Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08437g1521507951e-110
Kwal_27.126071521506414e-87
YPR062W (FCY1)1581496163e-83
Scas_667.25*1541486069e-82
CAGL0D01562g1551495781e-77
ADL328C1511505451e-72
ACR075C2451011179e-08
YJL035C (TAD2)2501021109e-07
Scas_690.232561071054e-06
Kwal_23.289424799984e-05
CAGL0J01023g259107932e-04
CAGL0G05852g30770897e-04
YHR144C (DCD1)31270830.003
Scas_677.2431670810.007
KLLA0C10989g23882760.032
Sklu_2368.332970730.074
Kwal_33.1449914470710.095
CAGL0M02233g76730660.68
Kwal_56.2475061964622.7
ADR304W65550604.2
Scas_473.136746604.5
AAL030C153943596.9
CAGL0F01705g59562579.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08437g
         (150 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08437g complement(750194..750652) highly similar to sp|Q12...   310   e-110
Kwal_27.12607                                                         251   4e-87
YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,...   241   3e-83
Scas_667.25*                                                          238   9e-82
CAGL0D01562g complement(166898..167365) highly similar to sp|Q12...   227   1e-77
ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH] (123313..12...   214   1e-72
ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH] (497467..49...    50   9e-08
YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit t...    47   9e-07
Scas_690.23                                                            45   4e-06
Kwal_23.2894                                                           42   4e-05
CAGL0J01023g complement(100059..100838) similar to sp|P47058 Sac...    40   2e-04
CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces c...    39   7e-04
YHR144C (DCD1) [2432] chr8 complement(387789..388727) Deoxycytid...    37   0.003
Scas_677.24                                                            36   0.007
KLLA0C10989g complement(944739..945455) similar to sp|P47058 Sac...    34   0.032
Sklu_2368.3 YHR144C, Contig c2368 5164-6153                            33   0.074
Kwal_33.14499                                                          32   0.095
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    30   0.68 
Kwal_56.24750                                                          28   2.7  
ADR304W [2045] [Homologous to ScYHR084W (STE12) - SH] complement...    28   4.2  
Scas_473.1                                                             28   4.5  
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    27   6.9  
CAGL0F01705g complement(168842..170629) highly similar to sp|P15...    27   9.4  

>KLLA0B08437g complement(750194..750652) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine deaminase
           singleton, start by similarity
          Length = 152

 Score =  310 bits (795), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%)

Query: 1   MAEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETS 60
           MAEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETS
Sbjct: 1   MAEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETS 60

Query: 61  TLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERG 120
           TLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERG
Sbjct: 61  TLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERG 120

Query: 121 IEVKVVDDERCIEIMKDFIAKRPEDWFEDI 150
           IEVKVVDDERCIEIMKDFIAKRPEDWFEDI
Sbjct: 121 IEVKVVDDERCIEIMKDFIAKRPEDWFEDI 150

>Kwal_27.12607
          Length = 152

 Score =  251 bits (641), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 118/150 (78%), Positives = 132/150 (88%)

Query: 1   MAEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETS 60
           M++WD+KG+D AYEEA  GYKEGGVPIGGCLI+N  G +LGSGHNMRFQKGS TLHGE S
Sbjct: 1   MSKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIS 60

Query: 61  TLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERG 120
           TLEN GR+KGSVYK CT+YTTLSPCDMCTGAILLYGI R VVGENVNFK  GE+YLAERG
Sbjct: 61  TLENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERG 120

Query: 121 IEVKVVDDERCIEIMKDFIAKRPEDWFEDI 150
            EVKV+DD+RC +IMK FI +RP+DWFEDI
Sbjct: 121 CEVKVLDDDRCKDIMKQFIEERPQDWFEDI 150

>YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,
           catalyzes the hydrolysis of cytidine into uridine and
           ammonia [477 bp, 158 aa]
          Length = 158

 Score =  241 bits (616), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (85%)

Query: 2   AEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETST 61
           ++WD+KGMD AYEEAA+GYKEGGVPIGGCLI+N  G +LG GHNMRFQKGS TLHGE ST
Sbjct: 8   SKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEIST 67

