 RSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENK 249

Query: 208 IQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGN---------NIL 258
              +D+      + GAA+G L   +  PLDV+K+ +QT     P+N +         N +
Sbjct: 250 TFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSI 309

Query: 259 TVG-RTIIARQGVSGLFKGFAPTML 282
           T G  T+   +G++GLF G  P  +
Sbjct: 310 TKGMMTVYKTEGLAGLFSGVGPRFI 334

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 63/151 (41%), Gaps = 25/151 (16%)

Query: 149 QTGSGATAEFKGPIDCIKKLRVNGQLMRGL----TPTMLRESHGCGVYFLTYEALIGHQV 204
           Q G+ +T ++K  I   + + +   L +GL    +  ML       ++F TYE       
Sbjct: 83  QQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYEY------ 136

Query: 205 KSGIQRKDIPAWKLC-----LFGAASGTLLWTMVY-PLDVIKSVMQTDN------LKTPK 252
               +RK I  W +      L     G  + + VY P +V+K+ +Q          ++  
Sbjct: 137 ---TKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGY 193

Query: 253 NGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           N  N+     TI+ R+G   LF G+  T+ R
Sbjct: 194 NYKNLTDAVTTIVRREGWPTLFFGYKATLSR 224

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 115/274 (41%), Gaps = 32/274 (11%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNE---GPMGFYKGTLTP 83
           +L   + GI ++ V  P DT   RL ++ T   +   +  +I  +    P+G    +L P
Sbjct: 14  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIFRDFASEPLGRRLLSLFP 73

Query: 84  LVGVGACVSL-----QFG----VNEAM-KRFFHTFDEAASQHL-SLLQYYICGVAGGFTN 132
            +G  A   +     ++G     NE + K F   FD+A  +     L+    G   G   
Sbjct: 74  GLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGIGE 133

Query: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG-QLMRGLTPTMLRESHGCGV 191
             L  P++ ++I+ QT   S     FKG    +K ++  G  L RG   T  R + G   
Sbjct: 134 IVLL-PLDVLKIKRQTNPES-----FKGR-GFLKIIKDEGFGLYRGWGWTAARNAPGS-- 184

Query: 192 YFLTYEALIGHQVKSGIQRKDIPAWKLCLFGA---ASGTLLWTMVYPLDVIKSVMQTDNL 248
           + L        +   G++      W      +   AS +L+ +   PLDVIK+ +Q  N 
Sbjct: 185 FALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSA--PLDVIKTRIQNRNF 242

Query: 249 KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
             P++G  I+   +  +  +G +  FKG  P +L
Sbjct: 243 DNPESGFKII---KNTLKNEGFTAFFKGLTPKLL 273

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           ++ ++   G  A ++V  P D  K R+Q    +   +  K+IK+ +KNEG   F+KG   
Sbjct: 211 QNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFTAFFKGLTP 270

Query: 83  PLVGVGACVSLQFGVNEAM 101
            L+  G  +   F + + +
Sbjct: 271 KLLTTGPKLVFSFALAQTL 289

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 111/265 (41%), Gaps = 42/265 (15%)

Query: 43  PFDTTKVRLQTSE----TSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVN 98
           PF+  K RLQ ++     S N + ++    + +G    Y G    +VG      ++F   
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGF 89

Query: 99  EAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLA-SPIEHIRIRL----------Q 147
           +A++R     DE  +  LS  +  + G+  G   S LA +P E ++  L           
Sbjct: 90  DALRRALQ--DERGA--LSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAARPRY 145

Query: 148 TQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSG 207
              G GA   +   +  +    + G L+    P  LR++    V F  Y      Q+K  
Sbjct: 146 QHNGRGAARNYALLLRELGLRGLYGGLV----PVALRQASNQAVRFGCYT-----QLKQA 196

Query: 208 IQR-----KDIP--AWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTV 260
           +QR      D P  + +  L GA SG +      P+D +K+ MQ   L   + G+   TV
Sbjct: 197 VQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA--LDAARYGS---TV 251

Query: 261 G--RTIIARQGVSGLFKGFAPTMLR 283
           G  R ++  +GV  L++G  P + R
Sbjct: 252 GCFRAVVREEGVRALWRGATPRLGR 276

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 14/116 (12%)

Query: 92  SLQFG----VNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQ 147
           +++FG    + +A++R+  T    A Q L   Q ++ G   G    +   P++ ++ R+Q
Sbjct: 184 AVRFGCYTQLKQAVQRYAGT---PADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ 240

Query: 148 TQTGSGATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCGVYFLTYEALI 200
                   A +   + C + + R  G   L RG TP + R     G+ F  YE L+
Sbjct: 241 ALD----AARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLL 292

>Kwal_47.19228
          Length = 281

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 6/110 (5%)

Query: 174 LMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMV 233
            ++G  PT++R++    V F TY +L   Q+ S    K +  +     G  S   +  + 
Sbjct: 147 FLQGTMPTIIRQTSNSAVRFTTYTSL--KQMISP--NKPLNEYYAFALGFISSCAVVAVT 202

Query: 234 YPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
            P+DVIK+ MQ+    T  N  N L     I   +G +  +KG+AP +++
Sbjct: 203 QPIDVIKTRMQSK--YTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMK 250

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 40/99 (40%), Gaps = 3/99 (3%)

Query: 4   EFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST---NA 60
            F T   +  + SP+           G     A V V QP D  K R+Q+  T +   N+
Sbjct: 165 RFTTYTSLKQMISPNKPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNS 224

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNE 99
           +     +   EG   F+KG    L+ VG    + FGV +
Sbjct: 225 LNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQ 263

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 67/141 (47%), Gaps = 19/141 (13%)

Query: 64  IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYI 123
           ++++ ++ G  GF +GT+  ++   +  +++F    ++K+         S +  L +YY 
Sbjct: 135 VQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-------SPNKPLNEYY- 186

Query: 124 CGVAGGFTNS----FLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG---QLMR 176
              A GF +S     +  PI+ I+ R+Q++      + +K  ++C  ++ V     +  +
Sbjct: 187 -AFALGFISSCAVVAVTQPIDVIKTRMQSKY---TWSNYKNSLNCAYRIFVEEGFTKFWK 242

Query: 177 GLTPTMLRESHGCGVYFLTYE 197
           G  P +++     GV F  Y+
Sbjct: 243 GWAPRLMKVGLSGGVSFGVYQ 263

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 102/247 (41%), Gaps = 23/247 (9%)

Query: 43  PFDTTKVRLQTSET-------STNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQF 95
           P  T   R+Q SE        S + ++ ++++ + EG +GFY G  + + G+ A     +
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYY 95

Query: 96  GVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGAT 155
              E   R   T     S+ L+  +  +     G   +  ++PI  +  R+       +T
Sbjct: 96  YFYELAAR--ATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQST 153

Query: 156 AEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPA 215
                 +D ++K  V   L  GL P ++  S+   + +  +E L    +K       +P+
Sbjct: 154 --LAVLLDIVRKDGVTA-LFNGLRPALMLVSNPI-IQYTVFEQLKNVVLKWSGSDVLLPS 209

Query: 216 WKLCLFG----AASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG-NNILTVGRTIIARQGV 270
           W   L      AA+G+      YP   +K+ M     K   +   ++ ++   I+ ++G+
Sbjct: 210 WAFLLGAVGKLAATGS-----TYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGI 264

Query: 271 SGLFKGF 277
            GL+ G 
Sbjct: 265 QGLYHGI 271

>Scas_715.45
          Length = 305

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 101/250 (40%), Gaps = 16/250 (6%)

Query: 43  PFDTTKVRLQTSET--STNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           P D  K RLQ   T   +N   +I+ ++K EG    + G     +G     + ++G  E 
Sbjct: 36  PLDLIKCRLQVDPTLYRSNTSGIIQ-ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYEL 94

Query: 101 MKRFFHTF---DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE 157
            KR + T    DEA +       Y +      F    +  P E I+++ QT         
Sbjct: 95  FKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNV 154

Query: 158 FKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALI-GHQVKSGIQRKDIPAW 216
            +G      K  +NG   +G+TP   R+       F ++E ++     +   ++ ++ A 
Sbjct: 155 IEGWKKMYAKEGLNG-FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSAL 213

Query: 217 KLC----LFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSG 272
           +      + G  +G L   + +P DV+  V + +N +      N+    + I +R G  G
Sbjct: 214 QQISVSFVGGYMAGILCAIVSHPADVM--VSKINNERKVNESMNVAL--KRIYSRIGFVG 269

Query: 273 LFKGFAPTML 282
           L+ G    +L
Sbjct: 270 LWNGLPVRIL 279

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 57/139 (41%), Gaps = 11/139 (7%)

Query: 9   QLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKD 66
            L+ D  + +     I  L + TA   A +++  PF+  KV+ QT+      N ++  K 
Sbjct: 102 HLVKDEATAYKYRTSIYLLSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIEGWKK 160

