Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08327g1534151066970.0
AFR562C1444119839190.0
Kwal_26.91641454117838900.0
Scas_594.71703121636140.0
YOR290C (SNF2)170396932730.0
CAGL0M04807g173096731980.0
KLLA0F04521g134486924660.0
AER375C128888024190.0
Kwal_23.4777130180524030.0
Scas_662.7134289023830.0
YIL126W (STH1)135988323410.0
CAGL0G08756g135488323340.0
Scas_665.17106048711891e-141
Scas_652.17102548311651e-138
CAGL0I09614g103948711621e-138
YOR304W (ISW2)112049811631e-137
CAGL0C01683g111548711611e-137
AFR537W102549011531e-136
Kwal_14.1600110248411471e-135
Kwal_34.15925102548811261e-133
YBR245C (ISW1)112957711231e-131
KLLA0F24838g106248511131e-130
Scas_597.8106549011011e-129
AFL040W108648111021e-129
KLLA0F06710g109648410951e-128
Kwal_56.23442143551010801e-123
CAGL0L11770g147651410621e-120
KLLA0C17578g152550910571e-119
Scas_576.6145752510511e-119
YER164W (CHD1)146851410371e-117
AGR123C142251410251e-116
YFR038W8535539441e-109
CAGL0J02662g8445859351e-108
ADL098C8045539251e-107
Kwal_47.180778095709131e-105
KLLA0E04048g8265459011e-104
Scas_520.58635518254e-93
AEL256C18665218058e-87
KLLA0F07513g10485497807e-86
CAGL0H05533g19045207951e-85
Scas_549.410795057702e-84
YPL082C (MOT1)18675267843e-84
Sklu_2125.310525177648e-84
Scas_664.918595257809e-84
KLLA0E23804g18735207782e-83
KLLA0E22726g10335267594e-83
AEL065C10255197522e-82
CAGL0I01694g10715027523e-82
YJR035W (RAD26)10855037454e-81
YAL019W (FUN30)11315387412e-80
Kwal_26.712310815497374e-80
CAGL0H06193g11265497369e-80
ACR286C10196037257e-79
Scas_548.410545357268e-79
Kwal_34.160827264746822e-75
CAGL0M01188g14504836644e-70
Scas_669.2013973276546e-69
Kwal_55.2014314943226548e-69
Kwal_27.1138813343566492e-68
KLLA0F21758g15723226484e-68
YDR334W15143266475e-68
ADR309W14863226459e-68
CAGL0E05038g14843586451e-67
YGL150C (INO80)14893406412e-67
AGR379W14143416412e-67
KLLA0E08965g14893336394e-67
Scas_646.3*14563206378e-67
Scas_718.409265405761e-60
YBR073W (RDH54)9246155761e-60
AGL212W9034995671e-59
CAGL0M01958g9204955627e-59
KLLA0A03069g8954865521e-57
AEL297W8954885521e-57
Kwal_27.105139004875492e-57
KLLA0F11814g9315265467e-57
Kwal_14.15378424915402e-56
Scas_668.188754885393e-56
CAGL0I04224g9424845405e-56
YGL163C (RAD54)8984865386e-56
Sklu_1582.22831944141e-44
ADL345C7462092593e-22
Scas_591.107722122413e-20
CAGL0K07766g8302212343e-19
Kwal_23.36607681912281e-18
Scas_721.10011371802272e-18
KLLA0B09240g8001912244e-18
CAGL0A03432g11511292255e-18
YBR114W (RAD16)7902162227e-18
CAGL0G09493g14082782229e-18
KLLA0C05368g16051432211e-17
Kwal_14.186813571262183e-17
KLLA0F17479g11143482156e-17
AAR147W15803542122e-16
YLR032W (RAD5)11691272102e-16
AFR220W10851652058e-16
Sklu_2412.711271252041e-15
YOR191W (RIS1)16193752004e-15
Scas_674.12d13231192004e-15
Kwal_47.177719721251994e-15
Scas_670.139001111441e-08
CAGL0B05049g1470691396e-08
Kwal_47.180598801041387e-08
Sklu_2218.38521041387e-08
Scas_573.915021301387e-08
YGR056W (RSC1)928941361e-07
YLR357W (RSC2)889741333e-07
CAGL0B02816g894831306e-07
YLR247C15561181306e-07
AAL030C15391181271e-06
Kwal_14.128715181181262e-06
KLLA0B13211g915771252e-06
Sklu_2234.21006701208e-06
Scas_478.46001171181e-05
ABL005C849641162e-05
KLLA0A05115g516801135e-05
AEL291C551741101e-04
YKR008W (RSC4)625811082e-04
KLLA0A02959g5591311082e-04
Scas_683.14894851082e-04
CAGL0K04389g934931082e-04
KLLA0F12166g15281191082e-04
CAGL0L02189g556561072e-04
Scas_645.12455801063e-04
AER297C452701054e-04
KLLA0E12617g1300671064e-04
Kwal_56.24776424801045e-04
AER172C1268671055e-04
Sklu_2273.8439801036e-04
YBR081C (SPT7)1332641048e-04
YGR252W (GCN5)439801010.001
AGR333C5041731010.001
Kwal_56.247604331241010.001
CAGL0M01738g1385641000.002
CAGL0F08283g54680990.002
Kwal_26.7948551125970.003
KLLA0A05203g435141970.003
YMR290C (HAS1)505154960.005
Kwal_23.4288492155960.005
Sklu_2432.9147570960.007
Scas_718.29131364950.007
Sklu_2341.7500113940.009
Sklu_2273.4435124920.012
CAGL0C02541g64372930.013
ADR011C107773930.013
Scas_719.2267852920.015
CAGL0I02354g437125910.016
Sklu_2281.461872920.017
CAGL0M13519g49498910.017
KLLA0A09669g49798900.024
Scas_720.17519113900.025
Scas_684.29508103900.026
AER068C56772890.031
YHR169W (DBP8)431129860.070
Scas_645.10437129860.074
KLLA0B03113g66167860.077
KLLA0D13552g104989840.16
CAGL0J01980g105262830.19
YLR399C (BDF1)68680820.22
Kwal_23.417966067820.25
CAGL0H03377g54098810.29
AER301C435124800.37
CAGL0L03846g54498790.49
YIR002C (MPH1)99386790.61
Scas_709.5104659790.63
Kwal_56.24005533116780.68
YGL078C (DBP3)523119780.71
YPR179C (HDA3)655177780.73
CAGL0L06908g439131770.87
KLLA0C15499g50498770.95
Kwal_56.2297415581730.97
Scas_623.5446131761.1
CAGL0G09867g644174761.4
Scas_568.1173979751.8
CAGL0M02717g26297731.9
AFL080W53598741.9
Scas_700.2364097732.4
YDL084W (SUB2)446131723.0
KLLA0E22033g437128713.9
Scas_661.12399117714.0
CAGL0M02035g1481234724.1
YPL119C (DBP1)61797714.2
ADR260C438128714.2
CAGL0M06567g399117705.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08327g
         (1510 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...  2584   0.0  
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...  1514   0.0  
Kwal_26.9164                                                         1503   0.0  
Scas_594.7                                                           1396   0.0  
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...  1265   0.0  
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...  1236   0.0  
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   954   0.0  
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   936   0.0  
Kwal_23.4777                                                          930   0.0  
Scas_662.7                                                            922   0.0  
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   906   0.0  
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   903   0.0  
Scas_665.17                                                           462   e-141
Scas_652.17                                                           453   e-138
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   452   e-138
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   452   e-137
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   451   e-137
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   448   e-136
Kwal_14.1600                                                          446   e-135
Kwal_34.15925                                                         438   e-133
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   437   e-131
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   433   e-130
Scas_597.8                                                            428   e-129
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   429   e-129
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   426   e-128
Kwal_56.23442                                                         420   e-123
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...   413   e-120
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...   411   e-119
Scas_576.6                                                            409   e-119
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...   404   e-117
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...   399   e-116
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   368   e-109
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   364   e-108
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   360   e-107
Kwal_47.18077                                                         356   e-105
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   351   e-104
Scas_520.5                                                            322   4e-93
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   314   8e-87
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   305   7e-86
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   310   1e-85
Scas_549.4                                                            301   2e-84
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   306   3e-84
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           298   8e-84
Scas_664.9                                                            305   9e-84
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   304   2e-83
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   296   4e-83
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   294   2e-82
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   294   3e-82
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   291   4e-81
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   290   2e-80
Kwal_26.7123                                                          288   4e-80
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   288   9e-80
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   283   7e-79
Scas_548.4                                                            284   8e-79
Kwal_34.16082                                                         267   2e-75
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   260   4e-70
Scas_669.20                                                           256   6e-69
Kwal_55.20143                                                         256   8e-69
Kwal_27.11388                                                         254   2e-68
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   254   4e-68
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   253   5e-68
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   253   9e-68
