Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08371g26826412421e-175
Sklu_1578.326826411251e-157
Kwal_26.916026726411071e-154
YMR226C2672649881e-136
CAGL0M11242g2682649881e-136
Scas_594.122672649811e-135
AFR561W2672628491e-115
KLLA0E09834g2681932311e-22
Kwal_14.24442881981883e-16
AER373C3002001742e-14
Sklu_268.12442381713e-14
Kwal_14.15112772101714e-14
CAGL0G08690g2941881662e-13
KLLA0D15521g2561471634e-13
Scas_662.43072011558e-12
KLLA0F04455g3051981522e-11
AGL060W8912081533e-11
YIL124W (AYR1)2971341479e-11
Sklu_2348.52892031451e-10
Kwal_23.31072482161432e-10
CAGL0F06919g2501921371e-09
ABR247W2501921362e-09
Scas_628.62521331327e-09
ABR249W2501961282e-08
ABR248W2612361264e-08
YIR036C2631971264e-08
KLLA0E13860g8891081276e-08
KLLA0D02596g3471371258e-08
Kwal_34.160242921741249e-08
Scas_685.82521331231e-07
Scas_478.29201171232e-07
YNL202W (SPS19)2951871212e-07
Kwal_26.79508971961171e-06
CAGL0H08063g2901831151e-06
CAGL0L02167g9011061152e-06
ABL163W2921971123e-06
KLLA0E24046g2802031123e-06
Kwal_55.195692882361106e-06
Kwal_47.171022852041097e-06
ABR076C2711131089e-06
Sklu_1570.17562001091e-05
Sklu_2267.53501871071e-05
Scas_613.182861361071e-05
YKR009C (FOX2)9001191082e-05
CAGL0J04774g3382061062e-05
YIR035C2541331052e-05
YKL055C (OAR1)2781201034e-05
Kwal_23.45723001721025e-05
Sklu_2380.4160164995e-05
Scas_641.312871861026e-05
AER111W3271411026e-05
CAGL0F06897g2581331017e-05
YLR426W3262041017e-05
ABR246W250196991e-04
ADR059C351118992e-04
Scas_721.47344186982e-04
KLLA0B09812g346120972e-04
ADL292C329119973e-04
YKL071W256213945e-04
Kwal_55.21822283227920.001
KLLA0C12694g259117910.001
Sklu_2219.3363118920.001
KLLA0D18909g290145910.001
CAGL0H10450g311151910.001
Scas_655.19297189890.003
AAL089W328195860.007
Kwal_26.8282298117850.007
Sklu_1624.331687840.010
KLLA0E08063g18688820.014
Sklu_2404.13301115820.018
Scas_675.10312259820.021
CAGL0M13013g270123810.022
Kwal_26.883832399790.041
YDL114W308199790.048
YBR265W (TSC10)320191780.057
Scas_650.832687750.13
KLLA0D06127g330224730.27
Kwal_27.1215528099680.90
Scas_652.19d1344137681.2
CAGL0H07513g352142671.5
KLLA0A11352g314167633.9
Sklu_2249.2108335644.0
Scas_652.19d341141625.6
Sklu_2420.532696626.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08371g
         (264 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...   483   e-175
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                           437   e-157
Kwal_26.9160                                                          431   e-154
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...   385   e-136
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...   385   e-136
Scas_594.12                                                           382   e-135
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...   331   e-115
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    94   1e-22
Kwal_14.2444                                                           77   3e-16
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    72   2e-14
Sklu_268.1 , Contig c268 57-791 reverse complement                     70   3e-14
Kwal_14.1511                                                           70   4e-14
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    69   2e-13
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    67   4e-13
Scas_662.4                                                             64   8e-12
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    63   2e-11
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    64   3e-11
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    61   9e-11
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       60   1e-10
Kwal_23.3107                                                           60   2e-10
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...    57   1e-09
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    57   2e-09
Scas_628.6                                                             55   7e-09
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    54   2e-08
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    53   4e-08
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...    53   4e-08
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    54   6e-08
KLLA0D02596g join(complement(219682..219797),complement(218659.....    53   8e-08
Kwal_34.16024                                                          52   9e-08
Scas_685.8                                                             52   1e-07
Scas_478.2                                                             52   2e-07
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    51   2e-07
Kwal_26.7950                                                           50   1e-06
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    49   1e-06
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    49   2e-06
ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH] complement(...    48   3e-06
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    48   3e-06
Kwal_55.19569                                                          47   6e-06
Kwal_47.17102                                                          47   7e-06
ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH] (527756..528...    46   9e-06
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             47   1e-05
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            46   1e-05
Scas_613.18                                                            46   1e-05
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    46   2e-05
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    45   2e-05
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...    45   2e-05
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    44   4e-05
Kwal_23.4572                                                           44   5e-05
Sklu_2380.4 YIR035C, Contig c2380 9858-10340                           43   5e-05
Scas_641.31                                                            44   6e-05
AER111W [2616] [Homologous to ScYLR426W - SH] complement(846805....    44   6e-05
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...    44   7e-05
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    44   7e-05
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...    43   1e-04
ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998) [...    43   2e-04
Scas_721.47                                                            42   2e-04
KLLA0B09812g complement(856799..857839) similar to sp|P38286 Sac...    42   2e-04
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    42   3e-04
YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with sim...    41   5e-04
Kwal_55.21822                                                          40   0.001
KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces...    40   0.001
Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement         40   0.001
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    40   0.001
CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530 S...    40   0.001
Scas_655.19                                                            39   0.003
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    38   0.007
Kwal_26.8282                                                           37   0.007
Sklu_1624.3 YBR265W, Contig c1624 1338-2288                            37   0.010
KLLA0E08063g complement(726232..726792) some similarities with s...    36   0.014
Sklu_2404.13 YKL055C, Contig c2404 24100-25005                         36   0.018
Scas_675.10                                                            36   0.021
CAGL0M13013g complement(1281291..1282103) similar to sp|P35731 S...    36   0.022
Kwal_26.8838                                                           35   0.041
YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the shor...    35   0.048
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    35   0.057
Scas_650.8                                                             33   0.13 
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    33   0.27 
Kwal_27.12155                                                          31   0.90 
Scas_652.19d1                                                          31   1.2  
CAGL0H07513g 734835..735893 highly similar to sp|P38286 Saccharo...    30   1.5  
KLLA0A11352g complement(983428..984372) similar to sp|P50167 Pic...    29   3.9  
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement          29   4.0  
Scas_652.19d                                                           28   5.6  
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        28   6.5  

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score =  483 bits (1242), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 242/264 (91%), Positives = 242/264 (91%)

Query: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXX 60
           MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNV                   
Sbjct: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKI 60

Query: 61  XXXYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120
              YPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI
Sbjct: 61  NAEYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180
           KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ
Sbjct: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180

Query: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240
           SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT
Sbjct: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240

Query: 241 SRKPNTVIADVLVFASNQASPYHI 264
           SRKPNTVIADVLVFASNQASPYHI
Sbjct: 241 SRKPNTVIADVLVFASNQASPYHI 264

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score =  437 bits (1125), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/264 (81%), Positives = 231/264 (87%)

Query: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXX 60
           MSQGR+AAERL NKT+FITGASAGIGQATALEY DA+NG +                   
Sbjct: 1   MSQGRRAAERLANKTVFITGASAGIGQATALEYCDASNGKINLVLSARRLEKLQELKDKI 60

Query: 61  XXXYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120
              YP+AKVYIG LDVTETEKI+PF+D LPEEFKDIDILINNAGKALGSD VGTI +EDI
Sbjct: 61  TKEYPEAKVYIGVLDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDI 120

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180
           +GMI+TNV+ALIN+TQAVLPIFKAKN GDIVNLGSVAGRDAYPTG+IYCASKHAVRAFTQ
Sbjct: 121 EGMINTNVLALINITQAVLPIFKAKNFGDIVNLGSVAGRDAYPTGAIYCASKHAVRAFTQ 180

Query: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240
           SLRKEL+NT IRVIEIAPGNVETEFSLVRYKGD DRAK+VY+GT PLYADDIADLIVYAT
Sbjct: 181 SLRKELVNTNIRVIEIAPGNVETEFSLVRYKGDTDRAKKVYEGTNPLYADDIADLIVYAT 240

Query: 241 SRKPNTVIADVLVFASNQASPYHI 264
           SRKPNTVIADVLVFASNQASPYHI
Sbjct: 241 SRKPNTVIADVLVFASNQASPYHI 264

>Kwal_26.9160
          Length = 267

 Score =  431 bits (1107), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 212/264 (80%), Positives = 231/264 (87%)

Query: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXX 60
           MSQGRKA+ERL  KT+ ITGASAGIGQATALEYLDA+NGN+                   
Sbjct: 1   MSQGRKASERLAGKTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQF 60

Query: 61  XXXYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120
              +P+AKVYIGQLDVT T++I+PFIDNLPEEFKDIDILINNAGKALGSD VGTI + DI
Sbjct: 61  EKDFPEAKVYIGQLDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDI 120

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180
           +GMI TNVVALIN+TQAVLPIFKAKN+GDIVNLGSVAGR+AYPTGSIYCA+KHAVRAFTQ
Sbjct: 121 EGMIQTNVVALINMTQAVLPIFKAKNAGDIVNLGSVAGREAYPTGSIYCATKHAVRAFTQ 180

Query: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240
           SLRKELINT IRVIEIAPGNVETEFSLVRYKGD ++AK+VY+GTTPLYADDIADLIVYAT
Sbjct: 181 SLRKELINTNIRVIEIAPGNVETEFSLVRYKGDPEKAKKVYEGTTPLYADDIADLIVYAT 240

Query: 241 SRKPNTVIADVLVFASNQASPYHI 264
           SRK NTVIADVLVFASNQASPYHI
Sbjct: 241 SRKSNTVIADVLVFASNQASPYHI 264

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score =  385 bits (988), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 188/264 (71%), Positives = 218/264 (82%)

Query: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXX 60
           MSQGRKAAERL  KT+ ITGASAGIG+ATALEYL+A+NG++                   
Sbjct: 1   MSQGRKAAERLAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTI 60

Query: 61  XXXYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120
              +P AKV++ QLD+T+ EKI+PFI+NLP+EFKDIDIL+NNAGKALGSD VG I++EDI
Sbjct: 61  DQEFPNAKVHVAQLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDI 120

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180
           + + DTNV ALIN+TQAVLPIF+AKNSGDIVNLGS+AGRDAYPTGSIYCASK AV AFT 
Sbjct: 121 QDVFDTNVTALINITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTD 180

Query: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240
           SLRKELINT IRVI IAPG VETEFSLVRY+G+ ++AK VYK TTPL ADD+ADLIVYAT
Sbjct: 181 SLRKELINTKIRVILIAPGLVETEFSLVRYRGNEEQAKNVYKDTTPLMADDVADLIVYAT 240

Query: 241 SRKPNTVIADVLVFASNQASPYHI 264
           SRK NTVIAD L+F +NQASP+HI
Sbjct: 241 SRKQNTVIADTLIFPTNQASPHHI 264

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score =  385 bits (988), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/264 (71%), Positives = 217/264 (82%)

Query: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXX 60
           MSQGRKAAERLQ K  FITGASAGIG+ATA+EYLDA+NG+V                   
Sbjct: 1   MSQGRKAAERLQGKIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKEL 60

Query: 61  XXXYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120
              YP AK++IG+LDVT+ E ++ F+ +LPEEFKDIDILINNAGKALGSD VG I  EDI
Sbjct: 61  LAQYPDAKIHIGKLDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDI 120

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180
            GM++TNV+ALIN+TQ +LP+FK KNSGDIVNLGS+AGRDAYPTG+IYCA+KHAVRAFTQ
Sbjct: 121 AGMVNTNVLALINLTQLLLPLFKKKNSGDIVNLGSIAGRDAYPTGAIYCATKHAVRAFTQ 180