Query: 67  LIKNEGPMGFYKGTLTPL----VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYY 122
           +   EG  GFYKG +TPL    +    C   +F   E +    +         +S LQ  
Sbjct: 161 MYAKEGLNGFYKG-ITPLWCRQIPYTMC---KFTSFERIVEAIYARLPTKKSEMSALQQI 216

Query: 123 ICGVAGGFTNSFLASPIEH 141
                GG+    L + + H
Sbjct: 217 SVSFVGGYMAGILCAIVSH 235

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 14/164 (8%)

Query: 126 VAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRE 185
           VA G T+S + +P++ I+ RLQ    +   +   G I  +KK  + G+L  G+  T +  
Sbjct: 25  VACGPTHSSV-TPLDLIKCRLQVDP-TLYRSNTSGIIQILKKEGL-GKLFTGVGATCIGY 81

Query: 186 S-HGCGVYFLTYEALIGHQVKSGIQRKDIPAWK----LCLFGAASGTLLW-TMVYPLDVI 239
           S  G G Y   YE L      + + + +  A+K    + L  +A+       M+ P + I
Sbjct: 82  SLQGAGKYG-GYE-LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAI 139

Query: 240 KSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           K   QT     P   NN++   + + A++G++G +KG  P   R
Sbjct: 140 KVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180

>Scas_645.9
          Length = 391

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 45/119 (37%), Gaps = 16/119 (13%)

Query: 4   EFPTPQLIDDLESPHDN-TRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-------- 54
           EF    L  D    H N T  I   + G+  G    LV  PFD  K R Q S        
Sbjct: 272 EFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKS 331

Query: 55  -------ETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFH 106
                  E + N  K ++++ K EG    Y G +  +V +    ++     E  KR F+
Sbjct: 332 VVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFN 390

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 78/181 (43%), Gaps = 20/181 (11%)

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQT-QTGSGATAEFKGPIDCIKK----LRVNGQ---L 174
           +CG       +   +P+E ++ +LQ+    S +T  +    + +K+    +R++G    L
Sbjct: 190 MCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNAL 249

Query: 175 MRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLF--GAASGTLLWTM 232
            +GL  T+ R+     +Y+ +YE    H      +      + +  F  G+ SGT+   +
Sbjct: 250 FKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALV 309

Query: 233 VYPLDVIKSVMQTDNL--------KTP--KNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
            +P DV K+  Q   +        K+P  +   N+    R I   +G   L+ G  P M+
Sbjct: 310 THPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRMV 369

Query: 283 R 283
           +
Sbjct: 370 K 370

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 77/195 (39%), Gaps = 33/195 (16%)

Query: 33  GGIAQVLVGQ---PFDTTKVRLQT---SETSTNAVKVIKDLIKNE--------GPMGFYK 78
           G IA++L      P +  K +LQ+      ST +  ++K+L+K               +K
Sbjct: 192 GAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALFK 251

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASP 138
           G    L       ++ +G  E  K   H + + +  H S L ++I    GG  +  +A+ 
Sbjct: 252 GLEITLWRDVPFSAIYWGSYEFCKT--HLWMDTSKSH-SNLTFFINSFIGGSISGTIAAL 308

Query: 139 IEHI----RIRLQTQ-TGSGATAEFKGP-----------IDCIKKLRVNGQLMRGLTPTM 182
           + H     + R Q    G+   +  K P           +  I KL   G L  GL P M
Sbjct: 309 VTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRM 368

Query: 183 LRESHGCGVYFLTYE 197
           ++ +  C +   +YE
Sbjct: 369 VKIAPSCAIMISSYE 383

>Scas_328.1
          Length = 227

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 89/203 (43%), Gaps = 20/203 (9%)

Query: 92  SLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRL-QTQT 150
           +L F   + +K  F    +   + L  + Y  CG+      SF   PI  + +RL + + 
Sbjct: 10  ALNFAFKDKIKAMFGF--QQGKRRLYQMVYGECGIRWMCRCSF---PIVCLFLRLCKNEI 64

Query: 151 GS-------GATAEFKGPIDCIKK-LRVNGQL--MRGLTPTMLRESHGCGVYFLTYEALI 200
           GS       GA  +F G +D  KK L  +G L   RG  P+++      G+YF  Y++L 
Sbjct: 65  GSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLK 124

Query: 201 GHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTV 260
              +    +   +P++   L G A      T  YPLD ++  M   + +  K    I   
Sbjct: 125 PVLLTGSFENAFLPSF---LLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAI-DC 180

Query: 261 GRTIIARQGVSGLFKGFAPTMLR 283
            + I++++GV  LFKG    + R
Sbjct: 181 FQQIVSQEGVYSLFKGCGANIFR 203

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 45  DTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRF 104
           D   ++          + V K  +  +G +G Y+G L  +VG+     L FG+ +++K  
Sbjct: 67  DAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPV 126

Query: 105 FHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC 164
             T     S   + L  ++ G A   + S  + P++ +R R+     SG   ++KG IDC
Sbjct: 127 LLT----GSFENAFLPSFLLGWAVTISASTTSYPLDTVRRRMMMT--SGQAVKYKGAIDC 180

Query: 165 IKKL 168
            +++
Sbjct: 181 FQQI 184

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDT--TKVRLQTSETSTNAVKVIKDLIKNEG 72
           E     +  + +LL+G   G+A  +V QP DT  +KV         + V ++  L K  G
Sbjct: 206 EKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLG 265

Query: 73  PMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
             G + G  T LV VG   SLQFG+  ++K
Sbjct: 266 FFGSFAGLPTRLVMVGTLTSLQFGIYGSLK 295

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 60/162 (37%), Gaps = 13/162 (8%)

Query: 43  PFDTTKVRLQTSETSTNA--VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           P D  K R+Q   T  N   V   K +I  EG      G    L+G     + +FG  E 
Sbjct: 37  PIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEV 96

Query: 101 MKRFFHT---FDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRL--QTQTGSGAT 155
            K+FF     +D A+    S+  Y        F       P+E  RIRL  Q Q  +G  
Sbjct: 97  FKKFFIDNLGYDTASRYKNSV--YMGSAAMAEFLADIALCPLEATRIRLVSQPQFANGLV 154

Query: 156 AEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
             F      I K    G    G TP + ++       FL +E
Sbjct: 155 GGF----SRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFE 192

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 217 KLCLFGA-ASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFK 275
           K  L GA   G+   +MV P+DV+K+ +Q   L+       ++   + IIA +G   L  
Sbjct: 19  KFALAGAIGCGSTHSSMV-PIDVVKTRIQ---LEPTVYNKGMVGSFKQIIAGEGAGALLT 74

Query: 276 GFAPTML 282
           GF PT+L
Sbjct: 75  GFGPTLL 81

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 6/101 (5%)

Query: 9   QLIDDLESPHDN----TRVIKDLLAGTAGGIAQVLVGQPFDT--TKVRLQTSETSTNAVK 62
           +L   L  P D     +    +LL+G   G+A  +V QP DT  +KV   +     + V 
Sbjct: 192 ELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQSTVG 251

Query: 63  VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR 103
           ++  L K  G +G + G  T LV VG   SLQFG+   +K+
Sbjct: 252 LLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGQLKK 292

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 63/160 (39%), Gaps = 9/160 (5%)

Query: 43  PFDTTKVRLQTSETSTNA--VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           P D  K R+Q   T  N   V   + +I  EG      G    L+G     + +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEV 92

Query: 101 MKRFFHT---FDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE 157
            K+FF     +D AA    S+  Y     A  F       P+E  RIRL +Q  + A   
Sbjct: 93  FKKFFIDTLGYDTAARYKNSV--YIGSAAAAEFLADIALCPLEATRIRLVSQP-TFANGL 149

Query: 158 FKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
             G    +K+  V G    G TP + ++       FL +E
Sbjct: 150 VGGFSRILKEEGV-GSFYSGFTPILFKQIPYNIAKFLVFE 188

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 217 KLCLFGA-ASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFK 275
           K  L GA   G+   +MV P+DV+K+ +Q   L+       ++   R IIA +G   L  
Sbjct: 15  KFALAGAIGCGSTHSSMV-PIDVVKTRIQ---LEPTVYNKGMVGSFRKIIAEEGAGALLT 70

Query: 276 GFAPTML 282
           GF PT+L
Sbjct: 71  GFGPTLL 77

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 26  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTP 83
           +LL+G   G+A  +V QP DT  +KV         + + ++  L K  G +G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTR 272

Query: 84  LVGVGACVSLQFGVNEAMKR 103
           LV VG   SLQFG+  ++K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 63/163 (38%), Gaps = 15/163 (9%)

Query: 43  PFDTTKVRLQTSETSTNA--VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           P D  K R+Q   T  N   +   K +I +EG      G    L+G     S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEV 92