Query: 62  LENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERGI 121
           LEN GRL+G VYK  T+YTTLSPCDMCTGAI++YGI R VVGENVNFKS GEKYL  RG 
Sbjct: 68  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGH 127

Query: 122 EVKVVDDERCIEIMKDFIAKRPEDWFEDI 150
           EV VVDDERC +IMK FI +RP+DWFEDI
Sbjct: 128 EVVVVDDERCKKIMKQFIDERPQDWFEDI 156

>Scas_667.25*
          Length = 154

 Score =  238 bits (606), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%)

Query: 3   EWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETSTL 62
           +WDK GMD A+EEAA GY EGGVPIGGCLI+N  G++LG GHNMRFQKGSPTLHGE STL
Sbjct: 5   QWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEISTL 64

Query: 63  ENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERGIE 122
           EN GRL+G VYK  T+YTTLSPCDMCTGAIL+YGI RVV+GE+VNFKSPGE YLA R ++
Sbjct: 65  ENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASRNVQ 124

Query: 123 VKVVDDERCIEIMKDFIAKRPEDWFEDI 150
           V  +DDERC  IMK FI +RP+DWFEDI
Sbjct: 125 VVQMDDERCKTIMKKFIDERPQDWFEDI 152

>CAGL0D01562g complement(166898..167365) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine
           deaminase, hypothetical start
          Length = 155

 Score =  227 bits (578), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 122/149 (81%)

Query: 2   AEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETST 61
           A+WD  GM  AYEEAA G++EGGVPIGGCLI+N  G +LG GHNMRFQKGSPTLHGE ST
Sbjct: 5   AQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEIST 64

Query: 62  LENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERGI 121
           LEN GRL+G VYK  T+YTTLSPCDMCTGAILLYGI R V+GE+ NFKSPGE+YL  RG+
Sbjct: 65  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSRGV 124

Query: 122 EVKVVDDERCIEIMKDFIAKRPEDWFEDI 150
           EV  ++DE C  IMK FI  RP+DWFEDI
Sbjct: 125 EVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153

>ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH]
           (123313..123768) [456 bp, 151 aa]
          Length = 151

 Score =  214 bits (545), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 115/150 (76%), Gaps = 1/150 (0%)

Query: 1   MAEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETS 60
           MA+WD+KGM+ AY+EA  GY EGGVPIGGCLID   G +LG G NMRFQ+ S TLHGET+
Sbjct: 1   MAQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETA 60

Query: 61  TLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERG 120
            LENAGRL G VYKHCT+YTTLSPCDMC GA+LLYGI R VVGEN  F    E +L  RG
Sbjct: 61  ALENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARG 119

Query: 121 IEVKVVDDERCIEIMKDFIAKRPEDWFEDI 150
           +EV V+ D RC  +M+ F+A RP+DW EDI
Sbjct: 120 VEVTVLQDARCRALMQQFVAARPQDWNEDI 149

>ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH]
           (497467..498204) [738 bp, 245 aa]
          Length = 245

 Score = 49.7 bits (117), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 43/101 (42%), Gaps = 4/101 (3%)

Query: 7   KGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETSTLENAG 66
           + M  A   A      G  P+    +   + +I+  G N   +  +   H E   +    
Sbjct: 6   QHMRTAIRLARYALDHGETPVACVFVHTPSDQIIAYGMNDTNRSLTGIAHAEFGAIAQVQ 65

Query: 67  RLKG----SVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVG 103
            L G    S++K  T+Y T+ PC MC  A+   GIGRV+ G
Sbjct: 66  ELFGEQDASIFKEVTVYVTVEPCVMCASALKQLGIGRVIFG 106

>YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit
           tRNA[Ala]-specific adenosine deaminase [753 bp, 250 aa]
          Length = 250

 Score = 47.0 bits (110), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 7   KGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETSTLENAG 66
           K M  A   A         P+    +   TG+++  G N   +  +   H E   ++   
Sbjct: 5   KHMRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIK 64

Query: 67  RLKGS-----VYKHCTMYTTLSPCDMCTGAILLYGIGRVVVG 103
            + GS     V+K  T+Y T+ PC MC  A+    IG+VV G
Sbjct: 65  AMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLDIGKVVFG 106

>Scas_690.23
          Length = 256

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 9/107 (8%)