Query: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240
           SLRKELINT IRVIEIAPG VETEFS+VRYKGD  +A  VY+GTTPLYADDIADLIVY+T
Sbjct: 181 SLRKELINTDIRVIEIAPGMVETEFSVVRYKGDKSKADDVYRGTTPLYADDIADLIVYST 240

Query: 241 SRKPNTVIADVLVFASNQASPYHI 264
           SRKPN V+ADVLVF ++QAS  HI
Sbjct: 241 SRKPNMVVADVLVFPTHQASASHI 264

>Scas_594.12
          Length = 267

 Score =  382 bits (981), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 190/264 (71%), Positives = 212/264 (80%)

Query: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXX 60
           MSQG KAAERL  K +FITGASAGIGQATALEY+DA+NG V                   
Sbjct: 1   MSQGPKAAERLNEKIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVI 60

Query: 61  XXXYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120
              YP++KVYIG+LDVTE E IQPF+DNLPEEFKDIDILINNAGKALGSD VG I  +D+
Sbjct: 61  EAKYPKSKVYIGKLDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDV 120

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180
           KGM+DTNV+ LINVTQAVL IF+ KNSGDIVNLGSVAGRDAYPTGSIYCASK AVRAFT+
Sbjct: 121 KGMMDTNVLGLINVTQAVLHIFQKKNSGDIVNLGSVAGRDAYPTGSIYCASKFAVRAFTE 180

Query: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240
           SLR+ELINT IRVI IAPG VETEFS+VRYKGD +RAK VY G  PL ADD+ADLIVY T
Sbjct: 181 SLRRELINTKIRVILIAPGIVETEFSVVRYKGDNERAKSVYDGVHPLEADDVADLIVYTT 240

Query: 241 SRKPNTVIADVLVFASNQASPYHI 264
           SRK NTVIAD L+F ++Q S +H+
Sbjct: 241 SRKQNTVIADTLIFPTSQGSAFHV 264

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score =  331 bits (849), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 157/262 (59%), Positives = 205/262 (78%)

Query: 1   MSQGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXX 60
           MS GRKAAERL NK + +TGASAGIG+ATA+ Y DA +G +                   
Sbjct: 1   MSLGRKAAERLANKIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEI 60

Query: 61  XXXYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI 120
              YP AK+++GQLDVT+ ++I+PF++ LPEEF+DIDILINNAGKALG++ VG IS +DI
Sbjct: 61  ESKYPNAKIHVGQLDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDI 120

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180
           + + +TNV+ L+++TQ VLPI KAKNSGDIVN+GS+AGR+AYP GSIYCA+KHAV+AFT+
Sbjct: 121 QEVFNTNVIGLVHLTQEVLPIMKAKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTR 180

Query: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYAT 240
           ++RKELI+T IRV EIAPG+VETEFS+VR +G+ + AK+VY+G  PL  DDIAD IVYAT
Sbjct: 181 AMRKELISTKIRVFEIAPGSVETEFSMVRMRGNEENAKKVYQGFEPLDGDDIADTIVYAT 240

Query: 241 SRKPNTVIADVLVFASNQASPY 262
           SR+ NTV+A+++V+ S Q S Y
Sbjct: 241 SRRSNTVVAEMVVYPSAQGSLY 262

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 93.6 bits (231), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 99/193 (51%), Gaps = 13/193 (6%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
           ++ + I ITGAS GIG + A E L +A   V                        +    
Sbjct: 1   MKKQVILITGASTGIGLSIA-ETLRSAGYEVFGTSRKGSIPGK------------EYSFK 47

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130
           + +LD+T+ E ++  ++ + E+   ID+L+NNAG A     V   S++  K + +TN   
Sbjct: 48  MIKLDITDEESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFG 107

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190
           +  +T+AVLP  + +  G I+N+ S+ G    P G++YC+SKHA+  +T+SL  E+   G
Sbjct: 108 VHRMTRAVLPHMREQRHGKIINISSMGGIMPIPYGALYCSSKHALEGYTESLDYEVKKFG 167

Query: 191 IRVIEIAPGNVET 203
           I V  I P  ++T
Sbjct: 168 IHVSTIDPHIIKT 180

>Kwal_14.2444
          Length = 288

 Score = 77.0 bits (188), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 97/198 (48%), Gaps = 18/198 (9%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQ 73
           K   +TGAS+GIG     +   A+ G                        +P+  V + +
Sbjct: 5   KVAVVTGASSGIGYELTRQL--ASKG-----YKVYAAARREQRLETLAKEFPELVVPV-K 56

Query: 74  LDVTETEKIQPFIDNLPEEF--KDIDILINNAGKAL---GSDVVGTISSEDIKGMIDTNV 128
           LDV+E E+I    + L +E   + +D+L NNAG++     SDV   +  +  K     NV
Sbjct: 57  LDVSEPEQIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTNDVLEQAFK----VNV 112

Query: 129 VALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELIN 188
              +N+ + +LP F  K  G ++  GSVAG   +P GSIY A+K A+ ++ + L  E+  
Sbjct: 113 FGPVNLCKELLP-FVIKAKGTVLFTGSVAGLMPFPFGSIYSATKGAIHSYARCLHTEMKP 171

Query: 189 TGIRVIEIAPGNVETEFS 206
            G+RV+ +  G V+T+ +
Sbjct: 172 FGVRVLNVVTGGVKTDIA 189

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 71.6 bits (174), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 91/200 (45%), Gaps = 11/200 (5%)

Query: 12  QNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYI 71
           + K + +TGAS+GIG     E   A  G V                       P+ KV  
Sbjct: 13  EAKVVLVTGASSGIGYELTKEL--ANRGYVVYAAARSIEPIEALRDKCG----PE-KVIP 65

Query: 72  GQLDVTETEKIQPFIDNLPEEFK--DIDILINNAGKALGSDVVGTISSEDIKGMIDTNVV 129
            QLDVT+ E++      + +E     +  L NNAG++     V  ++ E I+     NV 
Sbjct: 66  VQLDVTDEEQVTKLRRRMSKEIPGGKLHALFNNAGQSCTMPAV-DVTPEMIEKCFRVNVF 124

Query: 130 ALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINT 189
           A +N+T+   P+   +  G IV  GS+AG   +P GS+Y A+K AV  + + L  EL   
Sbjct: 125 APMNITREFAPLL-IRAHGTIVFTGSLAGIIPFPFGSVYSATKAAVHQYARVLHLELKPF 183

Query: 190 GIRVIEIAPGNVETEFSLVR 209
           G+RVI    G V T  +  R
Sbjct: 184 GVRVINAVTGGVATNIADTR 203

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 70.5 bits (171), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 109/238 (45%), Gaps = 18/238 (7%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXX--XXXXXXYPQAK 68
           L N+ + +TGA++GIG+A   + L      +                        YP   
Sbjct: 2   LSNRKVIVTGAASGIGKAIVNQCLQEGASVIACDLNEQALLVLKESLNDSTVLDTYP--- 58

Query: 69  VYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNV 128
                +DV + E++  F   +  E  D+D L+NNAG  L   ++     ++I  ++D NV
Sbjct: 59  -----MDVRKYEEVAAFFAYVETEHSDVDGLVNNAGIYLAKHIL-DYQEDEIDKVLDINV 112

Query: 129 VALINVTQAV-LPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELI 187
              I  +Q     +F ++  G IVNL SV+G++   + +IY +SK A+   T+S      
Sbjct: 113 KGYIYFSQMFGKKLFHSQRKGVIVNLSSVSGQEG-SSDAIYGSSKAAILGLTKSCAMNF- 170

Query: 188 NTGIRVIEIAPGNVETEF--SLVRYKGDADRAKQVYKGTTPLYADDIADLIVYATSRK 243
           +  IRV  +AP  V T    S+  ++     + Q+    TP+  +D+AD +V+  S K
Sbjct: 171 SPYIRVNAVAPTMVNTSMMDSIPEWRKKEYLSHQLID--TPVLPEDVADTVVFLLSDK 226

>Kwal_14.1511
          Length = 277

 Score = 70.5 bits (171), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 97/210 (46%), Gaps = 24/210 (11%)

Query: 14  KTIFITGASAGIGQATALEYLDAANG---NVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
           KTI ITGA+ GIG+A A++   A  G    +                        +A ++
Sbjct: 3   KTILITGAAQGIGKAIAVDL--ARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIF 60

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130
           +  +DV+  E +   +D +   F   D++INNAG A+ + ++   + E++  ++  NV  
Sbjct: 61  L-PIDVSNKESVFGVVDKVASHFGAFDVMINNAGIAMVAKIL-EATPEELDRIMKINVGG 118

Query: 131 LINVTQAVLPIF-----------------KAKNSGDIVNLGSVAGRDAYPTGSIYCASKH 173
           ++  TQA    F                   K +G I+N  S+AG +A  +  +YC+SK 
Sbjct: 119 VLYGTQAATRKFVELNRAGDYTPATVKTASKKLTGKIINCCSIAGNEAIGSLGLYCSSKF 178

Query: 174 AVRAFTQSLRKELINTGIRVIEIAPGNVET 203
           AV+  TQ+  KEL   GI V   APG V T
Sbjct: 179 AVKCLTQASAKELAPLGITVNAYAPGIVLT 208

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 93/188 (49%), Gaps = 18/188 (9%)

Query: 73  QLDVTETEKIQPFIDNLPEEFKD--IDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130
            LD++E +++  F + L  E  +  +DIL NNAG++     +  +S++ ++     NV  
Sbjct: 60  HLDISELDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPALD-VSNDVMEQCFKVNVFG 118

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190
            IN+T+  L  +     G ++  GS+AG    P GSIY A+K A+  + ++L  EL   G
Sbjct: 119 HINMTRE-LAQYLINAKGTVIFTGSIAGFSTLPFGSIYAATKAAIHEYARTLHLELKPFG 177

Query: 191 IRVIEIAPGNVETEFSLVR-------YKG----DADRAKQVY-KGTTPLYADDIADLIV- 237
           +RVI    G V T+ +  R       YK     DA R +Q   K   P+ AD  A  +V 
Sbjct: 178 VRVINAITGGVLTDIADKRDLPEGSIYKFPQGIDAFRTRQTMAKDNHPMPADVYAKKVVE 237

Query: 238 -YATSRKP 244
              +SR P
Sbjct: 238 DLLSSRDP 245

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 67.4 bits (163), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 74/147 (50%), Gaps = 10/147 (6%)

Query: 65  PQAKVYIG-QLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDI--- 120
           P     IG ++DVT  + ++  I  + EEF  +  L+NNAG   G    G I   DI   
Sbjct: 54  PSGSRVIGKEVDVTVAKAVEDLIQEIREEFGALHYLVNNAG-ITGPHQTG-IEDYDIDSW 111

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGD----IVNLGSVAGRDAYPTGSIYCASKHAVR 176
           + +IDTN+       +  LP+ ++ +S D    +VNL +V G    P  S Y A+KHAV 
Sbjct: 112 RQVIDTNINGTFYTLKYALPLMESSSSPDSEAAVVNLSAVNGLVGIPGISPYTATKHAVI 171

Query: 177 AFTQSLRKELINTGIRVIEIAPGNVET 203
             TQS+  E     +RV  +APG V T
Sbjct: 172 GITQSVALEYAERNVRVNAVAPGYVST 198

>Scas_662.4
          Length = 307

 Score = 64.3 bits (155), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 95/201 (47%), Gaps = 9/201 (4%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXX---XXXXXXXXXXXXXXYPQAKVY 70
           KT  +TGAS+GIG     E   A NG +                           +A + 
Sbjct: 10  KTAIVTGASSGIGYEITKEL--ARNGFIVYACARRLGPIDDLINDLAPELTTELAKAVIK 67

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKD--IDILINNAGKALGSDVVGTISSEDIKGMIDTNV 128
             QLD+++ ++++ F   L +E  +  +D+L NNAG++     +  ++++ ++     NV
Sbjct: 68  PYQLDISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPALD-VTNDVMEQCFKVNV 126