Query: 101 MKRFFHT---FDEAASQHLSLLQYYICGVA-GGFTNSFLASPIEHIRIRLQTQT--GSGA 154
            K+ F     +D+A +   S+   YI   A   F       P+E  RIRL +Q    +G 
Sbjct: 93  FKKLFIDVLGYDQAVNYKNSI---YIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGL 149

Query: 155 TAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
              F      I K    G    G TP + ++       FL +E
Sbjct: 150 VGGF----SRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFE 188

 Score = 31.2 bits (69), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 217 KLCLFGA-ASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFK 275
           K  L GA   GT    MV P+DV+K+ +Q   L+       +++  + II+ +G   L  
Sbjct: 15  KFALAGAIGCGTTHSAMV-PIDVVKTRIQ---LEPTVYNKGMISSFKQIISSEGAGALLT 70

Query: 276 GFAPTML 282
           GF PT+L
Sbjct: 71  GFGPTLL 77

>Kwal_33.15597
          Length = 305

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 26  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTP 83
           +LL+G   G+A  +V QP DT  +KV         + + ++  L K  G +G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTR 272

Query: 84  LVGVGACVSLQFGVNEAMKR 103
           LV VG   SLQFG+  ++K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 47/113 (41%), Gaps = 9/113 (7%)

Query: 43  PFDTTKVRLQTSETSTNA--VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           P D  K R+Q   T  N   +   K +I +EG      G    L+G     S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEV 92

Query: 101 MKRFFHT---FDEAASQHLSLLQYYICGVA-GGFTNSFLASPIEHIRIRLQTQ 149
            K+ F     +D+A +   S+   YI   A   F       P+E  RIRL +Q
Sbjct: 93  FKKLFIDTLGYDQAVNYKNSI---YIGSAAIAEFFADIALCPLEATRIRLVSQ 142

 Score = 31.2 bits (69), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 217 KLCLFGA-ASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFK 275
           K  L GA   GT    MV P+DV+K+ +Q   L+       +++  + II+ +G   L  
Sbjct: 15  KFALAGAIGCGTTHSAMV-PIDVVKTRIQ---LEPTVYNKGMISSFKQIISSEGAGALLT 70

Query: 276 GFAPTML 282
           GF PT+L
Sbjct: 71  GFGPTLL 77

>Scas_613.24
          Length = 177

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 70/170 (41%), Gaps = 25/170 (14%)

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKKLRVNGQLMRGLT 179
           + G  GG +++    P++ ++ R+Q   G+    A  + K PI          Q  RG  
Sbjct: 13  VSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKDPI----------QFWRGTL 62

Query: 180 PTMLRESHGCGVYFLTYEALIGHQVKSGIQRK--------DIPAWKLCLFGAASGTLLWT 231
           P+ LR S G  +Y      +    V                +  ++  L GA +  L+  
Sbjct: 63  PSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGY 122

Query: 232 MVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTM 281
           +  P+ ++K V       + K+ N  +   + I   +G+SG FKGF PT+
Sbjct: 123 ITMPITILK-VRYESTYYSYKSMNEAI---KDIYKMEGISGFFKGFGPTV 168

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 8/57 (14%)

Query: 27 LLAGTAGGIAQVLVGQPFDTTKVRLQTSETST--NAVKVIKDLIKNEGPMGFYKGTL 81
          L++G  GG++  +  QP D  K R+Q  + +T  +A+K IKD      P+ F++GTL
Sbjct: 12 LVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKD------PIQFWRGTL 62

 Score = 36.2 bits (82), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 33  GGIAQVLVG---QPFDTTKVRLQTSETSTNAV-KVIKDLIKNEGPMGFYKGTLTPLVGVG 88
           G +A+ LVG    P    KVR +++  S  ++ + IKD+ K EG  GF+KG   P VG+G
Sbjct: 113 GAMARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKG-FGPTVGIG 171

>Kwal_23.3965
          Length = 307

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 77/173 (44%), Gaps = 14/173 (8%)

Query: 114 QHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNG 172
           Q + + Q  + G   G +   + +P++ ++IRLQ Q  +   A++ G +   K+L R  G
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEG 67

Query: 173 --QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAW-KLCLFGAASGTLL 229
              L +G  P M          F +Y  L        + +  +PA     + GA SGT  
Sbjct: 68  VRALWKGNVPAMAMYILYGSTQFTSYAIL-----NKLLSKSQLPAQIHTGMVGALSGTCS 122

Query: 230 WTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
               YP DV+++    ++    +  + +L+  + I   +G  G FKG + +++
Sbjct: 123 AIASYPCDVLRTRFIANH---SRELSTMLSTAQEIWRHEGFRGFFKGVSSSIV 172

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/279 (20%), Positives = 110/279 (39%), Gaps = 35/279 (12%)

Query: 23  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSETSTNAVKV-IKDLIKNEGPMGFYK 78
           V + L+AG   GI+  +V  P DT K+RLQ    +E     + V  K L++ EG    +K
Sbjct: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73

Query: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASP 138
           G +  +       S QF     + +        A  H  ++     G   G  ++  + P
Sbjct: 74  GNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMV-----GALSGTCSAIASYP 128

Query: 139 IEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEA 198
            + +R R         +       +  +     G   +G++ +++  +        TYE+
Sbjct: 129 CDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRG-FFKGVSSSIVSIAVATSSILATYES 187

Query: 199 LIGHQVKSGI-QRKDIPAWKLCLFGAA----SGTLLWTMVYPLDVIK---SVMQTDNLKT 250
                VK    QR D  +  + L  ++    +G +  T+V+P+D ++    V+    L  
Sbjct: 188 -----VKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGH 242

Query: 251 PKNGN------------NILTVGRTIIARQGVSGLFKGF 277
           P + N            N L +   I+ ++G+  L+ G+
Sbjct: 243 PGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGY 281

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 5/149 (3%)

Query: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRL---QTSETST 58
           + +F +  +++ L S       I   + G   G    +   P D  + R     + E ST
Sbjct: 87  STQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRTRFIANHSRELST 146

Query: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSL 118
             +   +++ ++EG  GF+KG  + +V +    S      E++K F     +  S  + L
Sbjct: 147 -MLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQL 205

Query: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQ 147
           L+     V  G  +  +  PI+ +R R Q
Sbjct: 206 LESS-ASVIAGIVSKTIVFPIDTVRKRYQ 233

>Kwal_23.3529
          Length = 395

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 79/196 (40%), Gaps = 22/196 (11%)

Query: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQ--------- 52
           T E    +LIDD          +  L AG +G +   +V  P +  K RLQ         
Sbjct: 163 TYELTKRKLIDDW----GVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPH 218

Query: 53  --TSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD- 109
             +     N    I  +++ EG    + G    L       + QF   E  +++  T + 
Sbjct: 219 FHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEG 278

Query: 110 EAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLR 169
           +  SQ LSLL   + G A G     + +P++ I+ R+QTQ  S   +      D  + +R
Sbjct: 279 KTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVAS------DSTRLVR 332

Query: 170 VNGQLMRGLTPTMLRE 185
           +   L++GLT     E
Sbjct: 333 IENSLIKGLTAVYRSE 348

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 99/269 (36%), Gaps = 34/269 (12%)

Query: 40  VGQPFDTTKVRLQTSETS---TNAVKVIKDLIKNEG-PMGFYKGTLTPLVGVGACVSLQF 95
           V    DT K R Q +  +    N +   + +   EG   G Y G    ++G     ++ F
Sbjct: 102 VMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFF 161

Query: 96  GVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGAT 155
           G  E  KR     D   ++ LS L     G++G   +S +  P E ++ RLQ Q G    
Sbjct: 162 GTYELTKRKL-IDDWGVNETLSHL---TAGLSGDLVSSVVYVPSEVLKTRLQLQ-GCYNN 216

Query: 156 AEF---------KGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKS 206
             F         +  I  I +L     L  G   T+ R+       F  YE     Q   
Sbjct: 217 PHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKF--RQWAF 274

Query: 207 GIQRKDIPAWKLCLFGAASGTLLWT-----MVYPLDVIKSVMQTDNLKTPKNGN------ 255
            ++ K  P+  L L                +  P+DVIK+ +QT    T  + +      
Sbjct: 275 TLEGK-TPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRI 333

Query: 256 -NILTVGRTIIAR-QGVSGLFKGFAPTML 282
            N L  G T + R +G  G F G  P  +
Sbjct: 334 ENSLIKGLTAVYRSEGTLGFFSGVGPRFI 362

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 106/258 (41%), Gaps = 37/258 (14%)

Query: 43  PFDTTKVRLQTSETSTN-----AVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGV 97
           P  T   +LQT     N      ++ IK++ + +G +GFY G  + + G+     + +  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 98  NEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE 157
            E   R  +       + L+ L+  + G   G   +  ++PI     R+ T T S  TA 
Sbjct: 93  YELTSR--NVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRM-TVTKSEKTA- 148