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   253   1e-67
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   251   2e-67
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   251   2e-67
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   250   4e-67
Scas_646.3*                                                           249   8e-67
Scas_718.40                                                           226   1e-60
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   226   1e-60
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   223   1e-59
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   221   7e-59
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...   217   1e-57
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...   217   1e-57
Kwal_27.10513                                                         216   2e-57
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   214   7e-57
Kwal_14.1537                                                          212   2e-56
Scas_668.18                                                           212   3e-56
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...   212   5e-56
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...   211   6e-56
Sklu_1582.2 , Contig c1582 197-1048                                   164   1e-44
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...   104   3e-22
Scas_591.10                                                            97   3e-20
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    95   3e-19
Kwal_23.3660                                                           92   1e-18
Scas_721.100                                                           92   2e-18
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    91   4e-18
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    91   5e-18
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    90   7e-18
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    90   9e-18
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    90   1e-17
Kwal_14.1868                                                           89   3e-17
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    87   6e-17
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    86   2e-16
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    86   2e-16
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    84   8e-16
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          83   1e-15
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    82   4e-15
Scas_674.12d                                                           82   4e-15
Kwal_47.17771                                                          81   4e-15
Scas_670.13                                                            60   1e-08
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    58   6e-08
Kwal_47.18059                                                          58   7e-08
Sklu_2218.3 YLR357W, Contig c2218 5323-7877                            58   7e-08
Scas_573.9                                                             58   7e-08
YGR056W (RSC1) [2019] chr7 (601663..604449) Component of the abu...    57   1e-07
YLR357W (RSC2) [3739] chr12 (841330..843999) Component of the ab...    56   3e-07
CAGL0B02816g complement(271482..274166) similar to sp|Q06488 Sac...    55   6e-07
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    55   6e-07
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    54   1e-06
Kwal_14.1287                                                           53   2e-06
KLLA0B13211g complement(1155757..1158504) similar to sp|Q06488 S...    53   2e-06
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         51   8e-06
Scas_478.4                                                             50   1e-05
ABL005C [587] [Homologous to ScYLR357W (RSC2) - SH; ScYGR056W (R...    49   2e-05
KLLA0A05115g complement(455456..457006) some similarities with s...    48   5e-05
AEL291C [2214] [Homologous to ScYKR008W (RSC4) - SH] (94483..961...    47   1e-04
YKR008W (RSC4) [3264] chr11 (451844..453721) Component of abunda...    46   2e-04
KLLA0A02959g 260627..262306 similar to sp|Q02206 Saccharomyces c...    46   2e-04
Scas_683.14                                                            46   2e-04
CAGL0K04389g 414810..417614 similar to sp|P53236 Saccharomyces c...    46   2e-04
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    46   2e-04
CAGL0L02189g complement(256073..257743) similar to sp|Q02206 Sac...    46   2e-04
Scas_645.12                                                            45   3e-04
AER297C [2799] [Homologous to ScYGR252W (GCN5) - SH] (1182316..1...    45   4e-04
KLLA0E12617g 1118642..1122544 similar to sp|P35177 Saccharomyces...    45   4e-04
Kwal_56.24776                                                          45   5e-04
AER172C [2675] [Homologous to ScYBR081C (SPT7) - SH] (955996..95...    45   5e-04
Sklu_2273.8 YGR252W, Contig c2273 11152-12471                          44   6e-04
YBR081C (SPT7) [270] chr2 complement(401210..405208) Component o...    45   8e-04
YGR252W (GCN5) [2199] chr7 (996873..998192) Catalytic component ...    44   0.001
AGR333C [4644] [Homologous to ScYMR290C (HAS1) - SH] (1352668..1...    44   0.001
Kwal_56.24760                                                          44   0.001
CAGL0M01738g 197743..201900 similar to sp|P35177 Saccharomyces c...    43   0.002
CAGL0F08283g 825860..827500 similar to sp|Q03330 Saccharomyces c...    43   0.002
Kwal_26.7948                                                           42   0.003
KLLA0A05203g complement(462167..463474) highly similar to sp|P38...    42   0.003
YMR290C (HAS1) [4244] chr13 complement(850073..851590) RNA helic...    42   0.005
Kwal_23.4288                                                           42   0.005
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              42   0.007
Scas_718.29                                                            41   0.007
Sklu_2341.7 YMR290C, Contig c2341 11365-12867 reverse complement       41   0.009
Sklu_2273.4 YHR169W, Contig c2273 4981-6288                            40   0.012
CAGL0C02541g 255821..257752 similar to sp|P35817 Saccharomyces c...    40   0.013
ADR011C [1752] [Homologous to ScYIR002C (MPH1) - SH] (721695..72...    40   0.013
Scas_719.22                                                            40   0.015
CAGL0I02354g 209279..210592 highly similar to sp|P38719 Saccharo...    40   0.016
Sklu_2281.4 YLR399C, Contig c2281 8444-10300 reverse complement        40   0.017
CAGL0M13519g complement(1329252..1330736) highly similar to sp|Q...    40   0.017
KLLA0A09669g complement(847036..848529) highly similar to sp|Q03...    39   0.024
Scas_720.17                                                            39   0.025
Scas_684.29                                                            39   0.026
AER068C [2573] [Homologous to ScYLR399C (BDF1) - SH; ScYDL070W (...    39   0.031
YHR169W (DBP8) [2456] chr8 (442180..443475) Essential nucleolar ...    38   0.070
Scas_645.10                                                            38   0.074
KLLA0B03113g 282503..284488 similar to sp|P35817 Saccharomyces c...    38   0.077
KLLA0D13552g 1167506..1170655 similar to sp|P40562 Saccharomyces...    37   0.16 
CAGL0J01980g 194209..197367 similar to sp|P40562 Saccharomyces c...    37   0.19 
YLR399C (BDF1) [3778] chr12 complement(919536..921596) Protein r...    36   0.22 
Kwal_23.4179                                                           36   0.25 
CAGL0H03377g complement(313755..315377) highly similar to sp|P20...    36   0.29 
AER301C [2803] [Homologous to ScYHR169W (DBP8) - SH] (1188485..1...    35   0.37 
CAGL0L03846g join(complement(443151..444414),complement(441680.....    35   0.49 
YIR002C (MPH1) [2667] chr9 complement(357412..360393) Protein wi...    35   0.61 
Scas_709.5                                                             35   0.63 
Kwal_56.24005                                                          35   0.68 
YGL078C (DBP3) [1904] chr7 complement(360289..361860) ATP-depend...    35   0.71 
YPR179C (HDA3) [5593] chr16 complement(893791..895758) Protein o...    35   0.73 
CAGL0L06908g complement(777557..778876) highly similar to sp|Q07...    34   0.87 
KLLA0C15499g complement(1345201..1346715) similar to sp|P20447 S...    34   0.95 
Kwal_56.22974                                                          33   0.97 
Scas_623.5                                                             34   1.1  
CAGL0G09867g complement(942215..944149) similar to sp|Q06623 Sac...    34   1.4  
Scas_568.11                                                            33   1.8  
CAGL0M02717g 309656..310444 some similarities with tr|Q18401 Sac...    33   1.9  
AFL080W [3113] [Homologous to ScYGL078C (DBP3) - SH] complement(...    33   1.9  
Scas_700.23                                                            33   2.4  
YDL084W (SUB2) [784] chr4 (305237..306577) Essential pre-mRNA sp...    32   3.0  
KLLA0E22033g 1959770..1961083 highly similar to sp|Q07478 Saccha...    32   3.9  
Scas_661.12                                                            32   4.0  
CAGL0M02035g 245848..250293 similar to sp|P14284 Saccharomyces c...    32   4.1  
YPL119C (DBP1) [5326] chr16 complement(324410..326263) ATP-depen...    32   4.2  
ADR260C [2001] [Homologous to ScYDL084W (SUB2) - SH] (1152259..1...    32   4.2  
CAGL0M06567g complement(679126..680325) highly similar to sp|Q12...    32   5.1  