Query: 129 VALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELIN 188
              +N+ +  L  +  +  G IV  GS+AG   +P GSIY A+K A+  + + L  E+  
Sbjct: 127 FGHVNMCRE-LASYLIQARGTIVFTGSLAGITPFPFGSIYSATKAAIHEYARVLHLEMKP 185

Query: 189 TGIRVIEIAPGNVETEFSLVR 209
            G+RVI +  G V T  +  R
Sbjct: 186 FGVRVINVVTGGVATNIADTR 206

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 84/198 (42%), Gaps = 14/198 (7%)

Query: 12  QNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYI 71
           + K   +TGAS+GIG     E L    G                         P+     
Sbjct: 3   ETKYALVTGASSGIGYEVTKELL--RRGWYVYACARRTHPMEELRAEFGDRCIPR----- 55

Query: 72  GQLDVTETEKIQPFIDNLPEEFKD--IDILINNAGKALGSDVVGTISSEDIKGMIDTNVV 129
            +LDV+    I      L +E  D  + +L NNAG++     +  +S E I      NV 
Sbjct: 56  -KLDVSNQNDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAI-DVSEEIIDNTFRVNVY 113

Query: 130 ALINVTQAVLP-IFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELIN 188
             IN  +   P I  AK  G IV  GS+AG   +P G++Y ASK A+  + + L  EL  
Sbjct: 114 GPINSCREFAPLIINAK--GTIVFTGSLAGICPFPFGAVYSASKAAIHQYARVLHGELGP 171

Query: 189 TGIRVIEIAPGNVETEFS 206
            G+RVI +  G V T+ +
Sbjct: 172 LGVRVINMITGGVATDIA 189

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 97/208 (46%), Gaps = 32/208 (15%)

Query: 3   QGRKAAERLQNKTIFITGASAGIGQATALEY-----------LDAANGNVXXXXXXXXXX 51
           QG    + L++K + ITGA AG+G++ AL +           L  A+G V          
Sbjct: 309 QGSVQVKSLKDKVVIITGAGAGLGRSHALWFAKYGARVVVNDLKGADGVVAEINSQ---- 364

Query: 52  XXXXXXXXXXXXYPQAKVYIGQLD-VTETEKIQPFIDNLPEEFKDIDILINNAGKALGSD 110
                       Y + +      + VT+   +   ++   + F+ +D+L+NNAG      
Sbjct: 365 ------------YGEGRAVADSHNIVTDAAAV---VETAMKAFERVDVLVNNAGILRDRS 409

Query: 111 VVGTISSEDIKGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCA 170
            V  ++ ++   ++  +++++  +++AV PIF  + SG IVN  S +G       + Y A
Sbjct: 410 FV-KMTDDEWNSVLQVHLLSVFALSKAVWPIFMQQRSGVIVNTTSTSGIYGNFGQANYSA 468

Query: 171 SKHAVRAFTQSLRKELINTGIRVIEIAP 198
           +K AV  F++SL  E    GIRV  IAP
Sbjct: 469 AKAAVLGFSKSLAIEGAKRGIRVYVIAP 496

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 4/123 (3%)

Query: 76  VTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVT 135
           VT+ +KI   +    + F  +D+++NNAG  L       ++ ++   ++D ++     + 
Sbjct: 74  VTDGDKI---VKTAIDAFGRVDVIVNNAG-ILRDGSFAKMTEKNFSAVVDVHLNGSYKLC 129

Query: 136 QAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIE 195
           +A  P  + +  G IVN  S AG       + Y A+K  +   +++L KE     I+V  
Sbjct: 130 KAAWPYMRQQKYGRIVNTASPAGLYGNFGQTNYSAAKLGLVGLSETLAKEGHKYNIKVNV 189

Query: 196 IAP 198
           IAP
Sbjct: 190 IAP 192

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 61.2 bits (147), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 68/134 (50%), Gaps = 4/134 (2%)

Query: 73  QLDVTETEKIQPFIDNLPEEFKD--IDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130
           +LD+++ E+I  F   L     D  +D+L NNAG++     +    +  ++     NV  
Sbjct: 62  KLDISKPEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAA-VEQCFKVNVFG 120

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190
            IN+ +  L  F  K  G IV  GS+AG  ++P GSIY ASK A+  + + L  E+    
Sbjct: 121 HINMCRE-LSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFN 179

Query: 191 IRVIEIAPGNVETE 204
           +RVI    G V T+
Sbjct: 180 VRVINAITGGVATD 193

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 93/203 (45%), Gaps = 16/203 (7%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
           L+ K   +TGAS+GIG    +  L A+ G                        +P+ KV 
Sbjct: 2   LEKKVALVTGASSGIGYE--ITKLLASKG-----YTVYAAARRTTPIKPLEEEFPE-KVI 53

Query: 71  IGQLDVTETEKIQP----FIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDT 126
              LDV++ ++IQ     F  +LP+    + IL NNAG++     V  + ++ I+     
Sbjct: 54  AVSLDVSDLQQIQDLKARFSRDLPDS--KLHILYNNAGQSCTFPAVD-VGNDKIEQCFKV 110

Query: 127 NVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKEL 186
           NV   +N+ +  +  F     G IV  GS+AG   +P GSIY ++K A+  + + L  E+
Sbjct: 111 NVFGPMNLCRE-MSDFVINARGTIVFTGSLAGIVPFPFGSIYSSTKAAIHQYARVLHVEM 169

Query: 187 INTGIRVIEIAPGNVETEFSLVR 209
              G++VI    G V T  +  R
Sbjct: 170 KPFGVKVINAITGGVATNIADTR 192

>Kwal_23.3107
          Length = 248

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 92/216 (42%), Gaps = 10/216 (4%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
           L+ K   ITG +  +G+ TA+E       N+                        + ++Y
Sbjct: 3   LEGKVALITGGTKNLGRLTAIELASRHKANLFLHYNSTQGDEKKLADELSSKYNVKVELY 62

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGM-IDTNVV 129
            G L     + ++   +    +F  IDI INN GK L   +V  ++ E+   M +  N +
Sbjct: 63  QGNLG--SAKNVEKLFEAAKAKFGSIDIAINNVGKVLKKPMV-EVTEEEFDEMDLVNNKI 119

Query: 130 ALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINT 189
           A   + QA   +    + G I++L +       P  ++Y  +K AV  +T+S  KELI  
Sbjct: 120 AFFFIAQATKHV---SSGGSIISLVTSLLAAYTPFYAVYQGTKSAVEFYTKSASKELIEK 176

Query: 190 GIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTT 225
            + V  IAPG ++T F    Y  +   A + YK  +
Sbjct: 177 RVSVNCIAPGPMDTPF---FYAQEQPEAVEFYKSVS 209

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 85/192 (44%), Gaps = 9/192 (4%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQ 73
           K + +TGAS GIG+A     L A + N                       +     Y+  
Sbjct: 3   KVVLVTGASRGIGEAIVKNIL-ALDSNAVVYGIARNEDALKSLKDTVGARFQ----YLAG 57

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133
            D+T+ +KI   ++ +  E   ID ++ NAG       VG+ S  + K + D N  ++I+
Sbjct: 58  -DITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIH 116

Query: 134 VTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRV 193
           +    LP  + K+ G+ + + S A    Y     Y +SK AV   T SL  E  N  I+ 
Sbjct: 117 LINKTLPHLE-KSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHLTMSLAAE--NKAIKT 173

Query: 194 IEIAPGNVETEF 205
           I +APG V+T+ 
Sbjct: 174 IAVAPGVVDTKM 185

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 88/192 (45%), Gaps = 11/192 (5%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQ 73
           + + +TGAS GIG+AT  +    A+  V                      Y      +G 
Sbjct: 2   RVVIVTGASRGIGEATVEKLCPTADVVVVGVARAETKLQKLKARHGKKFDY-----VVG- 55

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133
            DVT+   +Q  ID +  E+  +D ++ NAG +   + + T   ++ + + + N+ +++N
Sbjct: 56  -DVTDERVVQAVIDKVSSEYGRLDAVVANAGVSR-HERIATADIKEWRRLFEINLFSVVN 113

Query: 134 VTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRV 193
           +    LP+ + ++ G ++ + S   +  +P  + Y +SK A+  F   L  E     IR 
Sbjct: 114 LVSKALPLLR-ESQGTVIVVSSGLSQMGHPALAAYASSKIALNHFALILAME--EPEIRT 170

Query: 194 IEIAPGNVETEF 205
           I + PG V+T+ 
Sbjct: 171 IALDPGAVQTDM 182

>Scas_628.6
          Length = 252

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 66/133 (49%), Gaps = 3/133 (2%)

Query: 75  DVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINV 134
           DVT    ++  I    ++F  +D ++ NAG       VG +  E  K + D N  +++++
Sbjct: 59  DVTNKSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSL 118

Query: 135 TQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVI 194
            Q+ LP  +  N  + V + S A   AY   + Y ASK A+ +F  S+  E     ++ I
Sbjct: 119 VQSTLPFMENTNR-NYVFVSSGASVKAYFGWAAYSASKAALNSFAMSVANE--KPKVKTI 175

Query: 195 EIAPGNVETEFSL 207
            +APG V+T+  +
Sbjct: 176 SVAPGVVDTQMQV 188

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 85/196 (43%), Gaps = 17/196 (8%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQ 73
           K I +TGAS GIG AT        +  V                      Y      +G 
Sbjct: 2   KVIIVTGASRGIGAATVDRLCSTPDVVVVGVARAETKLQELKARHGKKFDY-----VVG- 55

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIK---GMIDTNVVA 130
            DVT+   +Q  ID +  E+  +D ++ NAG +        I+  DIK    + + N+ +
Sbjct: 56  -DVTDERVVQAVIDKVSSEYGRLDAVVANAGVSYQQ----RIAEADIKEWRRLFEINLFS 110

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190
           ++N+    LP+ + K+ G  + + S   +  +P  + Y +SK A+  F   L  E   T 
Sbjct: 111 VVNLASKALPLLR-KSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAME--ETE 167

Query: 191 IRVIEIAPGNVETEFS 206
           IR + + PG V+T+ +
Sbjct: 168 IRSLALDPGLVQTDMT 183

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 100/236 (42%), Gaps = 16/236 (6%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQ 73
           K I +TGAS GIG AT           V                      Y      +G 
Sbjct: 13  KVIIVTGASRGIGAATVDRLCSTPEVVVVGVARAETKLQELKARHGKKFDY-----VVG- 66

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133
            DVT+   +Q  ID +   +  +D ++ NAG A G + +     ++ + + + N+ +++N
Sbjct: 67  -DVTDERVVQAVIDKVSSGYGRLDAVVANAGVA-GHERIEDADIKEWRRLFEINLFSVVN 124

Query: 134 VTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRV 193
           +    LP+ + K+ G  + + S+  +   P  + Y +SK A+  F   L  E     IR 
Sbjct: 125 LASKALPLLR-KSQGAFLVVSSMLSQMGVPAVATYASSKIALNHFAMILAME--EPEIRT 181

Query: 194 IEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYATSRKPNTVIA 249
           I + PG  +T+  L      AD+A     GT    A ++   +  A+  +P TV+A
Sbjct: 182 IALDPGVAQTDM-LTDGLNAADQA----AGTQDNAAREMMRHVRVASPDEPGTVLA 232

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 85/197 (43%), Gaps = 10/197 (5%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQ 73
           K I ITGAS GIG       ++  +  +                      Y   K     
Sbjct: 3   KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQRE-----YGADKFVYRV 57

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSE-DIKG---MIDTNVV 129
           LD+T+  +++  ++ + ++   +D ++ NAG       +   +SE DIK    + D N  
Sbjct: 58  LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFF 117

Query: 130 ALINVTQAVLPIFKAKN-SGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELIN 188
           +++++    LP+ K+    G+IV + S A    Y   S Y  SK A+  F   +  E  +
Sbjct: 118 SIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPS 177

