Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08415g1211205103e-68
Scas_667.26*1261071813e-18
ADL329W111691762e-17
CAGL0D01540g1271141744e-17
Kwal_27.1261072691566e-15
YPR063C1401081606e-15
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08415g
         (120 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267 Sacch...   201   3e-68
Scas_667.26*                                                           74   3e-18
ADL329W [1412] [Homologous to ScYPR063C - SH] complement(122957....    72   2e-17
CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces c...    72   4e-17
Kwal_27.12610                                                          65   6e-15
YPR063C (YPR063C) [5492] chr16 complement(677807..678188,678275....    66   6e-15

>KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267
           Saccharomyces cerevisiae YPR063c hypothetical protein,
           start by similarity
          Length = 121

 Score =  201 bits (510), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 103/120 (85%), Positives = 103/120 (85%)

Query: 1   MPLNNVRRPDLVATYNHTPAPKXXXXXXXXXXXXXXXXXPMAAMFMKNKFLAWFAVLTTW 60
           MPLNNVRRPDLVATYNHTPAPK                 PMAAMFMKNKFLAWFAVLTTW
Sbjct: 1   MPLNNVRRPDLVATYNHTPAPKGLYSSSSSSQGMLSQSMPMAAMFMKNKFLAWFAVLTTW 60

Query: 61  HVFLTSQPDPSNPTDSPFMKIGMAVLAVGMNYLGLFFPGTQPPPLGVVPKATSDSSATTT 120
           HVFLTSQPDPSNPTDSPFMKIGMAVLAVGMNYLGLFFPGTQPPPLGVVPKATSDSSATTT
Sbjct: 61  HVFLTSQPDPSNPTDSPFMKIGMAVLAVGMNYLGLFFPGTQPPPLGVVPKATSDSSATTT 120

>Scas_667.26*
          Length = 126

 Score = 74.3 bits (181), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 9/107 (8%)

Query: 1   MPLNNVRRPDLVATYNHTPAPKXXXXXXXXXXXXXXXXXPMAAMFMKNKFLAWFAVLTTW 60
           M LNNV+RPDL A  +    PK                 PMAA+F++N+F+AWFAV+ + 
Sbjct: 1   MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV 60

Query: 61  HVFLTSQPDPSNPTD---------SPFMKIGMAVLAVGMNYLGLFFP 98
           H +L +  D +N  D         +P +K+ MA++ + + Y+ L FP
Sbjct: 61  HYYLNTDEDEANAKDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFP 107

>ADL329W [1412] [Homologous to ScYPR063C - SH]
           complement(122957..123292) [336 bp, 111 aa]
          Length = 111

 Score = 72.4 bits (176), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 40  PMAAMFMKNKFLAWFAVLTTWHVFLTSQP----DPSNPTDSPFMKIGMAVLAVGMNYLGL 95
           PM AMFM+NKFLAWF++LT WH +LT+ P    D       P MK+GMAV+AV + Y G+
Sbjct: 41  PMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVRDREGTEVGPIMKLGMAVVAVVVCYTGM 100

Query: 96  FFPGTQPPP 104
             P  QP P
Sbjct: 101 VLP--QPAP 107

>CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces
           cerevisiae YPR063c, start by similarity
          Length = 127

 Score = 71.6 bits (174), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 10/114 (8%)

Query: 1   MPLNNVRRPDLVATYNHTPAPKXXXXXXXXXXXXXXXXXPMAAMFMKNKFLAWFAVLTTW 60
           M LNNVRR DL   Y  +  P+                 PMAA+F+KNKF+AWF+++ + 
Sbjct: 1   MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV 60

Query: 61  HVFLTSQPDPSNPTDS----------PFMKIGMAVLAVGMNYLGLFFPGTQPPP 104
           H +L +  +      S          P +K+ M+++ + + Y+ L FP    PP
Sbjct: 61  HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPDAPP 114

>Kwal_27.12610
          Length = 72

 Score = 64.7 bits (156), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 40  PMAAMFMKNKFLAWFAVLTTWHVFLTSQPDPSNPTDSPFMKIGMAVLAVGMNYLGLFFPG 99
           PMAAMFM+NKFLAWFA+L+T H  LT++PD +N   S  +K+ M+++++ + Y+ + FP 
Sbjct: 2   PMAAMFMRNKFLAWFALLSTVHYALTTEPD-ANADQSAVVKVLMSLVSLAVCYINVAFP- 59

Query: 100 TQPPPLGVV 108
            QP P   +
Sbjct: 60  -QPGPADAI 67

>YPR063C (YPR063C) [5492] chr16
           complement(677807..678188,678275..678315) Protein of
           unknown function [423 bp, 140 aa]
          Length = 140

 Score = 66.2 bits (160), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 10/108 (9%)

Query: 1   MPLNNVRRPDLVATYNHTPAPKXXXXXXXXXXXXXXXXXPMAAMFMKNKFLAWFAVLTTW 60
           M LNNV RPDL  +Y     PK                 PMAA+F++NKF+AWF+++ + 
Sbjct: 1   MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV 60

Query: 61  HVFLTSQPD----------PSNPTDSPFMKIGMAVLAVGMNYLGLFFP 98
           H +L +  D          PS     P +K+ M+++ + + Y+ L FP
Sbjct: 61  HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFP 108

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.133    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,545,600
Number of extensions: 113427
Number of successful extensions: 219
Number of sequences better than 10.0: 6
Number of HSP's gapped: 213
Number of HSP's successfully gapped: 6
Length of query: 120
Length of database: 16,596,109
Length adjustment: 88
Effective length of query: 32
Effective length of database: 13,549,725
Effective search space: 433591200
Effective search space used: 433591200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)