Query: 2   AEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETST 61
           A W    M+ A + A         P+    +   T +I+  G N   +  +   H E   
Sbjct: 9   ASW----MESAIKLARYALDHDETPVASIFVHEPTNKIIAYGLNDTNKSLTGIAHAEFMG 64

Query: 62  LENAGRLKGS-----VYKHCTMYTTLSPCDMCTGAILLYGIGRVVVG 103
           +E    + GS     ++K   +Y T+ PC MC  A+   GI +VV G
Sbjct: 65  IEQIKAMVGSEHLTEIFKDTVLYVTVEPCVMCASALRQLGIKKVVFG 111

>Kwal_23.2894
          Length = 247

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 4/99 (4%)

Query: 9   MDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGE----TSTLEN 64
           M  A + A         P+    +   T +IL  G N   +  +   H E    +     
Sbjct: 10  MRAALKLARYALDHDETPVACIFVHAPTNQILAYGMNDTNRSLTGIAHAEFMGISQIQAK 69

Query: 65  AGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVG 103
            G    SVYK   +Y T+ PC MC  A+   GI +V+ G
Sbjct: 70  FGVQNTSVYKDIILYVTVEPCIMCASALKQLGIQKVIFG 108

>CAGL0J01023g complement(100059..100838) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2, hypothetical
           start
          Length = 259

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 43/107 (40%), Gaps = 10/107 (9%)

Query: 7   KGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGE---TSTLE 63
           K +D A + A      G  P+    +   +  ++  G N      S T H E      L 
Sbjct: 6   KHIDSALKLARYALDHGETPVACVFVHEKSDSVVAYGLNDTNDSLSGTAHAEFVAMRMLR 65

Query: 64  NAGRLKG-------SVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVG 103
           +A + +G        ++K    Y T+ PC MC  A+   GI ++V G
Sbjct: 66  DAVQAQGYASVQLKQLFKEIVCYVTVEPCIMCASALKQMGIHKIVFG 112

>CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces
           cerevisiae YHR144c DCD1 deoxycytidylate deaminase, start
           by similarity
          Length = 307

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 55  LHGETSTLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEK 114
           LH E + L  AGR    V ++ T+Y    PC  C+  I+  GI  VV  +         K
Sbjct: 227 LHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDDASFK 284

Query: 115 YLAERGIEVK 124
            L E GI+V+
Sbjct: 285 VLREAGIKVR 294

>YHR144C (DCD1) [2432] chr8 complement(387789..388727)
           Deoxycytidylate deaminase [939 bp, 312 aa]
          Length = 312

 Score = 36.6 bits (83), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 2/70 (2%)

Query: 55  LHGETSTLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEK 114
           LH E + L  AGR    V ++ T+Y    PC  C+  I+  GI  VV  ++        K
Sbjct: 232 LHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGISEVVYSQSYRMDEESFK 289

Query: 115 YLAERGIEVK 124
            L   GI V+
Sbjct: 290 VLKNAGITVR 299

>Scas_677.24
          Length = 316

 Score = 35.8 bits (81), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 2/70 (2%)

Query: 55  LHGETSTLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEK 114
           LH E + L  AGR +  V    T+Y    PC  C+  I+  GI  VV  +         K
Sbjct: 236 LHAEENALLEAGRDRVGV--KATLYCDTCPCLTCSVKIVQTGIKEVVYSQTYRMDEESFK 293

Query: 115 YLAERGIEVK 124
            L   GI V+
Sbjct: 294 VLTSAGINVR 303

>KLLA0C10989g complement(944739..945455) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2 tRNA-specific
           adenosine deaminase 2 singleton, start by similarity
          Length = 238

 Score = 33.9 bits (76), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 3/82 (3%)

Query: 25  VPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETSTLENAGRLKGS---VYKHCTMYTT 81
            P+    + +   +++  G N   +  S   H E   ++      G+   +     +Y T
Sbjct: 24  TPVACIFVHSKLNKVIAYGMNGTNESISGISHAEFMGIKQIQEKYGTDPKILSEVVLYVT 83

Query: 82  LSPCDMCTGAILLYGIGRVVVG 103
           + PC MC  A+   GI +VV G
Sbjct: 84  VEPCIMCASALKQLGIKKVVFG 105

>Sklu_2368.3 YHR144C, Contig c2368 5164-6153
          Length = 329

 Score = 32.7 bits (73), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 2/70 (2%)