Query: 189 TGIRVIEIAPGNVETEF 205
             +R + IAPG V+T+ 
Sbjct: 178 DKVRAVCIAPGVVDTQM 194

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 91  EEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQAVLPIFKAKNSGDI 150
           ++F  +DIL+NNAG  L       ++ ++   +I+ ++ +   +++AV PIF  + SG I
Sbjct: 384 DKFGRVDILVNNAG-ILRDRSFAKMTEDEWNAVINVHLFSTFALSKAVWPIFLKQKSGYI 442

Query: 151 VNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAP 198
           +N  S +G         Y A+K A+  F+++L  E    GI V  IAP
Sbjct: 443 INTTSTSGIYGNFGQCNYAAAKAAILGFSRTLALEGTKRGITVNVIAP 490

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 75/188 (39%), Gaps = 6/188 (3%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
            +++ + ITGA  G+G+  ALEY     G V                         A   
Sbjct: 5   FKDRVVIITGAGGGLGRVYALEYAKRG-GKVVVNDLGRSAADSVVQEIKKLGGEGDAVAN 63

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130
              +       ++  I N    F  +DILINNAG  L       +S +  + +ID ++  
Sbjct: 64  YDSVSDNGAAIVETAISN----FGRVDILINNAG-ILRDSSFAKMSEKQFQQVIDVHLNG 118

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190
              +T+A  P  + +  G I+N  S AG       + Y A+K  +  F +SL KE     
Sbjct: 119 AFKLTRAAWPHMRKQKFGRIINTCSPAGLYGNFGQANYSAAKLGLLGFGESLAKEGYKYN 178

Query: 191 IRVIEIAP 198
           I V  IAP
Sbjct: 179 INVNSIAP 186

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 68/137 (49%), Gaps = 4/137 (2%)

Query: 73  QLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALI 132
           + D++  E+++  I  +  +F  +D+LINNA        +  +   ++  +   NV++ I
Sbjct: 135 RCDLSSDEEVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLSTI 194

Query: 133 NVTQAVLPIFKAKNSG-DIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELIN--- 188
            + QA  P   A N    +VN+ S  G  +    S Y ASK A+ ++ +S   EL+N   
Sbjct: 195 RLIQAFHPKKSANNDFYYVVNIASALGIMSPARASTYAASKAALISYHESWTYELLNDNA 254

Query: 189 TGIRVIEIAPGNVETEF 205
             +R + + PG ++T+ 
Sbjct: 255 MNVRTLLVLPGQMDTQM 271

>Kwal_34.16024
          Length = 292

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 81/174 (46%), Gaps = 21/174 (12%)

Query: 66  QAKVYIGQLDVTETEKIQPFIDNLPEEF--KDIDILINNAGKAL--GSDVVGTISSEDIK 121
           +A+ Y  Q+D+T  E ++  I  + ++F  +DID  I NAG A   GS +  + + E  +
Sbjct: 88  EARAY--QVDITNDEDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWR 145

Query: 122 GMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDA----YPTGSIYCASKHAVRA 177
            ++D NV    +  Q V  +FK +  G ++   S++   A    Y T   Y ASK AVR 
Sbjct: 146 RVMDVNVQGTFHCAQEVAHVFKRQGHGCLILTASMSSHIANVPNYQT--CYNASKAAVRH 203

Query: 178 FTQSLRKELINTG-----IRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTP 226
             +    E  +       IR   ++PG  +T  S   +     RA+  + G TP
Sbjct: 204 MARGFAVEFAHLTEPAGRIRCNSVSPGYTDTILS--SFVPTEQRAQ--WWGLTP 253

>Scas_685.8
          Length = 252

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 3/133 (2%)

Query: 75  DVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINV 134
           D+T+   +Q  +D   +E   ID ++ NAG       V  I  +  K + D N  +++++
Sbjct: 58  DITDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSL 117

Query: 135 TQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVI 194
           T   LP  K K +G+IV + S A    + +   Y ASK  +  F  ++  E     ++ +
Sbjct: 118 TSITLPYLK-KTNGNIVFVSSDASDMHFSSWGAYSASKACLNRFAMTVANE--EPAVKCL 174

Query: 195 EIAPGNVETEFSL 207
            +APG V+T   +
Sbjct: 175 SVAPGIVDTSMQV 187

>Scas_478.2
          Length = 920

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (47%), Gaps = 5/117 (4%)

Query: 82  IQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQAVLPI 141
           I+  IDN    F  IDILINNAG  L       +S ++ + +ID ++     +T A  P 
Sbjct: 86  IKTAIDN----FGKIDILINNAG-ILRDVSFNKMSEKEFQAVIDVHLNGAFQLTHAAWPY 140

Query: 142 FKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAP 198
            KA+  G I+N  S AG       + Y A+K  +    ++L KE     I V  IAP
Sbjct: 141 MKAQKFGRIINTASPAGLFGNFGQANYSAAKLGLVGLAETLAKEGFKYNILVNSIAP 197

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 88/197 (44%), Gaps = 10/197 (5%)

Query: 3   QGRKAAERLQNKTIFITGASAGIGQATALEYLD-AANGNVXXXXXXXXXXXXXXXXXXXX 61
           QG    E ++ K + ITGA+ G+G++ A+ +    A   +                    
Sbjct: 315 QGSVKVESIKGKVVIITGANGGLGKSHAMWFAKYGAKVIINDITNPETTVNEINSKFGAD 374

Query: 62  XXYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIK 121
             +P +   I     TE+E +   +    + F  +DIL+NNAG  L       ++ ++  
Sbjct: 375 TAFPDSHNII-----TESELV---VKTAIDHFGHVDILVNNAG-ILRDKSFLKMTEKEWY 425

Query: 122 GMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQS 181
            ++  ++ A   + +AV P F  +NSG I+N  S +G       + Y A+K A+  F+++
Sbjct: 426 PVLQVHLQATFAMCKAVWPHFSKQNSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSRT 485

Query: 182 LRKELINTGIRVIEIAP 198
           +  E    GI V  IAP
Sbjct: 486 IAIEGAKKGIIVNIIAP 502

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 80/187 (42%), Gaps = 8/187 (4%)

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130
           I  +DV   E+++  +    E+F  ID +I  A      D    +S    K ++D +++ 
Sbjct: 84  IANVDVRNFEQVENAVKKTVEKFGKIDFVIAGAAGNFVCDFA-NLSPNAFKSVVDIDLLG 142

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190
             N  +A L   K K+ G I+ + +       P      A+K  + A  ++L  EL   G
Sbjct: 143 SFNTAKACLKELK-KSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLG 201

Query: 191 IRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLY----ADDIADLIVYATSRKPNT 246
           IR   IAPG ++    L R  G   + K + K   PL       DIA+  VY  S   + 
Sbjct: 202 IRSNCIAPGAIDNTEGLKRLAGKKYKEKALAK--IPLQRLGSTRDIAESTVYIFSPAASY 259

Query: 247 VIADVLV 253
           V   VLV
Sbjct: 260 VTGTVLV 266

>Kwal_26.7950
          Length = 897

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 86/196 (43%), Gaps = 8/196 (4%)

Query: 3   QGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXX 62
           QG+   E L+ K + ITGA AG+G++ AL +                             
Sbjct: 314 QGQTRIESLKGKVVIITGAGAGLGRSHALTF-----AKYGAKVVVNDIKDPHTVVSEIEK 368

Query: 63  XYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKG 122
            Y +      + DV +       + +  + F  +DIL+NNAG  L       +S E+ + 
Sbjct: 369 LYGRNSAVADKHDVVKDPG--EIVKSAFQTFGRVDILVNNAG-VLRDRSFAKMSDEEWEI 425

Query: 123 MIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSL 182
           ++  ++ +   + +AV PIF  + SG I+N  S +G       + Y A+K AV  F+++L
Sbjct: 426 VLKVHLFSTFGLCKAVWPIFVKQKSGYIINTTSTSGIYGNFGQANYAAAKAAVLGFSKTL 485

Query: 183 RKELINTGIRVIEIAP 198
             E     IRV  +AP
Sbjct: 486 ALEGSKHNIRVNIVAP 501

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 78/195 (40%), Gaps = 12/195 (6%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
            +++ + ITGA  G+G+  ALE+       V                          + Y
Sbjct: 8   FKDRVVVITGAGGGLGKVYALEFAKRGAKVVVNDLGGSLGGEGHNSRAADVVVSEIREKY 67

Query: 71  IGQL-----DVTETEK--IQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGM 123
             Q       VTE     +Q  +DN    F  +DI+INNAG  L       +S      +
Sbjct: 68  KTQAAANYDSVTENAAAIVQTAVDN----FGRVDIIINNAG-ILRDSSFANMSDSAFASV 122

Query: 124 IDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLR 183
           +D ++    N+T+A  P  K +  G IVN  S AG       + Y A+K  +  F+++L 
Sbjct: 123 VDVHLTGAYNLTRAAWPHMKNQKFGRIVNTCSPAGLYGNFGQANYSAAKMGLVGFSETLA 182

Query: 184 KELINTGIRVIEIAP 198
           +E     I V  I P
Sbjct: 183 QEGFKYNIYVNCIVP 197

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 12/183 (6%)

Query: 65  PQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMI 124
           P A + I ++DV E ++++  +    + +  ID +I  A      D    +S+   K ++
Sbjct: 73  PDAVLPISKVDVREVKQLESAVKRTVDRYGRIDYVIAGAAGNFICDF-NHLSANAFKSVV 131

Query: 125 DTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRK 184
             +++   N  +A +P    K+ G I+ + +       P  S   A+K  + A + +L  
Sbjct: 132 SIDLLGSFNTAKATMPEL-IKSRGSILFVSATFHYYGVPFQSHVGAAKAGIDALSNALAV 190

Query: 185 ELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYK------GTTPLYADDIADLIVY 238
           E+   G+R   IAPG ++      R  GDA + K   K      GTT    +DIA   VY
Sbjct: 191 EMGPFGVRSNCIAPGAIQGTEGFDRLIGDASKKKTTSKIPLQRLGTT----EDIAQATVY 246

Query: 239 ATS 241
             S
Sbjct: 247 LFS 249

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 1/106 (0%)

Query: 93  FKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQAVLPIFKAKNSGDIVN 152
           F  IDILINNAG  L       ++ ++   ++D ++     +T+A  P  + +  G I+N
Sbjct: 91  FGRIDILINNAG-ILRDVSFAKMTEKEFSAVLDVHLTGAYRLTKAAWPYMRQQKFGRIIN 149

Query: 153 LGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAP 198
             S AG       + Y A+K  +  F ++L KE     I V  IAP
Sbjct: 150 TASPAGLFGNFGQANYSAAKLGLVGFAETLAKEGYKYNINVNSIAP 195

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 87/197 (44%), Gaps = 10/197 (5%)

Query: 3   QGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXX 62
           QG      L++K + ITGA  G+G++ AL +                             
Sbjct: 313 QGSIKITSLKDKVVIITGAGGGLGKSHALWF-----AKYGARVVVNDIKDPNTVVNEINS 367

Query: 63  XYPQAKVYIGQLDV-TETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIK 121
            Y + +      +V TE  ++   I+   + +  +D+L+NNAG  L       ++ ++  
Sbjct: 368 KYGEGRAIPDTHNVVTEANQV---IETAMKAYGRVDVLVNNAG-ILRDRSFLKMTDQEWF 423

Query: 122 GMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQS 181
            ++  ++ +   +++AV PIF  +  G I+N  S +G       + Y A+K A+  F+++
Sbjct: 424 AVVQVHLYSTFLLSKAVWPIFLKQKGGHIINTTSTSGIYGNFGQANYAAAKAAILGFSRT 483

Query: 182 LRKELINTGIRVIEIAP 198
           +  E    GIRV  IAP
Sbjct: 484 IAVEGAKRGIRVNIIAP 500

>ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH]
           complement(93017..93895) [879 bp, 292 aa]
          Length = 292