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score = 2584 bits (6697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1286/1510 (85%), Positives = 1286/1510 (85%)

Query: 1    MDLEFSPPRREYTREEINRCYLRWQQLRNEHGANVESMKEYQYYTAVLRMAAXXXXXXXX 60
            MDLEFSPPRREYTREEINRCYLRWQQLRNEHGANVESMKEYQYYTAVLRMAA        
Sbjct: 1    MDLEFSPPRREYTREEINRCYLRWQQLRNEHGANVESMKEYQYYTAVLRMAARQQQQRQQ 60

Query: 61   XXXXXXXXXXLQXXXXXXXXXXXXXXXXXXXXXYTPGSNGMGPVAATAVPPPHMSPQVGP 120
                      LQ                     YTPGSNGMGPVAATAVPPPHMSPQVGP
Sbjct: 61   QQQQQQQQQQLQNATTAAAASSASPNNIPTPSAYTPGSNGMGPVAATAVPPPHMSPQVGP 120

Query: 121  QPIAPASGLTVGVXXXXXXXXXXXXXXXXXXXXXXXXXXRSLFTDEQSLLLKAQIQSLKM 180
            QPIAPASGLTVGV                          RSLFTDEQSLLLKAQIQSLKM
Sbjct: 121  QPIAPASGLTVGVNTPASTNSNSNSNSNNNNNNNNASSSRSLFTDEQSLLLKAQIQSLKM 180

Query: 181  MANHMVVPPEIMMVIDRSLTNLLDFKSILLALSADLQAHNAGXXXXXXXXXXXXXXXXXX 240
            MANHMVVPPEIMMVIDRSLTNLLDFKSILLALSADLQAHNAG                  
Sbjct: 181  MANHMVVPPEIMMVIDRSLTNLLDFKSILLALSADLQAHNAGQQMQPPVQQQQQQQQQQN 240

Query: 241  XXXXXKLSPXXXXXXXXXXXXXXXXXXXXXESPVAAASQPLVQNNMPAQLVNTTANINPA 300
                 KLSP                     ESPVAAASQPLVQNNMPAQLVNTTANINPA
Sbjct: 241  NVPQQKLSPQVRQGVKKPVQKVRQPKKGKVESPVAAASQPLVQNNMPAQLVNTTANINPA 300

Query: 301  SPIVTSEPTPMAVQSPMVXXXXXXXXXXXXXXXXXXXXXALLSTYKKQHEDIEKYIDVAS 360
            SPIVTSEPTPMAVQSPMV                     ALLSTYKKQHEDIEKYIDVAS
Sbjct: 301  SPIVTSEPTPMAVQSPMVEPSRPISPPIPDQDPPKQEPPALLSTYKKQHEDIEKYIDVAS 360

Query: 361  PHIMVDCFSYPEQGGIPGSTPLVPPISYTDLLNQQNLSITPSLLPVGLDPRSAMETYQTL 420
            PHIMVDCFSYPEQGGIPGSTPLVPPISYTDLLNQQNLSITPSLLPVGLDPRSAMETYQTL
Sbjct: 361  PHIMVDCFSYPEQGGIPGSTPLVPPISYTDLLNQQNLSITPSLLPVGLDPRSAMETYQTL 420

Query: 421  IALDLDTSLDFCLQQLLESDSQVKDKGELIMDYNAMQLLPLQKAIRGYVLSFEWYQSTLL 480
            IALDLDTSLDFCLQQLLESDSQVKDKGELIMDYNAMQLLPLQKAIRGYVLSFEWYQSTLL
Sbjct: 421  IALDLDTSLDFCLQQLLESDSQVKDKGELIMDYNAMQLLPLQKAIRGYVLSFEWYQSTLL 480

Query: 481  TNIHPNFLSKNRGLNIQDALLTRELFKSRXXXXXXXXXXXXXXXLNSILDRCKSIHDLRI 540
            TNIHPNFLSKNRGLNIQDALLTRELFKSR               LNSILDRCKSIHDLRI
Sbjct: 481  TNIHPNFLSKNRGLNIQDALLTRELFKSRELQQYEKQQLEKSSKLNSILDRCKSIHDLRI 540

Query: 541  DKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQTKDTRIT 600
            DKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQTKDTRIT
Sbjct: 541  DKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQTKDTRIT 600

Query: 601  HLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDLERERID 660
            HLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDLERERID
Sbjct: 601  HLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDLERERID 660

Query: 661  YYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTI 720
            YYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTI
Sbjct: 661  YYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTI 720

Query: 721  SLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKN 780
            SLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKN
Sbjct: 721  SLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKN 780

Query: 781  REFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILT 840
            REFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILT
Sbjct: 781  REFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILT 840

Query: 841  GTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRL 900
            GTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRL
Sbjct: 841  GTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRL 900

Query: 901  HKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKF 960
            HKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKF
Sbjct: 901  HKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKF 960

Query: 961  SSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKAT 1020
            SSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKAT
Sbjct: 961  SSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKAT 1020

Query: 1021 GHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLS 1080
            GHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLS
Sbjct: 1021 GHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLS 1080

Query: 1081 TRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
            TRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL
Sbjct: 1081 TRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140

Query: 1141 DKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1200
            DKAHAKLDIDGKVIQAGKFDNKST                                    
Sbjct: 1141 DKAHAKLDIDGKVIQAGKFDNKSTAEEQEALLRSLLEAEEEEKKRRELGIEEEEQLDDNE 1200

Query: 1201 XXXXLARNENEIKVFQELDAQRIRTQMENGITNRLMENSELPECYNVDIEAKLAEEEKQN 1260
                LARNENEIKVFQELDAQRIRTQMENGITNRLMENSELPECYNVDIEAKLAEEEKQN
Sbjct: 1201 LNEILARNENEIKVFQELDAQRIRTQMENGITNRLMENSELPECYNVDIEAKLAEEEKQN 1260