Query: 158 FKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVY--FLTYEALIGHQVKSGIQRKDIPA 215
               I+ +KK      L  GL P ++   +    Y  F   + L+    K GI     P+
Sbjct: 149 LATIIEIVKKDSAK-TLFNGLKPALVLVMNPIVQYTVFEQLKNLVLAWNKQGILS---PS 204

Query: 216 WKLCLFG----AASGTLLWTMVYPLDVIKSVM-------QTDNLKTPK------NGNNIL 258
           W   L      AA+G+      YP   +K+ M        TD+    K      +  ++L
Sbjct: 205 WAFLLGALGKLAATGS-----TYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSML 259

Query: 259 TVGRTIIARQGVSGLFKG 276
           ++   I+ + GVSGL++G
Sbjct: 260 SLITEIVKKDGVSGLYRG 277

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 61/151 (40%), Gaps = 10/151 (6%)

Query: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNGQL--MRGLTPTMLRESHGCGV 191
           L  P+  I  +LQTQ G+    + K  ++ IK++ R +G L    GL   +   +    V
Sbjct: 30  LTYPLVTITTKLQTQ-GNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFV 88

Query: 192 YFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTP 251
           Y+  YE L    V    + K +   +  L G  +G++      P+ V  + M        
Sbjct: 89  YYYFYE-LTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMT-----VT 142

Query: 252 KNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           K+    L     I+ +     LF G  P ++
Sbjct: 143 KSEKTALATIIEIVKKDSAKTLFNGLKPALV 173

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 105/278 (37%), Gaps = 34/278 (12%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETST-----NAVKVIKDLIKNEGPMGFYKGTL 81
           L+ G  GG+   +V QPFD  K RLQ ++ +T       ++  K L +   P      +L
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIRSPKQLWRGALP-----SSL 65

Query: 82  TPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTN---SFLASP 138
              +G    +S       AM +         S  L  L  Y    +G FT     F+  P
Sbjct: 66  RTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMP 125

Query: 139 IEHIRIRLQ-TQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
           I  I++R + T     +  E    I   + +R       G   T++R++   G+Y L YE
Sbjct: 126 ITIIKVRYESTMYSYKSLGEATRHIYSTEGIR---GFFNGCGATVMRDAPYAGLYVLLYE 182

Query: 198 A---LIGHQVKSGIQRKDIPAWKLCLFGAA---------SGTLLWTMVYPLDVIKSVMQT 245
               L+   + S     D  A     + +          S +L  T+  P D IK+ MQ 
Sbjct: 183 KAKLLVPMMLPSSTISYD-EAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQL 241

Query: 246 DNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           D    P   +        I++++    LF G    + R
Sbjct: 242 D----PTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTR 275

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 73/181 (40%), Gaps = 29/181 (16%)

Query: 113 SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG 172
           S HL      I G  GG T++ +  P + ++ RLQ    +            +K++R   
Sbjct: 8   SSHL------IGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWG-------TLKEIRSPK 54

Query: 173 QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKD-----IPAWKLCLF-----G 222
           QL RG  P+ LR S G  +Y  T         K   Q  +     +P  +L ++     G
Sbjct: 55  QLWRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLP--QLTMYENLASG 112

Query: 223 AASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           A +  ++  +  P+ +IK   ++        G       R I + +G+ G F G   T++
Sbjct: 113 AFTRGVVGFITMPITIIKVRYESTMYSYKSLGE----ATRHIYSTEGIRGFFNGCGATVM 168

Query: 283 R 283
           R
Sbjct: 169 R 169

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 6/141 (4%)

Query: 143 RIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGH 202
           R RL        T+ F   +  I   R     ++G  PT+ R+     V F TY +L   
Sbjct: 255 RERLFLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSL--K 312

Query: 203 QVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGR 262
           Q+ S    K +  +   + G  S   +  +  P+DVIK+ MQ+       N  N L    
Sbjct: 313 QLIS--PNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSK--YAWANYKNSLNCAY 368

Query: 263 TIIARQGVSGLFKGFAPTMLR 283
            I   +G+   +KG+AP +++
Sbjct: 369 RIFVEEGIPKFWKGWAPRLMK 389

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 41/102 (40%), Gaps = 3/102 (2%)

Query: 4   EFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---ETSTNA 60
            F T   +  L SP+         + G     A V V QP D  K R+Q+        N+
Sbjct: 304 RFTTYTSLKQLISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNS 363

Query: 61  VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
           +     +   EG   F+KG    L+ VG    + FGV + ++
Sbjct: 364 LNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVE 405

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 102/285 (35%), Gaps = 39/285 (13%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVG 86
           L+ G  GG+   +  QP D  K R+Q  + +T    + K+L + + P+  ++GTL   + 
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT----LWKNLKEIDSPLQLWRGTLPSALR 69

Query: 87  VGACVSLQFGVNEAMKRFFHTFDEAA-------------SQHLSLLQYYICGVAGGFTN- 132
                +L       M+        A              S  L  L  Y   + G F   
Sbjct: 70  TSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFARG 129

Query: 133 --SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCG 190
              ++  PI  I++R ++   + ++   K  I  I          RG   T LR++   G
Sbjct: 130 LVGYITMPITVIKVRYESTLYNYSS--LKEAITHIYTKEGLFGFFRGFGATCLRDAPYAG 187

Query: 191 VYFLTYEA------------LIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDV 238
           +Y L YE              I +  + G                 S +L  T+  P D 
Sbjct: 188 LYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTT-VNTTSAVLSASLATTVTAPFDT 246

Query: 239 IKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           IK+ MQ +    P    N      +I+  + V  LF G +  + R
Sbjct: 247 IKTRMQLE----PSKFTNSFNTFTSIVKNENVLKLFSGLSMRLAR 287

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 40  VGQPFDTTKVRLQTSETS-TNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVN 98
           V  PFDT K R+Q   +  TN+      ++KNE  +  + G    L        + +G+ 
Sbjct: 240 VTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIY 299

Query: 99  EAM-KRF 104
           E + KRF
Sbjct: 300 EELVKRF 306

>Scas_673.17
          Length = 314

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 2/91 (2%)

Query: 15  ESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDT--TKVRLQTSETSTNAVKVIKDLIKNEG 72
           E+  D T    +LL+G   G A   V QP DT  +KV         + + ++  L K  G
Sbjct: 209 ETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLG 268

Query: 73  PMGFYKGTLTPLVGVGACVSLQFGVNEAMKR 103
            +G + G  T L+ VG   SLQF +  ++K 
Sbjct: 269 VIGSFAGLPTRLIMVGTLTSLQFAIYGSLKN 299

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 58/158 (36%), Gaps = 5/158 (3%)

Query: 43  PFDTTKVRLQTSETSTNA--VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           P D  K R+Q   T  N   V   K +I +EG      G    L+G     + +FG  E 
Sbjct: 40  PVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEV 99

Query: 101 MKRF-FHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFK 159
            K+    T     + H     Y        F       P+E  RIRL +Q  + A     
Sbjct: 100 FKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQP-TFANGLVG 158

Query: 160 GPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
           G    +K+  V G    G TP + ++       FL +E
Sbjct: 159 GFSRILKEEGV-GSFYSGFTPILFKQIPYNIAKFLVFE 195

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 78/182 (42%), Gaps = 20/182 (10%)

Query: 109 DEAASQHLSLLQYYICGVAG-GFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKK 167
           D AAS +    ++ + G  G G T+S L  P++ ++ R+Q +     T   KG +   KK
Sbjct: 14  DYAASDYF---KFALAGAIGCGTTHSSLV-PVDVVKTRIQLE----PTVYNKGMVGSFKK 65

Query: 168 LRVN---GQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLF--- 221
           +  +   G L+ G  PT+L  S      F  YE      + + I  ++   +K  ++   
Sbjct: 66  IIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDT-IGYENAVHYKNSVYMGS 124

Query: 222 GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTM 281
            A +  L    + PL+  +  +    +  P   N ++     I+  +GV   + GF P +
Sbjct: 125 AAVAEFLADIALCPLEATRIRL----VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPIL 180

Query: 282 LR 283
            +
Sbjct: 181 FK 182

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 112/292 (38%), Gaps = 57/292 (19%)

Query: 23  VIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST-----NAVKVIKDLIKNEGPMGFY 77
           V   L++G  GG+A V   QP D  K RLQ ++ S+       V+  ++L +   P    
Sbjct: 8   VPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVRTTRELWRGTLP---- 63

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNS---F 134
              L   +G    +SL      A+ R   +     S  L  LQ Y   + G  + +    
Sbjct: 64  -SALRTSIGSALYLSLLNYSRSALAR--GSEARTRSSLLPRLQSYQNLLTGALSRAAVGL 120

Query: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNGQ--LMRGLTPTMLRESHGCGV 191
           +  PI  I++R ++   +     + G  +  + + R  G     +G   T LR++   G+
Sbjct: 121 VTMPITVIKVRYESTLYA-----YNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGL 175