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 82/197 (41%), Gaps = 9/197 (4%)

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130
           IG +DV E   ++  ++     F  ID +I  A     +D+   +SS   K ++D ++V 
Sbjct: 79  IGGVDVREVADMKRAVEQTVAAFGRIDYVIAGAAGNFLADMT-NLSSRAFKTVLDIDLVG 137

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190
             N  +A L    AKN G ++ + +       P  +   A+K  V A +  L  EL   G
Sbjct: 138 SYNTVKATLSEL-AKNKGAVLFVSATLHYTGTPLQAHVSAAKAGVDALSNVLAVELGPLG 196

Query: 191 IRVIEIAPGNVETEFSLVRYKGD---ADRAKQVYKGTTPLYADDIADLIVYATSRKPNTV 247
           IR   IAPG +     + R  G     D  K++     P    DIAD  VY  S   +  
Sbjct: 197 IRCNCIAPGLIGGTEGVDRLSGGLPVTDAVKKIPL-QRPGLTKDIADGTVYLFSPAASYT 255

Query: 248 IADVLVFASNQASPYHI 264
              +LV        +H+
Sbjct: 256 TGTILVV---DGGAWHL 269

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 85/203 (41%), Gaps = 12/203 (5%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
           L+ K   +TGAS+GIG A A E L  A  ++                          KV 
Sbjct: 28  LKGKVAVVTGASSGIGYAVA-EGLAQAGASLAVWYNSNAALVERAVELSAKY---NVKVV 83

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKAL--GSDVVGTISSED---IKGMID 125
             Q  VTE  K++  I+++ +EF  ID+ I NAG     G  V    S  D      +I 
Sbjct: 84  AYQCPVTEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDTDEWNKVIH 143

Query: 126 TNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGR--DAYPTGSIYCASKHAVRAFTQSLR 183
           T+   +    + V   FK + SG +V   S++G   +     + Y A+K  V  F +SL 
Sbjct: 144 TDFNGVYYCAKYVGAQFKRQGSGSMVITASMSGHIVNIPQLQACYNAAKAGVIHFAKSLA 203

Query: 184 KELINTGIRVIEIAPGNVETEFS 206
            E      RV  ++PG + T  S
Sbjct: 204 VEWAGFA-RVNTVSPGYIATPIS 225

>Kwal_55.19569
          Length = 288

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 102/236 (43%), Gaps = 16/236 (6%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
           L+ K   I+GAS+GIG A A+ +  A  G                          +AK Y
Sbjct: 36  LRGKVACISGASSGIGGAVAVAFAQA--GADIAVWYNSNDKLIQTAKELSETYGVRAKAY 93

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVV-----GTISSEDIKGMID 125
             +  VT+  K++  I  + ++F  IDI + NAG       +       +++++ + + +
Sbjct: 94  --KCPVTDEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEERGVATKEWEKVFN 151

Query: 126 TNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGR--DAYPTGSIYCASKHAVRAFTQSLR 183
           T+   +   ++ +  IFK +  G +V   S++G   +     + Y A+K  V   ++SL 
Sbjct: 152 TDFQGVYYCSKVIGAIFKKQGRGSLVITASMSGHVVNVPQLQACYNAAKAGVIHLSRSLA 211

Query: 184 KELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYA 239
            E      RV  I+PG ++T  +         + KQ +   TPL  + + + +V A
Sbjct: 212 VEWAGFA-RVNSISPGYIDTPIATFA----EAKMKQRWHELTPLGREGLPEELVGA 262

>Kwal_47.17102
          Length = 285

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 79/204 (38%), Gaps = 31/204 (15%)

Query: 10  RLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKV 69
           ++ N    +TG S G+G+A   E+L                             +P    
Sbjct: 29  KIDNAVCVVTGGSNGLGRAIVQEFL----------LKLPNVTLISLDIEPPKKSFPNVYH 78

Query: 70  YIGQL----DVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMID 125
           Y   L    DV +T KI      +     D+ +LINNAG          +S E    +  
Sbjct: 79  YTCDLSNSSDVDQTLKI------VKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQ 132

Query: 126 TNVVALINVTQAVLPIFKAKNSGDI-----VNLGSVAGRDAYPTGSIYCASKHAVRAFTQ 180
            NV   + + Q + P      +GD+     V + S  G  A   GS Y ASK A  AF +
Sbjct: 133 VNVFTPMRLVQELSP-----KAGDLRQFYAVTVASALGVCAPARGSCYGASKAAAIAFHE 187

Query: 181 SLRKELINTG-IRVIEIAPGNVET 203
           +  +EL  T  IR + + PG ++T
Sbjct: 188 AWAQELDETSRIRTLLVTPGQLDT 211

>ABR076C [667] [Homologous to ScYKL055C (OAR1) - SH]
           (527756..528571) [816 bp, 271 aa]
          Length = 271

 Score = 46.2 bits (108), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 9/113 (7%)

Query: 97  DILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQ-AVLPIFKAKNSGD----IV 151
           D+L+N AG +  S    T +    + ++  N+ +L+++ Q +V P+ +A+        IV
Sbjct: 111 DLLVNCAGVSQASLAAHTSADAAAR-LLHVNLGSLVSLCQLSVRPMLRARRVAHARPTIV 169

Query: 152 NLGSVAG---RDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNV 201
           N+ SV G       P  ++Y ASK AV  ++++L  EL  TGI    +APG V
Sbjct: 170 NVASVLGCAHAQPPPGTAVYAASKSAVIQYSRALAAELERTGIACHAVAPGLV 222

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 88/200 (44%), Gaps = 16/200 (8%)

Query: 3   QGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXX 62
           QG    E L++K + +TGA  G+G++ AL +       V                     
Sbjct: 174 QGSTKVESLKDKIVIVTGAGGGLGRSHALWFAKYGAKVVVNDIKAPEPVVDEIN------ 227

Query: 63  XYPQAKVYIGQLDVTETEKI--QP--FIDNLPEEFKDIDILINNAGKALGSDVVGTISSE 118
                K+Y G   + +   +  QP   +    E F  +D+L+NNAG  L       ++ E
Sbjct: 228 -----KIYGGGSAIPDKHDVVTQPTEIVKTALEAFGRVDVLVNNAG-ILRDRSFLKMTDE 281

Query: 119 DIKGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAF 178
           +   ++  ++ +   +++AV P+F  + SG I+N  S +G       + Y A+K A+   
Sbjct: 282 EWYAVLKVHLFSTYGLSKAVWPVFLKQRSGYIINTTSTSGIYGNFGQANYAAAKAAILGL 341

Query: 179 TQSLRKELINTGIRVIEIAP 198
           +++L  E    GI+V  IAP
Sbjct: 342 SKTLALEGSKHGIKVNIIAP 361

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 81/187 (43%), Gaps = 14/187 (7%)

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133
           +DV + ++++  +     EF  ID +I  A     SD    +SS   K ++  +++   N
Sbjct: 142 VDVRDIKQLEDAVSQTVNEFGRIDFVIAGAAGNFISDFT-NLSSNAFKSVVSIDLLGSFN 200

Query: 134 VTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRV 193
             +A  P  K KN G I+ + +       P  S   A+K  + A + +L  EL   GIR 
Sbjct: 201 TVKACFPQLK-KNKGAIIFVSATFHYYGVPFQSHVGAAKAGIDALSNALAVELGVLGIRS 259

Query: 194 IEIAPGNVETEFSLVRYKGDADRAKQVYK-------GTTPLYADDIADLIVYATSRKPNT 246
             IAPG +     + R     ++  +V+K       GTT     DIA+  V+  S   + 
Sbjct: 260 NCIAPGAIANTEGISRLL-TGNKKDEVFKRIPLQRLGTT----RDIAETTVFLFSPAASF 314

Query: 247 VIADVLV 253
           V   V +
Sbjct: 315 VTGTVHI 321

>Scas_613.18
          Length = 286

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 62/136 (45%), Gaps = 7/136 (5%)

Query: 73  QLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALI 132
           + DV   E+I+     + ++   I ILINNAG      +    S E++  +I+ N +   
Sbjct: 84  KCDVGSQEEIEKTYKRISKDHASIHILINNAGITCLKPIT-EFSKEEVNKVINVNYLGAC 142

Query: 133 NVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLR---KELINT 189
            +    L    A N G IVN+ SV G       + Y ASK  + +F QSL    K+    
Sbjct: 143 KLMHLWL---SANNEGFIVNIASVLGLITPARLAAYGASKGGLISFHQSLNLLLKKRTTN 199

Query: 190 GIRVIEIAPGNVETEF 205
            I+++ +  G + T+ 
Sbjct: 200 KIKMLLVCTGKIRTKM 215

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 1/119 (0%)

Query: 80  EKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQAVL 139
           E  +  I+   +EF  +D+LINNAG  L       ++  +   ++D ++     +++A  
Sbjct: 78  ENGEKIIETAIKEFGRVDVLINNAG-ILRDVSFAKMTEREFASVVDVHLTGGYKLSRAAW 136

Query: 140 PIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAP 198
           P  +++  G I+N  S AG       + Y A+K  +    ++L KE     I V  IAP
Sbjct: 137 PYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKEGAKYNINVNSIAP 195

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 92  EFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQAVLPIFKAKNSGDIV 151
           +F+ +DIL+NNAG  L       +  E+   ++  ++ +  ++++AV PIF  + SG I+
Sbjct: 394 KFQRVDILVNNAG-ILRDKSFLKMKDEEWFAVLKVHLFSTFSLSKAVWPIFTKQKSGFII 452

Query: 152 NLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAP 198
           N  S +G       + Y A+K A+  F++++  E    GI V  IAP
Sbjct: 453 NTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAKRGIIVNVIAP 499

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 91/206 (44%), Gaps = 16/206 (7%)

Query: 3   QGRKAAERLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXX 62
           Q  K+   L +  + ITG S G+G+    + L + N N+                     
Sbjct: 59  QTWKSLNELHDPIVLITGGSNGLGRCIIHKLLRSYN-NIKVINLDLDVQYWSE------- 110

Query: 63  XYPQAKVYIGQLDVTETEKIQPFIDNLPEEFKD-IDILINNAGKALGSDVVGTISSEDIK 121
              +A+V   + D+   + ++  +  +  E++D I++LI NAG     +       ++++
Sbjct: 111 ---EARVINIECDLVNADGLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPIDEMQ 167

Query: 122 GMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQS 181
            +++ N  +   + QA++P    +    IV + SV G  A    + Y ASK A+ A   S
Sbjct: 168 RIMNINTWSTARILQAIIP-RDNQRQLYIVTISSVLGILAPSKVASYAASKAAITALHNS 226

Query: 182 LRKELINTG---IRVIEIAPGNVETE 204
           +  + +  G   IR + + PG ++T+
Sbjct: 227 MTNDFLVRGIGNIRTLLVLPGQIDTQ 252

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 3/133 (2%)

Query: 75  DVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINV 134
           D+TE   ++  ++   +    ID L+ NAG       V  I     K + D N  +++++
Sbjct: 58  DITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSL 117

Query: 135 TQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVI 194
               LP  K K +G++V + S A    + +   Y +SK A+  F  +L  E     ++ I
Sbjct: 118 VGIALPELK-KTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAI 174

Query: 195 EIAPGNVETEFSL 207
            +APG V+T+  +
Sbjct: 175 AVAPGIVDTDMQV 187

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
           3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
           aa]
          Length = 278

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 64/120 (53%), Gaps = 14/120 (11%)

Query: 96  IDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQAVLP-IFKAKN-----SGD 149
           +++LIN AG    S  V T +S+ I+ +++ N ++ + +T   +  + K++      SG 
Sbjct: 114 VNLLINCAGLTQESLSVRTTASQ-IQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQ 172

Query: 150 -----IVNLGSV--AGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNVE 202
                IVN+ S+  +G+   P  S+Y ASK A+  FT+ L  E+    IR   I+PG V+
Sbjct: 173 SARPTIVNISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVK 232