Query: 55  LHGETSTLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEK 114
           LH E + L  AGR +  V  + T+Y    PC  C+  I+  GI  VV  ++        K
Sbjct: 249 LHAEENALLEAGRDR--VGSNATLYCDTCPCLTCSVKIVQTGIREVVYSQSYRMDEASFK 306

Query: 115 YLAERGIEVK 124
            L   G+ ++
Sbjct: 307 VLQSGGVLIR 316

>Kwal_33.14499
          Length = 144

 Score = 32.0 bits (71), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 55  LHGETSTLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEK 114
           LH E + L  AGR +  V  + T+Y    PC  C+  I+  G+  VV  ++ +      K
Sbjct: 64  LHAEENALLEAGRDR--VGPNATLYCDTCPCLTCSVKIVQTGVREVVYSQSYHMDEASFK 121

Query: 115 YLAERGIEVK 124
            L + G+ V+
Sbjct: 122 VLQDGGVLVR 131

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 30.0 bits (66), Expect = 0.68,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 5/30 (16%)

Query: 110 SPGEKYLAERGIEVKVVDDERCIEIMKDFI 139
           +PG+KYL + G E+K++ D++     KDF+
Sbjct: 640 TPGKKYLLQEGDEIKIIKDKQ-----KDFV 664

>Kwal_56.24750
          Length = 619

 Score = 28.5 bits (62), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 7/64 (10%)

Query: 4   WDKKGMDKAYE-------EAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLH 56
           WDKK  +           +++    EG     G +ID L     GS    +FQKG+   +
Sbjct: 130 WDKKTQESMESMLTSGNMKSSKSSDEGADSSNGGIIDRLRSHDSGSAAAQKFQKGADMEN 189

Query: 57  GETS 60
           GE++
Sbjct: 190 GESA 193

>ADR304W [2045] [Homologous to ScYHR084W (STE12) - SH]
           complement(1231538..1233505) [1968 bp, 655 aa]
          Length = 655

 Score = 27.7 bits (60), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 100 VVVGENVNFKSPGEKYLAERGIEVKVVDDERCIEIMKDFIAKRPEDWFED 149
           V+  +N+  KS   +   ER     V +  R IE +K F+A  P +W E+
Sbjct: 3   VLKTDNIMMKSKTGEQRVERAKPENVEEALRLIEDLKFFLATAPANWQEN 52

>Scas_473.1
          Length = 367

 Score = 27.7 bits (60), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%)

Query: 23  GGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETSTLENAGRL 68
           GGV      IDN+ GEIL  G N+  QK      G  S   ++ +L
Sbjct: 236 GGVNTVDYFIDNVGGEILDLGVNLLKQKAMLLACGSISGYNDSSKL 281

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 27.3 bits (59), Expect = 6.9,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 22/43 (51%)

Query: 54   TLHGETSTLENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYG 96
            TL      L+N  +L+ ++  +     T+  CD+C GAI+  G
Sbjct: 1193 TLQSRLKYLQNLTKLEQALKDNMRFNCTICLCDICDGAIIGRG 1235

>CAGL0F01705g complement(168842..170629) highly similar to sp|P15624
           Saccharomyces cerevisiae YLR060w FRS1 phenylalanyl-tRNA
           synthetase, start by similarity
          Length = 595

 Score = 26.6 bits (57), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 14/62 (22%)

Query: 54  TLHGETSTLENAGRLKGSVYKHCTMYTT----LSPCDMCTGAILLYGIGRVVVGE---NV 106
           +LHGE S  + A         H T+  T    L PCD+   A + YG   +  GE   N 
Sbjct: 325 SLHGEASKTDEA-------VLHVTIPITRPDVLHPCDIMEDAAIGYGYNNLPKGEKLSNA 377

Query: 107 NF 108
           NF
Sbjct: 378 NF 379

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,072,760
Number of extensions: 203476
Number of successful extensions: 422
Number of sequences better than 10.0: 25
Number of HSP's gapped: 421
Number of HSP's successfully gapped: 25
Length of query: 150
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 58
Effective length of database: 13,411,253
Effective search space: 777852674
Effective search space used: 777852674
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)