Query: 192 YFLTYEALIGHQVKSGIQRKDIPAWKLCLFGA--------------------ASGTLLWT 231
           Y L YE     Q K  + R  +PA    L GA                     S +L  T
Sbjct: 176 YVLLYE-----QAKEMLPRA-LPA---TLLGADESGKLTAPASAMVNGVSAFLSASLATT 226

Query: 232 MVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283
           +  P D IK+ MQ  +     +    +   R I+  +    LF G +  + R
Sbjct: 227 LTAPFDTIKTRMQLQS-----HPVGFVQTLRHIVCEERARTLFDGLSLRLCR 273

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 26/64 (40%)

Query: 43  PFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
           PFDT K R+Q        V+ ++ ++  E     + G    L        + +G+ E + 
Sbjct: 230 PFDTIKTRMQLQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELL 289

Query: 103 RFFH 106
           +  H
Sbjct: 290 KLLH 293

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 79/200 (39%), Gaps = 23/200 (11%)

Query: 2   TEEFPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA- 60
           T E+   Q+I++ +  H+       L AG  G +   +V  P +  K RLQ      N  
Sbjct: 131 TYEWVKRQMINEWQI-HET---YSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRH 186

Query: 61  ----------VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRF-FHTFD 109
                        ++ +++ EG    + G    L       +LQF   E  +++ F    
Sbjct: 187 FQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLER 246

Query: 110 EAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQ-TGSGATAEFKGPIDCIKKL 168
           +    HLS     + G + G     + +P++ ++ R+QTQ  GS  T +   P       
Sbjct: 247 KPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPA------ 300

Query: 169 RVNGQLMRGLTPTMLRESHG 188
           R+NG + R L   +  E  G
Sbjct: 301 RLNGSIFRSLLVVLRYEGLG 320

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 28/190 (14%)

Query: 110 EAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLR 169
           E +S H  LL   + G  GG     +   ++ ++ R   Q G+    +++  I   + L 
Sbjct: 45  EPSSAHSPLLHCVLAGGIGGAIGDSVMHSLDTVKTR---QQGAPGEVKYRHMISAYRTLA 101

Query: 170 VNGQLMRGLT----PTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLC-----L 220
           +   + RGL       ML       V+F TYE          ++R+ I  W++      L
Sbjct: 102 LEEGVRRGLYGGYGAAMLGSFPSAAVFFGTYEW---------VKRQMINEWQIHETYSHL 152

Query: 221 FGAASGTLLWTMVY-PLDVIKSVMQ------TDNLKTPKNGNNILTVGRTIIARQGVSGL 273
                G L  ++VY P +V+K+ +Q        + ++  N   +    RTI+  +GVS L
Sbjct: 153 AAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSAL 212

Query: 274 FKGFAPTMLR 283
           F G+  T+ R
Sbjct: 213 FFGYKATLSR 222

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 103/268 (38%), Gaps = 31/268 (11%)

Query: 40  VGQPFDTTKVRLQTSETST---NAVKVIKDLIKNEG-PMGFYKGTLTPLVGVGACVSLQF 95
           V    DT K R Q +       + +   + L   EG   G Y G    ++G     ++ F
Sbjct: 70  VMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFF 129

Query: 96  GVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSG-- 153
           G  E +KR     +E   Q      +   G  G   +S +  P E ++ RLQ Q      
Sbjct: 130 GTYEWVKR--QMINEW--QIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNR 185

Query: 154 ---ATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSG 207
              +   ++G  D ++ + R  G   L  G   T+ R+     + F  YE     +    
Sbjct: 186 HFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERF--RKWAFL 243

Query: 208 IQRKDIPAW----KLCLFGAASGTLLWTMVYPLDVIKSVMQTD--------NLKTPKNGN 255
           ++RK +          + GA++G L   +  PLDV+K+ +QT         +   P   N
Sbjct: 244 LERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLN 303

Query: 256 NILTVGRTIIAR-QGVSGLFKGFAPTML 282
             +     ++ R +G+ G F G  P  +
Sbjct: 304 GSIFRSLLVVLRYEGLGGAFSGVGPRFI 331

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 61/148 (41%), Gaps = 6/148 (4%)

Query: 136 ASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLT 195
           A P++    R         ++ F G +  I + R     ++G  PT+ R+     V F T
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTT 232

Query: 196 YEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGN 255
           Y  +    V+S    K +  ++    GA S   +  +  P+DVIK+ MQ+         +
Sbjct: 233 YAWI----VQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSS 288

Query: 256 NILTVGRTIIARQGVSGLFKGFAPTMLR 283
             L     I   +G   ++KG+ P + +
Sbjct: 289 --LNCAYRIFVEEGFRYMWKGWVPRLFK 314

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 40/101 (39%), Gaps = 3/101 (2%)

Query: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSE---TSTNAV 61
           F T   I    SPH      +   AG     A V + QP D  K R+Q+     T  +++
Sbjct: 230 FTTYAWIVQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSL 289

Query: 62  KVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
                +   EG    +KG +  L  V     + FGV + ++
Sbjct: 290 NCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVE 330

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 68/136 (50%), Gaps = 13/136 (9%)

Query: 157 EFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDI 213
           +F G ++  +K+ +  G   L RG++ T+L       VYF  YE +      +G+     
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGL----Y 164

Query: 214 PAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVG-----RTIIARQ 268
           P     + GA + TL  T V PL++IK+ +Q+    + KNG+ I+        ++ IA +
Sbjct: 165 PTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMR 224

Query: 269 GVS-GLFKGFAPTMLR 283
           GV+  +FKG   T+ R
Sbjct: 225 GVAQTMFKGLEITLWR 240

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 74/181 (40%), Gaps = 25/181 (13%)

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQTGS----GATAEFKGPIDCIKK---LRVNGQLM 175
           ICG       +   +P+E I+ +LQ+   S    G+   ++   + IK    +R   Q M
Sbjct: 171 ICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTM 230

Query: 176 -RGLTPTMLRESHGCGVYFLTYEAL---IGHQVKSGIQRKDIPAW----KLCLFGAASGT 227
            +GL  T+ R+     +Y+ +YE     + +   S    K+   W       L G  SG+
Sbjct: 231 FKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFD-KNSSNWFHFTNSFLGGFISGS 289

Query: 228 LLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRT---------IIARQGVSGLFKGFA 278
           L     +P DV K+  Q   +   K  N+ L  G +         I   +G+  L+ G A
Sbjct: 290 LAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLA 349

Query: 279 P 279
           P
Sbjct: 350 P 350

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 64/157 (40%), Gaps = 16/157 (10%)

Query: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHT-------FDEA 111
           N+   +K +I+NEG  G YKG     +G    + LQ+ + E MKR           +   
Sbjct: 218 NSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFGYQAE 276

Query: 112 ASQHLSLLQYYICGVAGG-----FTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIK 166
            ++  S      C  +G      F  S    P E +R RL+         ++ G +   K
Sbjct: 277 GTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFK 336

Query: 167 K-LRVNG--QLMRGLTPTMLRESHGCGVYFLTYEALI 200
             ++  G   +  GLTP ++R      + F T+E +I
Sbjct: 337 VIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVI 373

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 106/248 (42%), Gaps = 39/248 (15%)

Query: 63  VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQF---GVNEAM-KRFFHTFDEAASQHLSL 118
           +I ++ K EG    +KG    LVGV    S+ F   G  + M  + F+   E    HL  
Sbjct: 122 IIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHL-- 179

Query: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQ-TQTGSGATAEFKGPIDCIKKLRVNG---QL 174
               +     G+  +   +PI  I+ R+Q  + G  +  ++K   DC+K +  N     L
Sbjct: 180 ----MAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGL 235

Query: 175 MRGLTPTMLRESHGCGVYFLTYEAL-----------IGHQVKSGIQRKDIPAWKLCLFGA 223
            +GL+ + L    G  + +L YE +            G+Q + G +       + C    
Sbjct: 236 YKGLSASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFGYQAE-GTKSTSEKVKEWCQRSG 293

Query: 224 ASGTLLWT---MVYPLDVIKSVMQTDNLKTPK-NGNN----ILTVGRTIIARQGVSGLFK 275
           ++G   +      YP +V+++ ++    +TPK NG      ++   + II  +G+  ++ 
Sbjct: 294 SAGLAKFVASIATYPHEVVRTRLR----QTPKENGKRKYTGLVQSFKVIIKEEGLFSMYS 349

Query: 276 GFAPTMLR 283
           G  P ++R
Sbjct: 350 GLTPHLMR 357

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 9/84 (10%)

Query: 28  LAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV----KVIKDLI----KNEGPMGFYKG 79
           +   +GG+AQ LV  PFD  + R Q      N +    K + D +    K EGP G+YKG
Sbjct: 16  MGAISGGVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKG 74