>Kwal_23.4572
          Length = 300

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 74/172 (43%), Gaps = 8/172 (4%)

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133
           +DV E E+++  +    E F  ID +I  A     +     +S+   K ++  +++   N
Sbjct: 92  VDVREIEQLEEAVARTVERFGRIDFVIAGAAGNFIAPF-SKLSANAFKSVVSIDLLGSFN 150

Query: 134 VTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRV 193
             +A L   + +  G I+ + +       P  S   A+K  V A + +L  EL  +G+R 
Sbjct: 151 TAKACLAELQ-RTKGSILFVSATFHYYGVPYQSHVGAAKAGVDALSNALAVELGVSGVRS 209

Query: 194 IEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLY----ADDIADLIVYATS 241
             IAPG +E    + R  G    +KQ      PL       DIA+  VY  S
Sbjct: 210 NCIAPGAIEGTEGISRLTGSV--SKQSICSKIPLQRLGTTKDIAETTVYLFS 259

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 69/164 (42%), Gaps = 15/164 (9%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQ 73
           K + +TGAS GIGQA      +  N  V                      +   +  IG 
Sbjct: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKF---EYIIG- 58

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133
            D+++ E ++ +++   ++F  ID ++ NAG       V  I     K + D N  ++++
Sbjct: 59  -DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVS 117

Query: 134 VTQAVLPIFKAKNSGDIVNLGS---------VAGRDAYPTGSIY 168
           +    LP  K K +G+IV + S         + GR   PT +IY
Sbjct: 118 LVSLSLPHLK-KFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160

>Scas_641.31
          Length = 287

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 91/186 (48%), Gaps = 38/186 (20%)

Query: 85  FIDNLP--EEFKD---------IDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133
           F +N+P  EE  D         +++L+N AG    S  + T S+++I  +++ N ++ ++
Sbjct: 98  FHENIPLFEEIWDKNASNTNYYVNLLVNCAGITQDSLSLRT-STDEISQIMNINFLSCVS 156

Query: 134 VTQAVLP-IFKAKN---SGD--------------IVNLGSVAGRDA--YPTGSIYCASKH 173
           ++  V   + +++N    G+              I+N+ S+ G      P  SIY ASK 
Sbjct: 157 LSNFVCKKMIRSQNLFKRGEMALDHELPKPPPPCIINISSILGEGTIQVPGTSIYSASKA 216

Query: 174 AVRAFTQSLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAK-QVYKG----TTPLY 228
           A+  +T++L +E    GIR + +APG V T+  +++      R +  +  G    T+ + 
Sbjct: 217 ALIQYTRTLSQETETWGIRALSMAPGLV-TDTDMIQEMDPQTRQQLNLLMGLNCTTSDVV 275

Query: 229 ADDIAD 234
           ADDI D
Sbjct: 276 ADDIWD 281

>AER111W [2616] [Homologous to ScYLR426W - SH]
           complement(846805..846884,846937..847840) [984 bp, 327
           aa]
          Length = 327

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 65/141 (46%), Gaps = 5/141 (3%)

Query: 68  KVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTN 127
           +V   + D+++   ++  ++ +  E+  +D+LIN AG       +  ++ E++      N
Sbjct: 114 RVRFLRADLSKPADVERVLEQVTREYSRVDVLINCAGMRSRYQGLQAVAPEELHKTFQVN 173

Query: 128 VVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELI 187
           V A     Q + P  +      +V +GS  G  A    S Y A+K A  A+  S   EL+
Sbjct: 174 VFAPQRFIQKLAP--RDDRQFYLVTVGSTLGILAPARLSAYAATKAATIAYHDSWTFELL 231

Query: 188 NTG---IRVIEIAPGNVETEF 205
           ++G   +R + +  G ++T  
Sbjct: 232 SSGRQRVRTLLVVLGQMDTRM 252

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 62/133 (46%), Gaps = 3/133 (2%)

Query: 75  DVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINV 134
           D+T  + ++ ++++  E    I+ LI NAG       +  I     K + + N  +++++
Sbjct: 62  DITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSL 121

Query: 135 TQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVI 194
               LP  K K  G  + + S A    + +   Y +SK A+  F  +L  E     +R +
Sbjct: 122 VDIALPHLK-KTHGSALFVSSDASDTYFSSWGAYGSSKAALNHFAMTLANE--EKAVRAL 178

Query: 195 EIAPGNVETEFSL 207
            +APG V+T+  +
Sbjct: 179 AVAPGIVDTDMQV 191

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 87/204 (42%), Gaps = 18/204 (8%)

Query: 6   KAAERLQNKTIFITGASAGIGQATALEYL-DAANGNVXXXXXXXXXXXXXXXXXXXXXXY 64
           K+    +N  + ITG S G+G+A   + L D +N  +                       
Sbjct: 63  KSLREFKNGIVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVR------------ 110

Query: 65  PQAKVYIGQLDVTETEKIQPFIDNLPEEFK-DIDILINNAGKALGSDVVGTISSEDIKGM 123
              +V     D+++ E++   ++ L  ++K +I +++NNAG          +  +++  +
Sbjct: 111 -NTRVKDLICDLSDDEEVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKI 169

Query: 124 IDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLR 183
              N  A +   Q + P   +     IVN+ S+ G       + Y ASK A+ AF QS  
Sbjct: 170 FKINTFAPLQFIQELAPSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSYS 229

Query: 184 KELINTG---IRVIEIAPGNVETE 204
            EL N G   IR + + PG + TE
Sbjct: 230 FELQNEGVRNIRTLLVTPGQLNTE 253

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 84/196 (42%), Gaps = 16/196 (8%)

Query: 14  KTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQ 73
           + I +TGAS GIG+AT  +   A +  V                      Y         
Sbjct: 3   RVIIVTGASRGIGEATVEKLCTAPDVVVVGVARAEKTLKVLKERYGSKFDYVAG------ 56

Query: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTN--VVAL 131
            DVT+   +Q  +D +  ++  +D +I NAG +        I+  DI+    T   +V+ 
Sbjct: 57  -DVTDESVVQAVLDKVSSDYGRLDAIIANAGVSRFE----RIAEADIQQWKRTFEIIVSA 111

Query: 132 INVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGI 191
           +++    LP+ + K+ G ++ + S   +  Y   +   +SK A+  F + L  E     +
Sbjct: 112 VSLVSKALPMLR-KSQGTVIVVTSGLSKVGYRASASSASSKIALNHFIRILAAE--EPAL 168

Query: 192 RVIEIAPGNVETEFSL 207
           R + +APG V T+ ++
Sbjct: 169 RAVAVAPGVVRTDMTV 184

>ADR059C [1800] [Homologous to ScYBR159W - SH] (811943..812998)
           [1056 bp, 351 aa]
          Length = 351

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 96  IDILINNAGKALGSDV-VGTISSEDIKGMIDTNVVALINVTQAVLPIF-----KAKNSGD 149
           + +L+NN G +    V     + E+++G+I  N  A + VTQ V P+      + +  G 
Sbjct: 147 VTVLVNNVGVSHSIPVSFLETTEEELRGIITVNNTATLMVTQTVAPLVIANARRLQCRGL 206

Query: 150 IVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNVETEFSL 207
           ++ +GS  G    P  + Y  SK  V+A++ +L          V+++AP NV+ +  L
Sbjct: 207 VLTMGSFDGLLPTPLLATYSGSKDFVQAWSTAL----------VVDLAPLNVDVQIVL 254

>Scas_721.47
          Length = 344

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 75/186 (40%), Gaps = 30/186 (16%)

Query: 80  EKIQPFIDNLPEEFKDIDILINNAGKALGSDV-VGTISSEDIKGMIDTNVVALINVTQAV 138
           E I+    +LP     I +LINN G++    V       E+++ +I  N  A + +TQ +
Sbjct: 130 EFIKGLCKDLP-----ITVLINNVGQSHSIPVPFLETEEEELRNIITINNTATLLITQII 184

Query: 139 LPIFK------AKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIR 192
            PI         K+ G I+ +GS  G    P  + Y  SK  ++ ++ SL  EL    I 
Sbjct: 185 APIISKTVKETKKSRGLILTMGSFGGLIPTPLLATYSGSKAFLQQWSTSLAGELQKDNID 244

Query: 193 VIEIAPGNVETEFSLVRYK------------------GDADRAKQVYKGTTPLYADDIAD 234
           V  +    V +  S +R                    G    A++ Y   TP ++  I +
Sbjct: 245 VELVLSYLVTSSMSKIRRTSMMIPNPSKFVKATLSNVGRRCGAQERYGTMTPFWSHAIYE 304

Query: 235 LIVYAT 240
            I+  T
Sbjct: 305 FIIEET 310

>KLLA0B09812g complement(856799..857839) similar to sp|P38286
           Saccharomyces cerevisiae YBR159w singleton, start by
           similarity
          Length = 346

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 96  IDILINNAGKALGSDVVGTISSE-DIKGMIDTNVVALINVTQAVLPIFKA-----KNSGD 149
           + +LINN GK+    V    + E +++ +I  N  A + +TQ +LP  KA     K  G 
Sbjct: 144 VTVLINNVGKSHSIPVPFDQTEESELRDIITINNTATLMITQTLLPQLKASVKTLKCRGL 203

Query: 150 IVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNVETEFSLVR 209
           I+ +GS  G    P  + Y  SK  +++++ +L  EL +  I V  +    V +  S +R
Sbjct: 204 ILTMGSFGGLLPTPFLATYSGSKAFLQSWSNALAGELSSDSIDVELVLSYLVTSAMSKIR 263

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 69  VYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDV-VGTISSEDIKGMIDTN 127
           V+    D++   +I+   +N+  +   + ILINNA  A+ SD+ +  + ++ I+ +I  N
Sbjct: 104 VHFYACDISLPGRIRVIHENIIRDVGHVTILINNA--AITSDLPLDRVDNDKIEQIIRVN 161

Query: 128 VVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKEL 186
           ++    + +  LP   A + G IVN+ SV G       + Y ASK  + A  +SL  EL
Sbjct: 162 LLGPYTLIREFLPSMIAIDRGYIVNIASVLGFVTPARLTAYGASKGGLIALHESLVDEL 220

>YKL071W (YKL071W) [3189] chr11 (304759..305529) Protein with
           similarity to proteins of the short-chain alcohol
           dehydrogenase family, expression is regulated by Yap1p
           transcription factor [771 bp, 256 aa]
          Length = 256

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 86/213 (40%), Gaps = 13/213 (6%)

Query: 15  TIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYIGQL 74
           T FI G S GIG    ++ L A+ GN                         +  ++I QL
Sbjct: 8   TYFIIGGSRGIG-FNLVKILSASTGNTVITSIRGSPSLPKNKQVEDLAKI-RKNIHIVQL 65

Query: 75  DVTETEKIQPFIDNLPEE--FKDIDILINNAGKALGSDVVGTISSEDIKGM--IDTNVVA 130
           D+T+ E I    D + +   F  IDI I  A  A+       + +     +    TN + 
Sbjct: 66  DLTKDESIGNIADEIKKTPFFLGIDIFI--ACSAVSDSYYKVLETPKSVWLNHYSTNALG 123

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGR-DAYPTGSI--YCASKHAVRAFTQSLRKELI 187
            I   Q V P+   K +  I  + SVAG  +A+   S+  Y  SK A+    ++L  EL 
Sbjct: 124 PILALQKVYPLLLLKKTRKIFFISSVAGSINAFVPLSVSAYGQSKAALNYAVKTLSFELK 183

Query: 188 NTGIRVIEIAPGNVETEFSLVRYKGDADRAKQV 220
             G  V+   PG V T+    +Y  D  + K +
Sbjct: 184 PEGFTVVAFHPGMVSTDMG--QYGLDHFKEKNI 214