Query: 1261 VFVGGRGNRERRTAHYSDELSEEQWLRQFEVSENEDEEGDAGPXXXXXXXXXXXXXXXXL 1320
            VFVGGRGNRERRTAHYSDELSEEQWLRQFEVSENEDEEGDAGP                L
Sbjct: 1261 VFVGGRGNRERRTAHYSDELSEEQWLRQFEVSENEDEEGDAGPKRRRRRAAENNAKRAKL 1320

Query: 1321 ETNKELDGPATGTENTPVLDPQESNGDSAPSGVXXXXXXXXXXXXXXXXXXXXXXXVRKN 1380
            ETNKELDGPATGTENTPVLDPQESNGDSAPSGV                       VRKN
Sbjct: 1321 ETNKELDGPATGTENTPVLDPQESNGDSAPSGVIAGKTSIKTAKKTSKGRKKTSTAVRKN 1380

Query: 1381 GRNYLRSADNATKTLKERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPDYY 1440
            GRNYLRSADNATKTLKERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPDYY
Sbjct: 1381 GRNYLRSADNATKTLKERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPDYY 1440

Query: 1441 LLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDAVI 1500
            LLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDAVI
Sbjct: 1441 LLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDAVI 1500

Query: 1501 AKWKEMTNEQ 1510
            AKWKEMTNEQ
Sbjct: 1501 AKWKEMTNEQ 1510

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score = 1514 bits (3919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/1198 (63%), Positives = 897/1198 (74%), Gaps = 43/1198 (3%)

Query: 342  LSTYKKQHEDIEKYIDVASPHIMVDCFSYPEQGGIPGSTPLVPPISYTDLLNQQN---LS 398
            L  Y+K+H +I   +    P ++VD +       +P S P  P + Y  L    +   L 
Sbjct: 227  LDEYRKKHPEILNTL-TCYPAVIVDTY-------MPPSLP--PVVPYDTLFTSSSSPKLM 276

Query: 399  ITPSLLPVGLDPRSAMETYQTLIALDLDTSLDFCLQQLLESDSQVKDKGELIMDYNAMQL 458
            + P +LP G+D  SAME YQTLIALD+DTS+D  L +LL+S    ++K + ++ Y+A+QL
Sbjct: 277  LQPGILPTGIDVHSAMEVYQTLIALDIDTSVDDALYKLLDSSLSKQEKEDALLQYSALQL 336

Query: 459  LPLQKAIRGYVLSFEWYQSTLLTNIHPNFLSKNRGLNIQDALLTRELFKSRXXXXXXXXX 518
            LPLQKA+RG++L F+W+Q+TLLTN HPNFLSK R +N+QDALLT +L++           
Sbjct: 337  LPLQKAVRGHILQFDWFQNTLLTNTHPNFLSKIRKINVQDALLTNDLYQRHEMQLDERKK 396

Query: 519  XXXXXXLNSILDRCKSIHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQA 578
                  L +I++   +  + R+D++A R+K  HRLI +H NLEKEE KR+ERNA+QRLQA
Sbjct: 397  FEKSAKLETIMEYSVNWFNQRMDRRAARIKFSHRLITVHNNLEKEEQKRVERNARQRLQA 456

Query: 579  LKANDEEAYIKLLDQTKDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELS 638
            LK+NDEEAYIKLLDQTKDTRITHLLKQTN FLDSLT+AVKDQQ  T+ KI SH++ +  S
Sbjct: 457  LKSNDEEAYIKLLDQTKDTRITHLLKQTNAFLDSLTRAVKDQQKHTQAKISSHVEEEHAS 516

Query: 639  EDNVGDKNGADSDDDLERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSL 698
            E+    ++  D DDD ERE+IDYYEVAH IKE+V+ QPSILVGGTLKEYQLKGLQWMVSL
Sbjct: 517  EEAAKLQSDMDVDDD-EREKIDYYEVAHRIKEDVRVQPSILVGGTLKEYQLKGLQWMVSL 575

Query: 699  FNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPK 758
            FNNHLNGILADEMGLGKTIQTISLLTYLYE KG+HGPFLVIVPLSTLTNWNAEFDKWAP 
Sbjct: 576  FNNHLNGILADEMGLGKTIQTISLLTYLYEFKGIHGPFLVIVPLSTLTNWNAEFDKWAPT 635

Query: 759  LRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKN 818
            LRK+AFKGPP ERK    +IK+  FDVVLTTFEYIIKERPLLSK+KWVH IIDEGHRMKN
Sbjct: 636  LRKLAFKGPPSERKALSGIIKSGNFDVVLTTFEYIIKERPLLSKVKWVHMIIDEGHRMKN 695

Query: 819  AQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFA 878
            AQSKLSLTLN YYH+DYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFA
Sbjct: 696  AQSKLSLTLNQYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFA 755

Query: 879  NTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHK 938
            NTGGQDKI LSEEETLLVIRRLHKVLRPFLLRRLKKDVEK+LPDKVEKVLKC+MSALQ K
Sbjct: 756  NTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVLKCRMSALQQK 815

Query: 939  LYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETND 998
            LY+QMLKHRRLF+ DD S++K    RGFNNQIMQL+KICNHPFVFEEVEDQINP RETN 
Sbjct: 816  LYEQMLKHRRLFVVDDPSSKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQINPNRETNA 875

Query: 999  TIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSD 1058
             IWR AGKFELLE+ILPKFKA+GHRVLIFFQMTQ+MDIMEDFLR+ DMKYLRLDGHTKSD
Sbjct: 876  NIWRVAGKFELLEKILPKFKASGHRVLIFFQMTQIMDIMEDFLRFCDMKYLRLDGHTKSD 935

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
            DRTALLN FNAP SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI
Sbjct: 936  DRTALLNKFNAPGSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 995

Query: 1119 GQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXXXXXXX 1178
            GQKNEVRILRLITDNSVEE IL++AH KLDIDGKVIQAGKFDNKST              
Sbjct: 996  GQKNEVRILRLITDNSVEEVILERAHRKLDIDGKVIQAGKFDNKSTAEEQEALLRSLLEA 1055

Query: 1179 XXXXXXXXXXXXXXXXXXXXXXXXXXLARNENEIKVFQELDAQRIRTQMENGITNRLMEN 1238
                                      LARN+NE+K+F E+DA+R R Q  +GIT+RLME+
Sbjct: 1056 EEEQKRKREMGVAEDEQLDDSELNEILARNDNELKLFAEIDAERNRKQFADGITSRLMED 1115

Query: 1239 SELPECYNVDIEAKLAEEEKQNVFVGGRGNRERRTAHYSDELSEEQWLRQFEVSENE--- 1295
            SELPE Y+ DI+A+L +E  + +FVGGRG RER+  HY D +SEEQWL+QFEVS+ E   
Sbjct: 1116 SELPEFYHQDIDAQLEKENSERMFVGGRGTRERKATHYGDSMSEEQWLKQFEVSDEELEA 1175

Query: 1296 -----------------DEEGDAGPXXXXXX-XXXXXXXXXXLETNKELDGPATGT--EN 1335
                             DE+G   P                 L+ + E++ P + T  ++
Sbjct: 1176 DALERLSTGGSNVSMTNDEDGMPLPLKRKRGPGRPPKNKRVKLDDDSEVENPLSQTTIDD 1235