Query: 80  TLTPLVGVGACVSLQFGVNEAMKR 103
               L  V    ++ + V E ++ 
Sbjct: 75  LTANLFKVIPSTAVSWLVYEVIRE 98

 Score = 28.5 bits (62), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 12/75 (16%)

Query: 216 WKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG-------NNILTVGRTIIARQ 268
           +KL + GA SG +  T+VYP D+++   Q   +   + G       + ++T+G+T    +
Sbjct: 12  YKLAM-GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKT----E 66

Query: 269 GVSGLFKGFAPTMLR 283
           G  G +KG    + +
Sbjct: 67  GPKGYYKGLTANLFK 81

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/295 (20%), Positives = 103/295 (34%), Gaps = 31/295 (10%)

Query: 1   MTEEFPTPQL-IDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTN 59
           M     +PQL  +D     +    +  ++AG+  G+    V  P DT K+R Q    S +
Sbjct: 1   MAASSGSPQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEH 60

Query: 60  A----VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQH 115
                +   + + + EG    +KG +          SLQFG    +         AAS  
Sbjct: 61  KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLN------TAAASAG 114

Query: 116 LSLLQYYIC-GVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQL 174
           L    + +  G   G  +S L  P++ +R RL     S      +     I         
Sbjct: 115 LPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR-SAHFFSLRRQARVIWDTEGPAGF 173

Query: 175 MRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVY 234
            RG    +   +   G+ F  YE         G+       W        +G +    V+
Sbjct: 174 FRGGAWAIAATTLTTGLIFGIYETCTIAADTYGLP------WLAAAASPTAGLVSKAAVF 227

Query: 235 PLDVIKSVMQTDNLK------------TPKNGNNILTVGRTIIARQGVSGLFKGF 277
           PLD ++  +Q  + K            +   G   L +   ++  +G++ L+KG 
Sbjct: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 222 GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAP 279
           G+ SG +  ++  P+D +K + +   L +    + IL   RT+   +GV  L+KG  P
Sbjct: 31  GSVSGLVARSVTAPMDTVK-IRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 69/168 (41%), Gaps = 12/168 (7%)

Query: 114 QHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNG 172
           + +S L   + G   G     + +P++ ++IR Q Q  S    ++ G +   + + R  G
Sbjct: 20  EAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLAS--EHKYHGILHTFRTVAREEG 77

Query: 173 --QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLW 230
              L +G  P          + F TY  L      +G+     P       GA +G +  
Sbjct: 78  VRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLP----PQAHSLAVGALAGLVSS 133

Query: 231 TMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFA 278
            + YPLD++++ +  +      +  ++    R I   +G +G F+G A
Sbjct: 134 LLTYPLDLLRTRLVANR---SAHFFSLRRQARVIWDTEGPAGFFRGGA 178

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 220 LFGAASGTLLWTMVYPLDVIKSVMQTDN---LKTPKNGNNILTVGRTIIARQGVSGLFKG 276
           L G  +G+   T++ PLD IK + QT N   +K   +   +L  G  I +R  + G+F+G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 277 FAPTMLR 283
            + T+LR
Sbjct: 118 HSATLLR 124

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 44/108 (40%), Gaps = 15/108 (13%)

Query: 12  DDLESPHDNTRVIK--------DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS------ 57
           DDL+     TR  K        +LLAG   G+A      PF+  + RLQ    +      
Sbjct: 271 DDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHK 330

Query: 58  -TNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRF 104
            T+  ++ K +    G  GF+ G     + V   V+  F V E MK +
Sbjct: 331 FTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWY 378

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/328 (21%), Positives = 113/328 (34%), Gaps = 84/328 (25%)

Query: 20  NTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKG 79
           N  +  +LLAG+A  + Q  +  PF+  K   Q   +  NA                +  
Sbjct: 5   NPSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNA-----------EAFNMFHH 53

Query: 80  TLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAA---------SQHLSLLQYYICGVAGGF 130
             +   G   C +L  G+       F TFD+A             +S L+    G   GF
Sbjct: 54  VKSYFAG---CSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITGF 110

Query: 131 TNSFLASPIEHI-------------RIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM-- 175
             S L  P E+I             R + + +TG       K   +   K ++  +L   
Sbjct: 111 MESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQ 170

Query: 176 ---------------------------------RGLT-------PTMLRESHGCGVYFLT 195
                                            RG T       PT+ R+     V F T
Sbjct: 171 VKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTT 230

Query: 196 YEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGN 255
           Y  L   Q+ S    K +  +     G  S   +  +  P+DV+K+ MQ+    +    N
Sbjct: 231 YTTL--KQMIS--PNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYR-N 285

Query: 256 NILTVGRTIIARQGVSGLFKGFAPTMLR 283
           ++  V RT I  +G++ L+KG+ P + +
Sbjct: 286 SLNCVYRTFI-EEGLTSLWKGWVPRLFK 312

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 30  GTAGGIAQVLVGQPFDTTKVRLQTSETST---NAVKVIKDLIKNEGPMGFYKGTLTPLVG 86
           G     A V + QP D  K R+Q+  T +   N++  +      EG    +KG +  L  
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFK 312

Query: 87  VGACVSLQFGV 97
           VG    + FGV
Sbjct: 313 VGLSGGVSFGV 323

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 65/137 (47%), Gaps = 17/137 (12%)

Query: 27  LLAGTAGGIAQVLVGQPFDT--TKVRLQTSETST-------NAVKVIKDLIKNEGPMGFY 77
           +L G +GG+AQ  +   F T    V +  S+ ++       ++++V K +   EG  G  
Sbjct: 111 ILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGIN 170

Query: 78  KG----TLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNS 133
           KG     +  +   G+   L   V + ++R  H   + + + LS ++  +    GG  ++
Sbjct: 171 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTH---KRSDEKLSAMEKIVASALGGGLSA 227

Query: 134 FLASPIEHIRIRLQTQT 150
           +   PIE IR+ +Q++T
Sbjct: 228 W-NQPIEVIRVEMQSRT 243

>Kwal_14.2210
          Length = 315

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 26/195 (13%)

Query: 27  LLAGTAGGIAQVLVGQPFDTTKVRL--QTSETST-------------NAVKVIKDLIKNE 71
           L++G   G   VL   P D  + RL  QT+  +                 ++++     E
Sbjct: 118 LVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQE 177

Query: 72  GPM-GFYKGTLTPLVGVGACVSLQFGVNEAMKRFF-HTFDEAASQHLSLLQYYICGVAGG 129
           G + G Y+G     +GV   V+L F V E ++ +   +FD A++   SL +  I  ++GG
Sbjct: 178 GGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASA---SLYKLSIGAISGG 234

Query: 130 FTNSFLASPIEHIRIRLQTQTGSGATAEFKG---PIDCIKKLRVNG--QLMRGLTPTMLR 184
              + +  P + +R R Q      +   F     P   I   R  G     +GLT  + +
Sbjct: 235 VAQT-ITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFK 293

Query: 185 ESHGCGVYFLTYEAL 199
                 V ++ YE +
Sbjct: 294 VVPSTAVSWVVYETV 308

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 73/176 (41%), Gaps = 26/176 (14%)

Query: 125 GVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQ---LMRGLTPT 181
           G+AG  + + + SP E ++I LQ Q+ + A     G    +K++ +      L+RG    
Sbjct: 25  GIAGAVSRT-VVSPFERVKILLQVQSSTHAYNH--GLFRAVKQVYLEEGVPGLLRGNGLN 81

Query: 182 MLRESHGCGVYFLTYEALIGHQVKSGIQRKD--IPAWKLCLFGAASGTLLWTMVYPLDVI 239
            +R      V FL YE       +   Q  D  +  W   + GA  G       YPLD++
Sbjct: 82  CIRIFPYSAVQFLVYEFCKKQWFQ---QNPDTVVLNWHRLVSGALCGGCSVLATYPLDLV 138

Query: 240 KSVM--QTDNLK-----------TPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282
           ++ +  QT NL             P     +L   +T     G+ GL++G  PT +
Sbjct: 139 RTRLSIQTANLARLHKAKAASAAKPPGVWELLR--KTYTQEGGIFGLYRGVWPTSI 192

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query: 9   QLIDDLESPHD--NTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-----SETSTNAV 61
           QL + + +  D  +  + K  +   +GG+AQ +   PFD  + R Q      SE   +  
Sbjct: 207 QLREYIPASFDPASASLYKLSIGAISGGVAQTIT-YPFDLLRRRFQVLAMGQSELGFHYK 265

Query: 62  KVIKDLI---KNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRF 104
            V   LI   + EG  G+YKG    L  V    ++ + V E ++ +
Sbjct: 266 SVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRDY 311

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 60/149 (40%), Gaps = 11/149 (7%)

Query: 43  PFDTTKVRLQTSETSTNA--VKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA 100
           P D  K R+Q   T  N   V   K +I +EG      G    L+G     S +FG  E 
Sbjct: 33  PIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEL 92