>Kwal_55.21822
          Length = 283

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 91/227 (40%), Gaps = 19/227 (8%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVY 70
           L+ K   +TGAS+GIG   A+ +   A                          Y   KV 
Sbjct: 28  LKGKVAAVTGASSGIGYDVAVAF---AQAGADVAMWYNSNPHITELVGEISEKY-GVKVK 83

Query: 71  IGQLDVTETEKIQPFIDNLPEEFK-DIDILINNAGKALGSDVVGTISSED-------IKG 122
             +  VT ++ +   ID + ++F   IDI++ NAG A     +  +  +D          
Sbjct: 84  AYKCSVTSSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWNK 143

Query: 123 MIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGR--DAYPTGSIYCASKHAVRAFTQ 180
           +ID ++  +  V + +  +FK +  G  +   S++G   +     + Y A+K  V   ++
Sbjct: 144 VIDVDLNGIYRVAKNIGRVFKEQGHGSFIITASMSGHVVNVPQMQTAYNAAKAGVLHMSK 203

Query: 181 SLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPL 227
           SL  E      RV  ++PG + TE +        D  K  +   TP+
Sbjct: 204 SLAVEWAGFA-RVNTVSPGYIATEITNFA----EDELKDKWHKLTPM 245

>KLLA0C12694g 1077786..1078565 similar to sp|P35731 Saccharomyces
           cerevisiae YKL055c OAR1 putative 3-oxoacyl-(acyl carrier
           protein) reductase singleton, start by similarity
          Length = 259

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 62/117 (52%), Gaps = 10/117 (8%)

Query: 96  IDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQAVLP--IFKAK---NSGDI 150
           +D+L+N AG    +  +   ++E +  +++ N ++ +++TQ  L   I   K   + G I
Sbjct: 104 LDLLVNCAGITQTTAAIKANTNE-MADIMNVNFMSSVSLTQLALKQMIRNTKLHGHRGKI 162

Query: 151 VNLGSVAGRDA----YPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNVET 203
           VN+ SV G  +     P  ++Y ASK A+  + + L +EL    I V  I+PG VE+
Sbjct: 163 VNIASVLGDSSSNIIVPGTAMYSASKAAMIQYNRVLSEELKRLSIDVQTISPGLVES 219

>Sklu_2219.3 YDL114W, Contig c2219 6060-7151 reverse complement
          Length = 363

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 56/118 (47%), Gaps = 1/118 (0%)

Query: 69  VYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNV 128
           V+    D++  ++I      +  +  ++ ILINNAG   G  +   +S + I+  I  N 
Sbjct: 134 VFYYPCDISNPKEIAELHKKIKLQHGNVTILINNAGITSGYRL-QELSDKVIEKTIQVNY 192

Query: 129 VALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKEL 186
           V+     Q  LP   + + G IVN+ SV G  +    + Y ASK  + +  ++L  EL
Sbjct: 193 VSAFYTIQEFLPDMVSMSRGYIVNVASVLGFMSPARLTAYGASKGGLISLHEALVNEL 250

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 2/145 (1%)

Query: 65  PQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMI 124
           P + + I  +DV   +++   +    ++F  +D +I  A     +D    +SS   K ++
Sbjct: 73  PHSCLPISSVDVRNVDQLHEAVKVAIQKFGRLDYVIAGAAGNFLADFT-HLSSNAFKSVV 131

Query: 125 DTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRK 184
             +++   N  +A  P    K  G ++ + S       P  S   A+K  + A + +L  
Sbjct: 132 SIDLLGSFNTVKACFPEL-VKTKGSVLFVSSTLHYYGVPFQSHVGAAKAGIDALSNALAV 190

Query: 185 ELINTGIRVIEIAPGNVETEFSLVR 209
           E+   G+R   +APG +     L R
Sbjct: 191 EMGPLGLRFNCVAPGAIANTEGLAR 215

>CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530
           Saccharomyces cerevisiae YDL114w, hypothetical start
          Length = 311

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 68/151 (45%), Gaps = 13/151 (8%)

Query: 64  YPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGM 123
           YP    Y  + D+T++ ++      +  +F  ++IL+NNA   +   +     +E I+ +
Sbjct: 89  YPNIIHY--RCDITDSFQVAHMKKKVLLDFGKVNILVNNAAITIIKQLTDMTEAE-IQRV 145

Query: 124 IDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLR 183
           I+ N++A  ++    +P      +G I+N+ SV G        +Y A+K  +      L 
Sbjct: 146 INVNLIASYHLVSMFVPEMLYTKNGCIINIASVLGELTPSRLIVYGATKGGLIELHNYLN 205

Query: 184 KELINT---------GIRVIEIAPGNVETEF 205
           ++ IN          G++ I + PG + T  
Sbjct: 206 QQ-INAHNSYAYNRRGLKAILVCPGKISTTM 235

>Scas_655.19
          Length = 297

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 77/189 (40%), Gaps = 12/189 (6%)

Query: 71  IGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVA 130
           +G +DV   ++++  +    + F  ID LI  A      D +  +S    K +ID +++ 
Sbjct: 86  LGNIDVRNFDQLKNAVKKTVDTFGHIDYLIAGAAGNFICDFM-NLSPNAFKSVIDIDLLG 144

Query: 131 LINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKELINTG 190
             N  +A       KN G ++ + +       P      A+K  + A + +L  EL   G
Sbjct: 145 SFNTVKACASQL-IKNKGSVLFVSATFHYYGVPFQLHVGAAKAGIDALSNNLAVELGPLG 203

Query: 191 IRVIEIAPGNVETEFSLVRYKGDADRAKQVYK------GTTPLYADDIADLIVYATSRKP 244
           +R   IAPG +       R  G     K + K      GTT     DIA+  V+  S   
Sbjct: 204 VRSNCIAPGAIGQTEGFKRLTGTDFEEKSLNKIPLQRLGTT----RDIAEATVFLFSPAA 259

Query: 245 NTVIADVLV 253
           + +   V+V
Sbjct: 260 SYISGSVMV 268

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 78/195 (40%), Gaps = 20/195 (10%)

Query: 10  RLQNKTIFITGASAGIGQATALE--------YLDAANGN-VXXXXXXXXXXXXXXXXXXX 60
           R++ K   +TG ++GIG  T L         Y+   N + V                   
Sbjct: 16  RVERKVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVHKAIKEIKQEAENRLETAR 75

Query: 61  XXXYPQAKVYIGQL-----DVTETEKIQPFIDNLPEEFKDIDILINNAG-KALGSDVVGT 114
              + + +  +G+L     D+T+   ++        +   +D+LINNAG  AL  +    
Sbjct: 76  QDPHDELERCLGELRYLPIDLTDLRSVEKAAKKFRAQESTLDVLINNAGVMALPYE---- 131

Query: 115 ISSEDIKGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHA 174
           ++ +  +  + TN V+   +T  +LP  K ++ G +V L S+  +  +    + C   + 
Sbjct: 132 LTHDGFEVQMQTNYVSHFLLTMRLLPYVK-RSGGRVVTLSSIGHKIQFTYCPLDCHFDYR 190

Query: 175 VRAFTQSLRKELINT 189
              F   LR  +  T
Sbjct: 191 PNIFFTWLRYAMAKT 205

>Kwal_26.8282
          Length = 298

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 13/117 (11%)

Query: 95  DIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINVTQAVLPIFKAKNSGD----- 149
           DI +L+N AG    S  +   S EDI  +  TN+  +  VT   L   K   S       
Sbjct: 139 DIALLVNCAGITQASPAL-RCSPEDILRI--TNINYMSAVTLCSLSAKKMLRSRKHLATP 195

Query: 150 --IVNLGSVAG---RDAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNV 201
             I+N+ S+ G       P  ++Y ASK A+  +++ L +EL  +GI+V  ++P  V
Sbjct: 196 PCIINVSSILGDPKTPPLPGTALYSASKAALTQYSRVLSEELARSGIQVHSLSPSLV 252

>Sklu_1624.3 YBR265W, Contig c1624 1338-2288
          Length = 316

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 166 SIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTT 225
           S Y   K +++A    LR+E   +  R+  + PGN E+E   V      +  K +   +T
Sbjct: 172 SQYAPMKQSIKALVMILRQEFPES--RISCVYPGNFESEGFEVETLTKPEITKSIEGAST 229

Query: 226 PLYADDIADLIVYATSRKPNTVIADVL 252
           P+  D+  + IVY   +  + V  D +
Sbjct: 230 PISCDECCNKIVYWLDKGYDDVTTDFI 256

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score = 36.2 bits (82), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 75  DVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALINV 134
           DV++ E I   ++ +  ++K +D ++ NAG     + V  I     K + D N  +++++
Sbjct: 58  DVSDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSL 117

Query: 135 TQAVLPIFKAKNSGDIVNLGSVAGRDAY 162
               LP+ K  N G+IV + S A   +Y
Sbjct: 118 VGHALPLLKQSN-GNIVLVSSGASTKSY 144

>Sklu_2404.13 YKL055C, Contig c2404 24100-25005
          Length = 301

 Score = 36.2 bits (82), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 61/115 (53%), Gaps = 16/115 (13%)

Query: 96  IDILINNAG---KALGSDVVGTISSEDIKGMIDTNVVALINVTQAVLPIF---KAKN--- 146
           +++L+N AG   +ALG        +E+++ +++ N ++  +++ +   +    K KN   
Sbjct: 136 LELLVNCAGVTQQALGIRT----RTEEVQRIMNINFMSATSLSSSAAKVMIKHKIKNPTA 191

Query: 147 SGDIVNLGSVAGRD---AYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAP 198
              I+N+ S+ G       P  SIY ASK A+  ++  L +EL  +G+RV  ++P
Sbjct: 192 KPCIINVSSILGHSKGITLPGTSIYSASKAAIAQYSMVLSQELARSGVRVNCVSP 246

>Scas_675.10
          Length = 312

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 45/259 (17%), Positives = 101/259 (38%), Gaps = 24/259 (9%)

Query: 10  RLQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXX-----XXXXXXXY 64
           +L ++ + ITG S G+G+  A +Y    N +                             
Sbjct: 4   QLNDQIVLITGGSQGLGREFAHKYYHEGNNSKIIVVSRSEKKLIKAVDAISGKTVGTNLS 63

Query: 65  PQ--------AKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDV---VG 113
           P+        AK+Y    D+++ E +    D L E    +++L        G  +     
Sbjct: 64  PEETGKLNKNAKLYYYPCDLSDHEAVSTMFDRLCE----LEMLPTQVYCCAGGSIPKLFK 119

Query: 114 TISSEDIKGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKH 173
            ++ E++   I  N    +++   V  +    ++  ++   SV     +   S Y   K 
Sbjct: 120 DLTGEELDMGIKMNYSTTLHIAHKVAQL--ELSNCHLILFSSVTAFFPFIGYSQYAPLKV 177

Query: 174 AVRAFTQSLRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIA 233
           +++A    LR+E++    R+  + PGN ++E   +      D  +++   +TP+ ++D  
Sbjct: 178 SLKALVGILRQEMLQN--RISCVYPGNFQSEGFELEELTKPDITREIEGASTPISSEDCC 235

Query: 234 DLIVYATSRKPNTVIADVL 252
           + I+ +     + +  D++
Sbjct: 236 NKIIRSLESGYDDITTDLI 254

>CAGL0M13013g complement(1281291..1282103) similar to sp|P35731
           Saccharomyces cerevisiae YKL055c OAR1, hypothetical
           start
          Length = 270

 Score = 35.8 bits (81), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 87  DNLPEEFKDIDILINNAGKALGSDVVG-TISSEDIKGMIDTN---VVALINVTQAVLPIF 142
           DN       + +L+N AG    S  VG  +S   I  MI+ N    V L N    +    
Sbjct: 106 DNNDSNRYTLRVLVNCAGITQAS--VGIRMSPNVISNMINVNFASAVYLSNYAARLQMKQ 163