Query: 1336 TPV----LDPQESNGDSAPSGVXXXXXXXXXXXXXXXXXXXXXXXVRKNGRNYLRSADNA 1391
            +PV     D    N  ++P                            KNGR Y R     
Sbjct: 1236 SPVNGNGKDVAIQNNANSPEDRVTTSLKSVRSGKTKPKLKGRRGRPAKNGRIYSREMPKQ 1295

Query: 1392 TKTLKERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFEN 1451
             + +  R+EI+ +++ELYDY + YRN + R L++IFLVKPSK+LYPDYYLLI+YPAAFE+
Sbjct: 1296 PEAV--REEIAAQSKELYDYILSYRNEEGRNLAEIFLVKPSKKLYPDYYLLIRYPAAFED 1353

Query: 1452 VMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDAVIAKWKEMTNE 1509
            V +HI+   YDS+K+VVEDFHLIFANAR+YNTE S I+ DS+ELEDAV+ K++E++ +
Sbjct: 1354 VTRHIEAKAYDSIKEVVEDFHLIFANARVYNTEGSTIYNDSIELEDAVVQKYRELSGD 1411

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 2/52 (3%)

Query: 1  MDLEFSPPRREYTREEINRCYLRWQQLRNEHGANVESMKEYQYYTAVLRMAA 52
          MD+E   P+R  T+EEINRCYLRWQQLRN+HG N  ++ E+ Y+T VLR AA
Sbjct: 1  MDMEI--PQRALTKEEINRCYLRWQQLRNQHGENASTIPEFIYFTRVLRHAA 50

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 163 FTDEQSLLLKAQIQSLKMMANHMVVPPEIMMVIDRSLTNLLDFKSILLALSADLQAHNA 221
           FT EQS LLKAQI +LK +A+   +P E++ VI  SL N  + + ++  +S+ L   +A
Sbjct: 104 FTMEQSELLKAQIAALKCLAHKQPIPKEVLEVIQLSLNNPPNLRQMVTMVSSVLAQRSA 162

>Kwal_26.9164
          Length = 1454

 Score = 1503 bits (3890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 762/1178 (64%), Positives = 880/1178 (74%), Gaps = 31/1178 (2%)

Query: 342  LSTYKKQHEDIEKYIDVASPHIMVDCFSYPEQGGIPGSTPLVPPISYTDLL---NQQNLS 398
            L  YKK H DI+K +DV +P ++VD +S P+   +P       PI Y  L       ++ 
Sbjct: 262  LDDYKKMHPDIDKIVDVTAPSMIVDSYSLPQ---LPAE-----PIEYRKLFPSAEAPHIL 313

Query: 399  ITPSLLPVGLDPRSAMETYQTLIALDLDTSLDFCLQQLLESDSQVKDKGELIMDYNAMQL 458
            + P +LP G+D  SAME YQTLIALD+DT++D CL  +L  D     K     DY A+QL
Sbjct: 314  LKPGILPPGVDIHSAMEIYQTLIALDIDTAVDNCLSDILNDDIDKGTKECATYDYYALQL 373

Query: 459  LPLQKAIRGYVLSFEWYQSTLLTNIHPNFLSKNRGLNIQDALLTRELFKSRXXXXXXXXX 518
            LPLQKAIRG+VL F+WYQ TLLTN HPNFLSK R +N+ DALLT +L+K           
Sbjct: 374  LPLQKAIRGHVLQFDWYQKTLLTNTHPNFLSKIRRINLHDALLTDDLYKRYEIMQYERQR 433

Query: 519  XXXXXXLNSILDRCKSIHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQA 578
                  L SI D     ++ R++++ QRVK GHRLI+LH N+EKEE KR+ERNAKQRLQA
Sbjct: 434  YEKSTKLKSITDCSIEYYNNRLNRRTQRVKFGHRLISLHGNIEKEEQKRMERNAKQRLQA 493

Query: 579  LKANDEEAYIKLLDQTKDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHL---DTQ 635
            LKANDEEAYIKLLDQTKDTRITHLLKQTN FLDSLTKAVK QQ +TK+KI+SH+   + +
Sbjct: 494  LKANDEEAYIKLLDQTKDTRITHLLKQTNAFLDSLTKAVKSQQQYTKEKIDSHMQKDNDE 553

Query: 636  ELSEDNVGDKNGADSDDDLERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWM 695
            E      G  +  D  D+ ER+ IDYY VAH IKEE+KQQPSILVGGTLKEYQLKGLQWM
Sbjct: 554  ERETVEQGPVSALDVPDEEERQNIDYYNVAHRIKEEIKQQPSILVGGTLKEYQLKGLQWM 613

Query: 696  VSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKW 755
            VSL+NNHLNGILADEMGLGKTIQTISLLTYLYE K V GP LVIVPLSTLTNW++EFDKW
Sbjct: 614  VSLYNNHLNGILADEMGLGKTIQTISLLTYLYEVKNVRGPSLVIVPLSTLTNWDSEFDKW 673

Query: 756  APKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHR 815
            AP +RK+A+KG P ERK KQ +I++ +FDVVLTTFEYIIKER LLSKIKWVH IIDEGHR
Sbjct: 674  APVIRKVAYKGSPNERKSKQGIIRSGQFDVVLTTFEYIIKERALLSKIKWVHMIIDEGHR 733

Query: 816  MKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNT 875
            MKNAQSKLSLTLN YYH+DYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNT
Sbjct: 734  MKNAQSKLSLTLNNYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNT 793

Query: 876  PFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSAL 935
            PFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEK+LPDKVEKVLKCKMSAL
Sbjct: 794  PFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVLKCKMSAL 853

Query: 936  QHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARE 995
            Q KLY+QMLKHRRLFI D +SN K    RGFNNQIMQL+KICNHPFVFEEVEDQINP RE
Sbjct: 854  QQKLYEQMLKHRRLFIGDLNSN-KNVGMRGFNNQIMQLKKICNHPFVFEEVEDQINPTRE 912

Query: 996  TNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHT 1055
            TN  IWR AGKFELLERILPKFKATGHR+LIFFQMTQ+MDIMEDFLR  +MKYLRLDGHT
Sbjct: 913  TNANIWRVAGKFELLERILPKFKATGHRILIFFQMTQIMDIMEDFLRLSNMKYLRLDGHT 972

Query: 1056 KSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRA 1115
            KSDDRT LLN FNAPNS+YFCFLLSTRAGGLGLNLQ+ADTVIIFDTDWNPHQDLQAQDRA
Sbjct: 973  KSDDRTLLLNLFNAPNSEYFCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRA 1032

Query: 1116 HRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXXXX 1175
            HRIGQKNEVRILRLIT+NSVEE ILD+AH KLDIDGKVIQAGKFDNKST           
Sbjct: 1033 HRIGQKNEVRILRLITENSVEEVILDRAHKKLDIDGKVIQAGKFDNKSTSEEQEALLRSL 1092

Query: 1176 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLARNENEIKVFQELDAQRIRTQMENGITNRL 1235
                                         LAR+E EIK+F E+D +R R  +ENGIT  L
Sbjct: 1093 LEAEEEQKRKRELGLEEDEQMDDNELNETLARSEAEIKIFAEIDEERSRRHLENGITTTL 1152

Query: 1236 MENSELPECYNVDIEAKLAEEEKQNVFVGGRGNRERRTAHYSDELSEEQWLRQFEVSENE 1295
            MENSELP  Y+ DIEA+L +++ + +  GGRG RERR+A+Y D+++EEQWL+QFEVS+ E
Sbjct: 1153 MENSELPNFYHQDIEAELDKKQNEGLLTGGRGTRERRSANYDDDITEEQWLKQFEVSDGE 1212