Query: 101 MKRFF---HTFDEAASQHLSLLQYYICGVA-GGFTNSFLASPIEHIRIRLQTQTGSGATA 156
            K+       +D A +   ++   YI   A   F       P+E  RIRL +Q  + A  
Sbjct: 93  FKKLAIDNMGYDNAVNYKNTI---YIGSAAIAEFFADIALCPLEATRIRLVSQP-TFANG 148

Query: 157 EFKGPIDCIKKLRVNGQLMRGLTPTMLRE 185
            F G    +K+  V G    G TP + ++
Sbjct: 149 LFGGFSRILKEEGV-GSFYNGFTPILFKQ 176

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 39  LVGQPFDT--TKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFG 96
           +V QP DT  +KV         + + ++  L K  G +G + G  T LV VG   SLQFG
Sbjct: 226 VVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFG 285

Query: 97  VNEAMKR 103
           +   +K+
Sbjct: 286 IYGTLKK 292

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 217 KLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKG 276
           K  L GA    +  + + P+DV+K+ +Q   L+       +++  + II+ +G   L  G
Sbjct: 15  KFALAGAIGCGITHSSMVPIDVVKTRIQ---LEPTVYNKGMVSSFKQIISSEGAGALLTG 71

Query: 277 FAPTML 282
           F PT+L
Sbjct: 72  FGPTLL 77

>Scas_687.15*
          Length = 328

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 41/103 (39%), Gaps = 3/103 (2%)

Query: 11  IDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS---TNAVKVIKDL 67
           +  L SP      +     G     A V + QP D  K R+Q+        N++     +
Sbjct: 221 LKQLISPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRV 280

Query: 68  IKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDE 110
              EG +  +KG L  L  VG    + FGV + ++   HT  +
Sbjct: 281 FVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQYVENLSHTLKK 323

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/154 (20%), Positives = 69/154 (44%), Gaps = 13/154 (8%)

Query: 57  STNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHL 116
           S+N   V+K++    G  GF +G +  +    +  +++F     +K+       + +Q L
Sbjct: 177 SSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI-----SPTQPL 231

Query: 117 SLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG---Q 173
           + +  +  G+        L  PI+ ++ R+Q++T   A   +K  ++C  ++ V      
Sbjct: 232 NEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKT---AHYFYKNSLNCAYRVFVEEGMVS 288

Query: 174 LMRGLTPTMLRESHGCGVYFLTYEAL--IGHQVK 205
           L +G  P + +     G+ F  Y+ +  + H +K
Sbjct: 289 LWKGWLPRLFKVGLSGGISFGVYQYVENLSHTLK 322

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 45/123 (36%), Gaps = 19/123 (15%)

Query: 2   TEEFPTPQLIDDLESPHDNT---RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST 58
           T EF   Q      + H+ +     I     G+ GG    L+  PFD  K R+Q +  S 
Sbjct: 220 TYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASP 279

Query: 59  NAVKV----------------IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMK 102
             + V                +  + K+EG    Y G L  ++ +    ++     E  K
Sbjct: 280 QQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSK 339

Query: 103 RFF 105
           +FF
Sbjct: 340 KFF 342

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 81/198 (40%), Gaps = 41/198 (20%)

Query: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQ------TGSG----------------------- 153
           +   AG    S   +P++ +R+RL  Q      T +G                       
Sbjct: 16  VSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCRE 75

Query: 154 ATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQR 210
             A  +G ++ ++K+ ++ G   L RGL  T++       VYF  YEAL  +   +    
Sbjct: 76  PAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDNSPLAS--- 132

Query: 211 KDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQT-----DNLKTPKNGNNILTVGRTII 265
             +P     + GA +  L  T + PL+++++ +Q+     D  +T     ++L   R  +
Sbjct: 133 -RLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEV 191

Query: 266 ARQGVSGLFKGFAPTMLR 283
           +  G   LFKG   T+ R
Sbjct: 192 SVMGYRALFKGLEITLWR 209

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 77/215 (35%), Gaps = 32/215 (14%)

Query: 15  ESPHDNTRVIKDLLAGT---AGGIAQVLVG---QPFDTTKVRLQT---SETSTNAVKVIK 65
           E+  DN+ +   L        G  A++L      P +  + RLQ+   +  +   + +I 
Sbjct: 122 EALRDNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIG 181

Query: 66  DLIKNE-------GPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFF---HTFDEAASQH 115
           DL++         G    +KG    L       ++ +G  E  K  F   H     AS  
Sbjct: 182 DLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNW 241

Query: 116 LSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGP-------------I 162
              +  + CG  GG   + L  P +  + R+Q    S       G              +
Sbjct: 242 DHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFL 301

Query: 163 DCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYE 197
           + I+K      L  GL P +++ +  C +   TYE
Sbjct: 302 NAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYE 336

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 110/307 (35%), Gaps = 54/307 (17%)

Query: 18  HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFY 77
           +DN  +I    AG+  G+    +  PF+  K  LQ      N V      +       ++
Sbjct: 7   NDNVTLIT---AGSVSGLFSATITYPFEFLKTGLQLHR---NVVAAKPFEVLGYQVRTYF 60

Query: 78  KGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLAS 137
            G     +GV    SL+F   +    +      A    LS +Q  + G   G   S    
Sbjct: 61  AGCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTGTMESLCII 120

Query: 138 PIEHIRI-----------RLQTQTGS--GATA-EFKGPIDCIKKLRVNGQLM-------- 175
           P E++++           RL T T +  G  A E K        LR + + +        
Sbjct: 121 PFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTN 180

Query: 176 ------------------RGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWK 217
                             +G  PT++R+     V F T+  L     K   Q  +  A  
Sbjct: 181 VLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKE-YQNNEYFA-- 237

Query: 218 LCLFGAASGTLLWTMVYPLDVIKSVMQT-DNLKTPKNGNNILTVGRTIIARQGVSGLFKG 276
             L G  S   +     PLDVIK+ MQ  D++   +N  N       I   +G + L+KG
Sbjct: 238 -TLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSIN---CAYRIFVEEGFAMLWKG 293

Query: 277 FAPTMLR 283
           + P +++
Sbjct: 294 WLPRLMK 300

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 4/85 (4%)

Query: 18  HDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSET---STNAVKVIKDLIKNEGPM 74
           + N      LL G     A V   QP D  K R+Q  ++     N++     +   EG  
Sbjct: 230 YQNNEYFATLL-GLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFA 288

Query: 75  GFYKGTLTPLVGVGACVSLQFGVNE 99
             +KG L  L+ VG   S+ FG+ +
Sbjct: 289 MLWKGWLPRLMKVGLSGSVSFGIYQ 313

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 64/147 (43%), Gaps = 19/147 (12%)

Query: 58  TNAVKVIKDLIKNEGPMGFYKGTLTPLV-GVGACVSLQFGVNEAMKRFF---HTFDEAAS 113
           TN +    +L +  G   ++KGT+  L+  VG  V ++F     +K+F    +  +E  +
Sbjct: 179 TNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSV-VRFTTFTMLKQFAPKEYQNNEYFA 237

Query: 114 QHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN-- 171
             L L+    C V G         P++ I+ R+Q +    +   ++  I+C  ++ V   
Sbjct: 238 TLLGLISS--CAVVGA------TQPLDVIKTRMQAK---DSVLLYRNSINCAYRIFVEEG 286

Query: 172 -GQLMRGLTPTMLRESHGCGVYFLTYE 197
              L +G  P +++      V F  Y+
Sbjct: 287 FAMLWKGWLPRLMKVGLSGSVSFGIYQ 313

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 217 KLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKG 276
           K  L GA       + + P+DV+K+ +Q + LK     + ++   R I+  +G + L  G
Sbjct: 17  KFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYS---SGMVGSFRKIVGEEGAAALLTG 73

Query: 277 FAPTML 282
           F PT+L
Sbjct: 74  FGPTLL 79

 Score = 34.3 bits (77), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 67/165 (40%), Gaps = 7/165 (4%)

Query: 25  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKDLIKNEGPMGFYKGTLT 82
           K  LAG  G  A      P D  K R+Q    + S+  V   + ++  EG      G   
Sbjct: 17  KFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGP 76

Query: 83  PLVGVGACVSLQFGVNEAMKRFF--HTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIE 140
            L+G     + +FG  E  K+ F      E A Q+ + +      +A  F +  L  P+E
Sbjct: 77  TLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALC-PLE 135

Query: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRE 185
             RIRL +Q  + A     G    +K+  + G    G TP + ++
Sbjct: 136 ATRIRLVSQP-TFANGLVGGFARILKEEGI-GSFYNGFTPILFKQ 178

 Score = 32.0 bits (71), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 39  LVGQPFDT--TKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFG 96
           ++ QP DT  +KV         +   ++  L K  G +G + G  T LV VG   SLQFG
Sbjct: 228 VISQPADTLLSKVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFG 287