Query: 143 KAKNSGDIVNLGSVAG-----RDAYPTG-SIYCASKHAVRAFTQSLRKELINTGIRVIEI 196
           K++   DI+N+ S+ G     R+    G SIY A+K A+  FT+   KE+    I   +I
Sbjct: 164 KSRKRLDIINVSSILGGFADKRNFMIQGTSIYSATKAALSQFTRVYGKEVERLSINCHDI 223

Query: 197 APG 199
           APG
Sbjct: 224 APG 226

>Kwal_26.8838
          Length = 323

 Score = 35.0 bits (79), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 14/99 (14%)

Query: 64  YPQAKVYIGQLDVTETEKIQPFIDNLPEEFKDI----DILINNAG-KALGSDVVGTISSE 118
           +P  ++Y   LD+TE +     +D   + F+ +    D+LINNAG  AL      +++ +
Sbjct: 79  HPVGELYFLSLDLTELK----LVDKAAKRFRSLETRLDVLINNAGVMALPY----SVTED 130

Query: 119 DIKGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVA 157
             +  + TN +A   +T  +LP  K +  G I+ + S+ 
Sbjct: 131 GFEIQLQTNYIAHFLLTMRLLPSVK-RCRGRIITVSSIG 168

>YDL114W (YDL114W) [755] chr4 (255604..256530) Member of the
           short-chain dehydrogenase-reductase family, which are
           NAD- or NADP-dependent oxidoreductases, has low
           similarity to S. cerevisiae Ylr426p [927 bp, 308 aa]
          Length = 308

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 84/199 (42%), Gaps = 18/199 (9%)

Query: 12  QNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAKVYI 71
           +N T  ITG S+G+G   A E     N  +                           ++ 
Sbjct: 37  KNATALITGGSSGLGFELAKELSRRINKVIVADIQSFPTFAQVEYN----------NIFY 86

Query: 72  GQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVAL 131
            Q D+T  ++I+     +  +  +I+I+INNAG A     +  +++++++ +ID N++  
Sbjct: 87  YQCDITSLDEIKNLKKAIERDHGNINIIINNAGVA-HIKKLEHMTNKEVEQLIDINLIGA 145

Query: 132 INVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQ-------SLRK 184
             +             G I+N+ SV G       + Y ASK A+  F +       SL  
Sbjct: 146 YRIISTFAEDMIDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLST 205

Query: 185 ELINTGIRVIEIAPGNVET 203
           E   TGI+ + + PG ++T
Sbjct: 206 ECNKTGIKTLLVCPGKIKT 224

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
           reductase, catalyzes the second step in the synthesis of
           phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 34.7 bits (78), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 79/191 (41%), Gaps = 12/191 (6%)

Query: 66  QAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDIL----INNAGKALGSDVVGTISSEDIK 121
           + +++    D++  E ++   + L    +D+D+L    +  AG A+     G +S  ++ 
Sbjct: 80  EQRLFYYPCDLSCYESVECLFNAL----RDLDLLPTQTLCCAGGAVPKLFRG-LSGHELN 134

Query: 122 GMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGRDAYPTGSIYCASKHAVRAFTQS 181
             +D N    +NV   +    + K    I+   S      +   S Y  +K A+++    
Sbjct: 135 LGMDINYKTTLNVAHQIALAEQTKEHHLII-FSSATALYPFVGYSQYAPAKAAIKSLVAI 193

Query: 182 LRKELINTGIRVIEIAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYADDIADLIVYATS 241
           LR+EL N   R+  + PGN E+E   V      +  K +   +  +      D+I  + +
Sbjct: 194 LRQELTN--FRISCVYPGNFESEGFTVEQLTKPEITKLIEGPSDAIPCKQACDIIAKSLA 251

Query: 242 RKPNTVIADVL 252
           R    V  D +
Sbjct: 252 RGDEDVFTDFV 262

>Scas_650.8
          Length = 326

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 73  QLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALI 132
            +D+T+ + ++     L +    ID+LINNA       +   ++ +  +  + TN +A  
Sbjct: 91  HMDLTDLKCVEKAAQKLLKLEDKIDVLINNAAIL---AIPYELTKDGFEIQLQTNYIAHF 147

Query: 133 NVTQAVLPIFKAKNSGDIVNLGSVAGR 159
            +T  +LP  K K  G I+ LGS+  R
Sbjct: 148 LLTMRLLPAIK-KCHGRIITLGSLGHR 173

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 85/224 (37%), Gaps = 38/224 (16%)

Query: 10  RLQNKTIFITGASAGIGQATALE--------YLDAANGNVXXXXXXXXXXXXXXXXXXXX 61
           ++ NK   +TG ++GIG  T L         YL   N +                     
Sbjct: 16  KVDNKVALVTGGNSGIGYYTVLHLYLHGFKVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQ 75

Query: 62  XXYPQ--------AKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVG 113
              P          K+    +D+T+   ++        +   +D+LINNAG      +  
Sbjct: 76  DEKPHDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAGVM---AIPY 132

Query: 114 TISSEDIKGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSV------------AGRDA 161
            ++ ++ +  + TN V+   +T  +LP+ KA+  G ++ + S+            A  + 
Sbjct: 133 ELTKDNFEIQMQTNYVSHFLLTMRLLPLIKAR-KGRVITVSSLGHNLIFFNCNPGAQFNY 191

Query: 162 YPT----GSIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNV 201
           +P+       Y  +K A   FT+ L   + N  I  + + PG V
Sbjct: 192 WPSMFFMWCRYALAKTASIQFTKML--AIKNPDILCMSLHPGLV 233

>Kwal_27.12155
          Length = 280

 Score = 30.8 bits (68), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 66  QAKVYIGQLDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVV-----GTISSEDI 120
             +V   +  V + +++Q  I  +  EF  ID+ + NAG A     +      +++ ++ 
Sbjct: 79  HVRVVAYKCPVDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQEW 138

Query: 121 KGMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVAGR 159
             +I T+   +   ++ V  +F+ +  G +V   S++G 
Sbjct: 139 NRIIQTDFQGVYYCSKYVGEVFQRQQHGSLVVTASMSGH 177

>Scas_652.19d1
          Length = 344

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 58/137 (42%), Gaps = 10/137 (7%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAK-- 68
           L +KT  +TG + GIG+   +E L   N NV                       P++K  
Sbjct: 39  LSDKTAVVTGCNTGIGKHV-VELLYQKNCNVIGVVRTDAKGEEAKKEIIANN--PKSKGN 95

Query: 69  -VYIGQLDVTETEKIQPFIDNLPEEFKD--IDILINNAGKALGSDVVGTISSEDIKGMID 125
              IG  D  + EK+      + E   D  ++I+I+NAG  +  D  GT S +  + M  
Sbjct: 96  ITIIGGCDYLDLEKVPAVGGKIKEALGDKPLNIIIHNAG-LMAPDNKGT-SVQGYEAMFQ 153

Query: 126 TNVVALINVTQAVLPIF 142
           TNV+    +   + P+F
Sbjct: 154 TNVLGSQLLQHFLDPLF 170

>CAGL0H07513g 734835..735893 highly similar to sp|P38286
           Saccharomyces cerevisiae YBR159w, start by similarity
          Length = 352

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 60/142 (42%), Gaps = 30/142 (21%)

Query: 81  KIQPFIDNLPEEFKDIDILINNAGKALGSDV-VGTISSEDIKGMIDTNVVALINVTQAVL 139
           KI    D+LP     I IL+NN G++    V       E+++ +I  N  A + +TQ + 
Sbjct: 131 KIYSLCDDLP-----ISILVNNVGQSHSIPVPFLATEEEEMRNIITINNTATLMITQIIA 185

Query: 140 -----PIFKAKNSGD---------IVNLGSVAGRDAYPTGSIYCASKHAVRAFTQSLRKE 185
                 + K + SGD         I+ +GS  G    P  + Y  SK  ++ ++ SL  E
Sbjct: 186 PIIIRTVKKHRESGDKKLKSQRGLILTMGSFGGLIPTPLLATYSGSKAFLQNWSSSLAGE 245

Query: 186 LINTGIRVIEIAPGNVETEFSL 207
           L          A  NV+ E  L
Sbjct: 246 L----------AADNVDVELVL 257

>KLLA0A11352g complement(983428..984372) similar to sp|P50167 Pichia
           stipitis D-arabinitol 2-dehydrogenase [ribulose forming]
           (EC 1.1.1.250) (ARDH), start by similarity
          Length = 314

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 69/167 (41%), Gaps = 26/167 (15%)

Query: 65  PQAKVYIGQLDVTETEKIQPFIDNLPEEFKDI--DILINNAGKALGSDVVGTISSEDIKG 122
           P  K+ +   D++  ++++  + ++P   K I    L++ AG     +      +E  + 
Sbjct: 87  PPVKISLWACDISNADEVEMVVKSIPSSHKGIVPQKLVHTAGFCQNINA-HEYDAEKAQK 145

Query: 123 MIDTNVVALINVTQAVLPIFKAK------------NSGD---------IVNLGSVAGR-- 159
           +++ N++  + + Q++     A+             SG+          V +GS++G   
Sbjct: 146 LVNVNLLGSLYICQSMARQLLARRTRRKSISEHIDESGEAMPQFPEASFVLIGSMSGLIV 205

Query: 160 DAYPTGSIYCASKHAVRAFTQSLRKELINTGIRVIEIAPGNVETEFS 206
           +       Y  SK  V    +SL  E    GIRV  I+PG + T  +
Sbjct: 206 NTPQPQCAYNMSKAGVIHLVKSLAAEWAKFGIRVNAISPGYIATALT 252

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score = 29.3 bits (64), Expect = 4.0,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 196 IAPGNVETEFSLVRYKGDADRAKQVYKGTTPLYAD 230
           +APGNVE   +L+ Y+ +  RA +   GT+ +  D
Sbjct: 600 VAPGNVELALNLIGYEDEVSRAMEFIFGTSLICKD 634

>Scas_652.19d
          Length = 341

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 60/141 (42%), Gaps = 10/141 (7%)

Query: 11  LQNKTIFITGASAGIGQATALEYLDAANGNVXXXXXXXXXXXXXXXXXXXXXXYPQAK-- 68
           L +KT  ITG + GIG    ++ L + N N+                      YP +K  
Sbjct: 39  LTSKTALITGTNTGIG-FEVMKLLYSKNCNI--IAVVRSAEKGEAAKKEAIEKYPNSKGS 95

Query: 69  -VYIGQLDVTETEKIQPFIDNLPEEFKD--IDILINNAGKALGSDVVGTISSEDIKGMID 125
              +G  D  +   ++P  + +     D  ++I+I+NAG  L + V    S + ++ M  
Sbjct: 96  ISVVGGNDFLDLTTVKPASEEIKLVLGDKPLNIIIHNAG--LMAPVNTGTSKQGLEAMFS 153

Query: 126 TNVVALINVTQAVLPIFKAKN 146
           TNV+    +   + P+F  K+
Sbjct: 154 TNVLGPQLLQHFLDPLFLKKD 174

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 14/96 (14%)

Query: 67  AKVYIGQLDVTETEKIQPFIDNLPEEFK----DIDILINNAG-KALGSDVVGTISSEDIK 121
            K++   LD+++   +    D    +FK     +D+LINNAG  AL  +    I+ +  +
Sbjct: 85  GKLHFLSLDLSDLRSV----DKAAAKFKGLELSLDVLINNAGVMALPYE----ITKDGFE 136

Query: 122 GMIDTNVVALINVTQAVLPIFKAKNSGDIVNLGSVA 157
             + TN ++   +T  +LP  K  N G ++ + S+ 
Sbjct: 137 IQLQTNYISHFLLTMRLLPRIKRCN-GRVITVSSIG 171

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,133,994
Number of extensions: 277089
Number of successful extensions: 1089
Number of sequences better than 10.0: 88
Number of HSP's gapped: 1039
Number of HSP's successfully gapped: 99
Length of query: 264
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 164
Effective length of database: 13,134,309
Effective search space: 2154026676
Effective search space used: 2154026676
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)