Query: 1296 DEEGDAGPXXXXXXXXXXXXXXXXLETNKELDGPATGTENTPVLD-PQESNGDSAPSGVX 1354
             EE D                   LET +  +           LD  +E++G S P  V 
Sbjct: 1213 -EETDTDTRKREASEARVPTKRAKLETEEPFE-----------LDVKEEADGSSPPPTVG 1260

Query: 1355 XXXXXXXXXXX---XXXXXXXXXXXVRKNGRNYLRSADNATKTLKERQEISQKARELYDY 1411
                                       KNGR Y+R  D  T   +ER++++ +A+ L+ +
Sbjct: 1261 QTSMKSTKDVKGRPRGRARTPRNTNKGKNGRTYVRDPDLVTIPSEEREKVTAQAKTLHSF 1320

Query: 1412 AVYYRNADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDF 1471
            AV Y + D RRL+DIFLVKPSK+LYPDYY+LIKYP A E V +HI+   Y +L++V++D 
Sbjct: 1321 AVDYCDEDGRRLADIFLVKPSKKLYPDYYMLIKYPVALETVSRHIETQAYSTLREVLDDL 1380

Query: 1472 HLIFANARIYNTEDSIIFRDSLELEDAVIAKWKEMTNE 1509
            HLIF NAR+YNTEDS+I+ DS+ELE+A+I K+KEM+ E
Sbjct: 1381 HLIFFNARVYNTEDSLIYHDSIELENAIIDKYKEMSGE 1418

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 39/57 (68%)

Query: 161 SLFTDEQSLLLKAQIQSLKMMANHMVVPPEIMMVIDRSLTNLLDFKSILLALSADLQ 217
           SLFT EQS LLKAQI SL+ + +   +P ++  VI RSL N  +FK +LLALS  +Q
Sbjct: 106 SLFTPEQSELLKAQIGSLRYLLSRQPIPQDVQDVIQRSLNNPPNFKQMLLALSESVQ 162

>Scas_594.7
          Length = 1703

 Score = 1396 bits (3614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/1216 (58%), Positives = 858/1216 (70%), Gaps = 57/1216 (4%)

Query: 341  LLSTYKKQHEDIEKYIDVASPHIMVDCFSYPEQGGIPGSTPLVPPISYTDLLNQQNLS-- 398
            LL  +K  H++I++ ++V  P ++VD FS P          +   + Y  L      S  
Sbjct: 472  LLEEFKLLHKEIKEVVNVTDPSMIVDAFSLPN---------METKVDYEKLFPTSETSKQ 522

Query: 399  -ITPSLLPVGLDPRSAMETYQTLIALDLDTSLDFCLQQLLESDSQVKDKGELIMDYNAMQ 457
             I P LLP GLD  SA E Y TL AL++ T++D  L  ++   +  + +   + DY A+Q
Sbjct: 523  EIYPGLLPTGLDVHSATELYHTLTALNIGTTIDAFLNDIVSDKTDEETRCNSLYDYYALQ 582

Query: 458  LLPLQKAIRGYVLSFEWYQSTLLTNIHPNFLSKNRGLNIQDALLTRELFKSRXXXXXXXX 517
            LLPLQKA+RG+VL FEWYQ++LL N HPNFLSK R +N+ D + TREL++          
Sbjct: 583  LLPLQKAVRGHVLQFEWYQNSLLPNTHPNFLSKVRNINMLDTIFTRELYRRHELVQYQKL 642

Query: 518  XXXXXXXLNSILDRCKSIHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQ 577
                   L SI        +L+ +++ + VK G++  N+H  +EK+E +R+ER AK+RLQ
Sbjct: 643  MVHEERKLRSITHSSVVQFNLKNERRNRHVKTGNKFFNIHATIEKDEQRRVERKAKERLQ 702

Query: 578  ALKANDEEAYIKLLDQTKDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQEL 637
            ALKANDEEAYIKLLDQTKDTRITHLLKQTN FLDSLT+AVKDQQ +TK+ I+SHL     
Sbjct: 703  ALKANDEEAYIKLLDQTKDTRITHLLKQTNAFLDSLTRAVKDQQKYTKEMIDSHLLEASE 762

Query: 638  SEDNVGDK----NGADSDDDLERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQ 693
             + +V          D +D  E+   DYY VAH IKEE++QQP++LVGGTLKEYQLKGLQ
Sbjct: 763  EDKSVSPSMPVATFPDEEDGEEKGNFDYYSVAHRIKEEIRQQPAMLVGGTLKEYQLKGLQ 822

Query: 694  WMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFD 753
            WMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYE K +HGP+LVIVPLSTL+NW+ EF 
Sbjct: 823  WMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYETKHIHGPYLVIVPLSTLSNWSNEFA 882

Query: 754  KWAPKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEG 813
            KWAP +R I++KG P ERK K A+IK+ EFDVVLTTFEYIIKER LLSK+KW+H IIDEG
Sbjct: 883  KWAPTMRCISYKGSPNERKSKHAIIKSGEFDVVLTTFEYIIKERALLSKVKWIHMIIDEG 942

Query: 814  HRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWF 873
            HRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNF LPKIFNSVKSFDEWF
Sbjct: 943  HRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFALPKIFNSVKSFDEWF 1002

Query: 874  NTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMS 933
            NTPFANTGGQDKI LSEEETLLVIRRLHKVLRPFLLRRLKKDVEK+LPDKVEKV+KCKMS
Sbjct: 1003 NTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMS 1062

Query: 934  ALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPA 993
            ALQ  +YQQMLK+RRLFI  D +N+K    RGFNNQ+MQL+KICNHPFVFEEVEDQINP 
Sbjct: 1063 ALQQIMYQQMLKYRRLFI-GDHTNKKMVGLRGFNNQLMQLKKICNHPFVFEEVEDQINPT 1121

Query: 994  RETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDG 1053
            RETN  IWR AGKFELLE++LPK KATGHRVLIFFQMTQ+MDI+EDFLR++D+KYLRLDG
Sbjct: 1122 RETNANIWRVAGKFELLEKVLPKLKATGHRVLIFFQMTQIMDIVEDFLRFIDIKYLRLDG 1181

Query: 1054 HTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQD 1113
            HTKSDDR+ LL  FNAP+S+Y CF+LSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQD
Sbjct: 1182 HTKSDDRSNLLKLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQD 1241

Query: 1114 RAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXX 1173
            RAHRIGQKNEVRILRLIT++SVEEAIL++AH KLDIDGKVIQAGKFDNKST         
Sbjct: 1242 RAHRIGQKNEVRILRLITEHSVEEAILERAHKKLDIDGKVIQAGKFDNKSTSEEQEALLR 1301

Query: 1174 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLARNENEIKVFQELDAQRIRTQMENGITN 1233
                                           LARN+ E+++F +LD +R++   E G+ +
Sbjct: 1302 SLLEAEEERKQRRVKGLPDEEEMGDNELNELLARNDGELEIFHDLDVERLKRDSERGLKS 1361

Query: 1234 RLMENSELPECYNVDIEAKLAEEEKQNVFV-GGRGNRERRTAHYSDELSEEQWLRQFEVS 1292
            RL+ N ELPE Y+ DIE +L +E+ +   V  GRG RER+   YS+ ++E+QWL+QFEVS
Sbjct: 1362 RLLANDELPEVYHQDIEKELEKEQSEAAAVYSGRGARERKATTYSENVTEDQWLQQFEVS 1421