Query: 97  VNEAMKR 103
           +   +K+
Sbjct: 288 IYGKLKQ 294

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 34.7 bits (78), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 222 GAASGTLLWTMVYPLDVIKSVMQTD-------NLKTPKNGNNILTVGRTIIARQGVSGLF 274
           GA + +L  T VYPLD+ K+++QT        + K  +   N++     I  ++G  GL+
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 275 KGFAPTM 281
           +G A  +
Sbjct: 70  QGLATNV 76

>Scas_705.9
          Length = 323

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 11/72 (15%)

Query: 222 GAASGTLLWTMVYPLDVIKSVMQ-------TDNL----KTPKNGNNILTVGRTIIARQGV 270
           GA + T+   +VYPLDV K+V+Q       TD L    K      N++     I  ++G+
Sbjct: 10  GAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGL 69

Query: 271 SGLFKGFAPTML 282
            GL++G + ++ 
Sbjct: 70  RGLYQGMSTSVF 81

>Kwal_55.21106
          Length = 328

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 222 GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNN 256
           GA + +L   +VYPLD++K+++QT N K P  G+ 
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQN-KEPNIGSE 43

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 33/92 (35%), Gaps = 10/92 (10%)

Query: 24  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS----------ETSTNAVKVIKDLIKNEGP 73
           I    +G   G+   +   PFD  K R Q S            S N  K ++ + + EG 
Sbjct: 269 INSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGL 328

Query: 74  MGFYKGTLTPLVGVGACVSLQFGVNEAMKRFF 105
              Y G    ++ +    ++     E  K+ F
Sbjct: 329 AALYTGLAARVIKIRPSCAIMISSYEISKKVF 360

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 109 DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQ 149
           D   S  L+L +  +   AG    S + +P++ +RIRLQ Q
Sbjct: 3   DRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQ 43

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 39/94 (41%), Gaps = 14/94 (14%)

Query: 5   FPTP----QLIDD--LESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST 58
           FPTP     L+D   L SP  N       + G    I   ++ QP    K  LQ S +  
Sbjct: 220 FPTPAAASHLVDSAALLSPGQN------FVMGVLSKIVSTVLTQPLIIAKASLQRSGSCF 273

Query: 59  NAV-KVIKDLIKNEGPMGFYKGTLTPLVGVGACV 91
               +V+  L   EGP+  +KG L P +  G  V
Sbjct: 274 QDFHQVLHHLYSTEGPLSLWKG-LGPQITKGVLV 306

>KLLA0E19547g complement(1729566..1730318) similar to sgd|S0006117
           Saccharomyces cerevisiae YPL196w, hypothetical start
          Length = 250

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 230 WTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFA 278
           WT++Y L+   + + +   K   + NN   VG  I+ R    G+F G+A
Sbjct: 85  WTLLYSLEQHGASLHSLYDKLKYDTNNNARVGYVIVIRDRKGGIFGGYA 133

>CAGL0E01771g complement(175415..176974) similar to sp|P53379
           Saccharomyces cerevisiae YDR144c MKC7 or sp|P32329
           Saccharomyces cerevisiae YLR120c YAP3 or sp|Q12303
           Saccharomyces cerevisiae YLR121c YPS3, hypothetical
           start
          Length = 519

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 30/80 (37%)

Query: 7   TPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKD 66
           TP++ D+L    DN   I  LL G      Q+ VG P     V+L T  +    V     
Sbjct: 24  TPKISDELTKRADNDSFIAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSASNP 83

Query: 67  LIKNEGPMGFYKGTLTPLVG 86
             KN       K  L P+  
Sbjct: 84  YCKNNKKFAPKKQDLMPITS 103

>Scas_671.1*
          Length = 123

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 37/89 (41%), Gaps = 2/89 (2%)

Query: 12  DDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-ETSTNAVKVIKDLIKN 70
           +D++     + V+  + A  +  +A  +   PFDT K R+Q   +  TN    +  + KN
Sbjct: 29  EDMKFSTSTSTVVNSVSAIASASLATAITA-PFDTIKTRMQLKPKVFTNFFTTLVLITKN 87

Query: 71  EGPMGFYKGTLTPLVGVGACVSLQFGVNE 99
           E     + G    L        + +G+ E
Sbjct: 88  ESIFQLFSGLSMRLTRKALSAGIAWGIYE 116

>KLLA0F09768g complement(899099..900685) weakly similar to sp|P53129
           Saccharomyces cerevisiae YGL124c MON1 singleton,
           hypothetical start
          Length = 528

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 44/100 (44%), Gaps = 6/100 (6%)

Query: 96  GVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGAT 155
           G+   +  +F+  D  A     + Q+ + G  G  T  F+     HI++ +Q      +T
Sbjct: 139 GIIHTVMNYFNINDNTA-----MRQFTMYGKDGIMT-RFVFLDKNHIKLMVQCNNNYEST 192

Query: 156 AEFKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLT 195
           A+ +  +D +    ++    R L   ML+ S+    ++LT
Sbjct: 193 AQLQQQLDLVYSYIISSVSQRNLNKLMLKRSNFDLQHYLT 232

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 33/97 (34%)

Query: 219 CLFGAASGTLLWTMVYPLDVIKSVMQT-----DNLK----TPK----------------- 252
            L GA +  +  T+VYPLD++K+++QT     + LK     P+                 
Sbjct: 7   ALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIK 66

Query: 253 -NGNNILTVGRT------IIARQGVSGLFKGFAPTML 282
            N NN L    T      I  ++G+ GL++G   +++
Sbjct: 67  LNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVM 103

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 39/97 (40%), Gaps = 2/97 (2%)

Query: 64  IKDLIKNEGPMGFYKG-TLTPLVGVGACVSLQFGVNEAMKRFFHT-FDEAASQHLSLLQY 121
           I  + K EG  G Y+G T + + G     S  F  +   K +F        +   + ++ 
Sbjct: 82  IYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKNTKFTTIEE 141

Query: 122 YICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEF 158
            + G+    T+    +PI  I  R QT+ G     +F
Sbjct: 142 LLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDF 178

>Kwal_27.11537
          Length = 708

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIK 69
           D +A +A G+A+VL+G+P D   V     +    AV+VI  +IK
Sbjct: 382 DSIAKSALGVAKVLIGEPPDELPV---VKQPKPEAVEVIDAVIK 422

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 47/133 (35%), Gaps = 19/133 (14%)

Query: 43  PFDTTKVRLQTSETST------NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFG 96
           P    K R+Q               + +  L K+ G  G Y+G    L+  G   ++Q  
Sbjct: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196

Query: 97  VNEAMKRFFHTFDEAASQHL--SLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGA 154
           V    K       EA S+H+   +  Y +             +P +    R+    G   
Sbjct: 197 VYSHAK-------EALSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG--- 246

Query: 155 TAEFKGPIDCIKK 167
              ++GP+DC+ K
Sbjct: 247 -GLYRGPLDCLCK 258

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 50/129 (38%), Gaps = 3/129 (2%)

Query: 34  GIAQVLVGQPFDTTKVRLQTSETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSL 93
           GI Q+   +P   T  +    +   +A+ VI  + +NEG  G Y G    L+G       
Sbjct: 65  GIQQI-KPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFS 123

Query: 94  QFGVNEAMKRFFHTFDEAASQ--HLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTG 151
            F     ++R +    +   +    S ++  +  +    T+    +PI  +  + QT+ G
Sbjct: 124 YFFWYTLIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRG 183

Query: 152 SGATAEFKG 160
                 FK 
Sbjct: 184 LEGDNSFKA 192

>AFR665C [3858] [Homologous to ScYGR046W - SH] (1651993..1653123)
           [1131 bp, 376 aa]
          Length = 376

 Score = 28.1 bits (61), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 5/34 (14%)

Query: 188 GCGVYFLTYEALIGHQVKSGIQR-----KDIPAW 216
           G GVYF  +  + GHQVK G+       KD+  W
Sbjct: 182 GAGVYFNPFVDINGHQVKYGVVSMENLLKDLATW 215

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 28.1 bits (61), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 123 IC-GVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKG----PIDCIKKLRVNGQLMRG 177
           +C G   G   +  ++PI+ I  R        +  ++       ID +K++ + G    G
Sbjct: 160 VCAGFMAGVAQAVASAPIDAIYTRSTANDLLSSAKKYNSLWLYGIDKLKEIGLVG-CFGG 218

Query: 178 LTPTMLRESHGCGVYFLTYEALIGHQVKSGIQ 209
              ++++ES G  VYF T+E L G      I+
Sbjct: 219 FGLSLVKESVGFAVYFTTFELLKGQVCNKTIE 250

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,045,735
Number of extensions: 358973
Number of successful extensions: 2002
Number of sequences better than 10.0: 206
Number of HSP's gapped: 1291
Number of HSP's successfully gapped: 462
Length of query: 299
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 198
Effective length of database: 13,099,691
Effective search space: 2593738818
Effective search space used: 2593738818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)