Query: 1293 ENED---------EEG--DAGPXXXXXXXXXXXXXXXXLETNKELDGPAT-------GTE 1334
            ++ED         +EG  DA                   + + E D P           E
Sbjct: 1422 DHEDNDNNGNNSMDEGSLDANGNPRKRKTARSRGKSKRAKLSGESDAPENTIPESPMTVE 1481

Query: 1335 NTP----------VLDPQE---SNGDSAPSGVXXXXXXXXXXXXXXXXXXXXXXXVR--- 1378
            NTP          V  P E   S G    +G                         +   
Sbjct: 1482 NTPNEELHSSPDLVSSPVEIPLSTGAPTTAGKTSIKSARTSTKGRSKIRAKGRSRAKGRS 1541

Query: 1379 -----KNGRNYLRSADNATKTLKERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSK 1433
                 KNG  Y+R+A  A + L+ R+ +S+ A+ LYD+AV Y N+D R LS IF+ KPSK
Sbjct: 1542 RQVKPKNGLEYVRTAQAAVEPLQVRENVSKTAQILYDFAVNYENSDGRPLSGIFMTKPSK 1601

Query: 1434 RLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSL 1493
             LYPDYYLLIKYP A+EN+ +HID   Y+ L +V+EDFHL+FANARIYNTEDS++++D++
Sbjct: 1602 TLYPDYYLLIKYPVAYENIQRHIDDKAYNKLFEVLEDFHLVFANARIYNTEDSLVYQDAI 1661

Query: 1494 ELEDAVIAKWKEMTNE 1509
            ELE  +I K+KE++ +
Sbjct: 1662 ELEGVIIEKYKELSKD 1677

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 3  LEFSPPRREYTREEINRCYLRWQQLRNEHGANVESMKEYQYYTAVLRMAA 52
          +E   P R +T+EE+NRCYL+WQQLRN HG N   + E+   T +L+ AA
Sbjct: 1  MEVEIPDRIFTKEEVNRCYLKWQQLRNLHGENAPKIPEFIMCTRILQKAA 50

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 36/53 (67%)

Query: 161 SLFTDEQSLLLKAQIQSLKMMANHMVVPPEIMMVIDRSLTNLLDFKSILLALS 213
           S+FT EQS LLKAQI +LK + N   VP E  +VI +S+    DFK +L++LS
Sbjct: 241 SIFTHEQSTLLKAQITALKCLVNQQQVPRECQVVIQQSIERPPDFKRMLMSLS 293

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score = 1265 bits (3273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/969 (66%), Positives = 749/969 (77%), Gaps = 20/969 (2%)

Query: 342  LSTYKKQHEDIEKYIDVASPHIMVDCFSYPEQGGIPGSTPLVPPISYTDLL---NQQNLS 398
            L+  + Q+++  K +D+  P +MVD F+ P    I  S      I Y  LL   +    +
Sbjct: 427  LNVLQDQYKEGIKVVDIDDPDMMVDSFTMP---NISHSN-----IDYQTLLANSDHAKFT 478

Query: 399  ITPSLLPVGLDPRSAMETYQTLIALDLDTSLDFCLQQLLESDSQVKDKGELIMDYNAMQL 458
            I P +LPVG+D  +A + YQTLIAL+LDT+++ CL +LL  +     +   + DY A+QL
Sbjct: 479  IEPGVLPVGIDTHTATDIYQTLIALNLDTTVNDCLDKLLNDECTESTRENALYDYYALQL 538

Query: 459  LPLQKAIRGYVLSFEWYQSTLLTNIHPNFLSKNRGLNIQDALLTRELFKSRXXXXXXXXX 518
            LPLQKA+RG+VL FEW+Q++LLTN HPNFLSK R +N+QDALLT +L+K+          
Sbjct: 539  LPLQKAVRGHVLQFEWHQNSLLTNTHPNFLSKIRNINVQDALLTNQLYKNHELLKLERKK 598

Query: 519  XXXXXXLNSILDRCKSIHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQA 578
                  L S+     + ++ R DKK +R+K GHRLI  HTNLE++E KR E+ AK+RLQA
Sbjct: 599  TEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEKKAKERLQA 658

Query: 579  LKANDEEAYIKLLDQTKDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELS 638
            LKANDEEAYIKLLDQTKDTRITHLL+QTN FLDSLT+AVKDQQ +TK+ I+SH+  +E S
Sbjct: 659  LKANDEEAYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHI--KEAS 716

Query: 639  ED-----NVGDKNGADSDDDLERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQ 693
            E+      V      + DDD +   +DYY VAH IKE++K+QPSILVGGTLK+YQ+KGLQ
Sbjct: 717  EEVDDLSMVPKMKDEEYDDDDDNSNVDYYNVAHRIKEDIKKQPSILVGGTLKDYQIKGLQ 776

Query: 694  WMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFD 753
            WMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYE K + GP+LVIVPLSTL+NW++EF 
Sbjct: 777  WMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFA 836

Query: 754  KWAPKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEG 813
            KWAP LR I+FKG P ERK KQA I+  EFDVVLTTFEYIIKER LLSK+KWVH IIDEG
Sbjct: 837  KWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEG 896

Query: 814  HRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWF 873
            HRMKNAQSKLSLTLNT+YH+DYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWF
Sbjct: 897  HRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWF 956

Query: 874  NTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMS 933
            NTPFANTGGQDKI LSEEETLLVIRRLHKVLRPFLLRRLKKDVEK+LPDKVEKV+KCKMS
Sbjct: 957  NTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMS 1016

Query: 934  ALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPA 993
            ALQ  +YQQMLK+RRLFI  D +N+K    RGFNNQIMQL+KICNHPFVFEEVEDQINP 
Sbjct: 1017 ALQQIMYQQMLKYRRLFI-GDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQINPT 1075

Query: 994  RETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDG 1053
            RETND IWR AGKFELL+RILPK KATGHRVLIFFQMTQ+MDIMEDFLRY+++KYLRLDG
Sbjct: 1076 RETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDG 1135

Query: 1054 HTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQD 1113
            HTKSD+R+ LL  FNAP+S+Y CF+LSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQD
Sbjct: 1136 HTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQD 1195

Query: 1114 RAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXX 1173
            RAHRIGQKNEVRILRLIT NSVEE IL++A+ KLDIDGKVIQAGKFDNKST         
Sbjct: 1196 RAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQEALLR 1255

Query: 1174 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLARNENEIKVFQELDAQRIRTQMENGITN 1233
                                           LARN+ E+ V   +D  R + + E G+ +
Sbjct: 1256 SLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRSKKEEELGVKS 1315

Query: 1234 RLMENSELPECYNVDIEAKLAEEEKQNVFV-GGRGNRERRTAHYSDELSEEQWLRQFEVS 1292
            RL+E SELP+ Y+ DI A+L  EE ++  V  GRG RER+TA Y+D +SEEQWLRQFEVS
Sbjct: 1316 RLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQFEVS 1375

Query: 1293 ENEDEEGDA 1301
            ++E  +  A
Sbjct: 1376 DDEKNDKQA 1384

 Score =  150 bits (379), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 97/128 (75%)

Query: 1379 KNGRNYLRSADNATKTLKERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPD 1438
            +NG +Y+R+   AT  +  R++++++A +LY +A+ Y N   R+LSDIFL KPSK LYPD
Sbjct: 1528 RNGLDYVRTPAAATSPIDIREKVAKQALDLYHFALNYENEAGRKLSDIFLSKPSKALYPD 1587

Query: 1439 YYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDA 1498
            YY++IKYP AF+N+  HI+   Y+SLK+ ++DFHLIF+NARIYNTE S+++ DSLELE  
Sbjct: 1588 YYMIIKYPVAFDNINTHIETLAYNSLKETLQDFHLIFSNARIYNTEGSVVYEDSLELEKV 1647

Query: 1499 VIAKWKEM 1506
            V  K+ E+
Sbjct: 1648 VTKKYCEI 1655

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (77%)

Query: 8  PRREYTREEINRCYLRWQQLRNEHGANVESMKEYQYYTAVLRMAA 52
          P+R+++ EE+NRCYLRWQ LRNEHG N  S+ E+ Y T VL+ AA
Sbjct: 4  PQRQFSNEEVNRCYLRWQHLRNEHGMNAPSVPEFIYLTKVLQFAA 48

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 36/53 (67%)

Query: 161 SLFTDEQSLLLKAQIQSLKMMANHMVVPPEIMMVIDRSLTNLLDFKSILLALS 213
           ++FT EQS LLKAQI SLK + N   +P E   VI +S+ +  DFK +LL+LS
Sbjct: 246 TMFTAEQSELLKAQITSLKCLVNRKPIPFEFQAVIQKSINHPPDFKRMLLSLS 298

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score = 1236 bits (3198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/967 (64%), Positives = 730/967 (75%), Gaps = 34/967 (3%)

Query: 352  IEKY------IDVASPHIMVDCFSYPEQGGIPGSTPLVPPISYTDLL-NQQN--LSITPS 402
            +EKY      + +  P +MVD FS P    IP       P+ Y  L  N  N  L + P 
Sbjct: 463  VEKYPYVKNVVSIEDPDLMVDTFSIP---TIPEE-----PVDYYSLFPNTANPKLVMEPG 514

Query: 403  LLPVGLDPRSAMETYQTLIALDLDTSLDFCLQQLLESDSQVKDKGELIMDYNAMQLLPLQ 462
            +LP G+D  +A + YQTLIAL+LDTS++ C+  +L+       K E + DY A+QLLPLQ
Sbjct: 515  MLPAGVDIHTATDIYQTLIALNLDTSVNECISDMLDDSKDENTKEETLYDYFALQLLPLQ 574

Query: 463  KAIRGYVLSFEWYQSTLLTNIHPNFLSKNRGLNIQDALLTRELFKSRXXXXXXXXXXXXX 522
            KA+RG+VL +EWYQ++LLTN HPNFLSK R +N  D LLT EL++ R             
Sbjct: 575  KAVRGHVLQYEWYQNSLLTNAHPNFLSKIRNINFNDVLLTIELYRKREVIRQEEESKRYQ 634

Query: 523  XXLNSILDRCKSIHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQALKAN 582
              L  I +   +  + ++ ++ +R+KLGH+L+  H N+EKEE KR ER AK+RLQALKAN
Sbjct: 635  QKLTRIRNSVVNTFNHKVHRRNKRIKLGHKLVATHANIEKEEQKRAERKAKERLQALKAN 694

Query: 583  DEEAYIKLLDQTKDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHL-DTQELSEDN 641
            DEEAYIKLLDQTKDTRITHLLKQTN FLDSLTKAVKDQQ +TKD +  HL + +E S + 
Sbjct: 695  DEEAYIKLLDQTKDTRITHLLKQTNAFLDSLTKAVKDQQKYTKDMLNQHLMEKKEESAEP 754

Query: 642  VGDKNGADSDDDL----------ERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKG 691
            V       +DD +          + E IDYY VAH IKEEV+QQPSILVGGTLKEYQ+KG
Sbjct: 755  V-----VYNDDQMLTMSMNDDDDDEENIDYYNVAHRIKEEVRQQPSILVGGTLKEYQIKG 809

Query: 692  LQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAE 751
            LQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYE K + GPFL+IVPLSTL NW++E
Sbjct: 810  LQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIKGPFLIIVPLSTLPNWSSE 869

Query: 752  FDKWAPKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIID 811
            F KWAPKLR I++KG P ERK KQA IK+ EFD V+TTFEYIIKER +LSK+KWVH IID
Sbjct: 870  FAKWAPKLRTISYKGSPNERKMKQAQIKSGEFDAVITTFEYIIKERAILSKVKWVHMIID 929

Query: 812  EGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDE 871
            EGHRMKNAQSKLSLTLNT+YHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNS KSFDE
Sbjct: 930  EGHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAKSFDE 989

Query: 872  WFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCK 931
            WFNTPFANTGGQDKI LSEEETLL+IRRLHKVLRPFLLRRLKKDVEK+LPDKVEKV+KCK
Sbjct: 990  WFNTPFANTGGQDKIELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKCK 1049

Query: 932  MSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQIN 991
            MSALQH +YQQMLKH++LFI D   N K    RGFNNQ+MQL+KICNHPFVFEEVED IN
Sbjct: 1050 MSALQHAMYQQMLKHKQLFIGDQKKN-KLVGLRGFNNQLMQLKKICNHPFVFEEVEDHIN 1108

Query: 992  PARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRL 1051
            P R+TN  IWR AGKFELLERILPK KA+ HRVLIFFQMTQ+MDIMEDFLRY+D+KYLRL
Sbjct: 1109 PTRDTNMNIWRVAGKFELLERILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYLRL 1168

Query: 1052 DGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQA 1111
            DGHT+SD+R  LL  FN PNS+YFCF+LSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQA
Sbjct: 1169 DGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQA 1228

Query: 1112 QDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXX 1171
            QDRAHRIGQKNEVRI+RLIT NSVEE IL++A+ KLDIDGKVIQAGKFDNKST       
Sbjct: 1229 QDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTAEEQEAL 1288

Query: 1172 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLARNENEIKVFQELDAQRIRTQMENGI 1231
                                             LAR+E+++ +F +LD +R        I
Sbjct: 1289 LRSLLEAEEGRRRRREAGIEEEEELRDNEINEILARSEDDLALFSKLDTEREEADKAMHI 1348

Query: 1232 TNRLMENSELPECYNVDIEAKLAEEEKQNVFVGGRGNRERRTAHYSDELSEEQWLRQFEV 1291
             +RLM   ELPE Y+ +I+ +L +EE ++    GRG RER+   YSD +SEEQWL+QFEV
Sbjct: 1349 NSRLMTLDELPEIYHRNIDEELKKEESESAETYGRGTRERKQMIYSDNMSEEQWLKQFEV 1408

Query: 1292 SENEDEE 1298
            S++ED++
Sbjct: 1409 SDSEDKD 1415

 Score =  159 bits (401), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 103/131 (78%)

Query: 1379 KNGRNYLRSADNATKTLKERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPD 1438
            KNG  Y+R       + +ER+ I+++A +LYD+A+ Y N+D+RRLSDIFLVKPSK LYPD
Sbjct: 1559 KNGMVYVRMLPEDPVSEEERKGIAEQATKLYDFALNYVNSDERRLSDIFLVKPSKHLYPD 1618

Query: 1439 YYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDA 1498
            YYL+IKYP AF+ +   ID   Y+S+ +V+EDFHL+FANAR+YNTE SII+ D++ELEDA
Sbjct: 1619 YYLIIKYPIAFDTIKDAIDRLQYNSITEVMEDFHLMFANARVYNTEGSIIYEDAIELEDA 1678

Query: 1499 VIAKWKEMTNE 1509
            ++ K+ E+TN+
Sbjct: 1679 MLQKYVEITND 1689

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 36/45 (80%)

Query: 8  PRREYTREEINRCYLRWQQLRNEHGANVESMKEYQYYTAVLRMAA 52
          P+R+ T+EEINRCYL+WQQLRNEHG N  ++ E+ + T +L +AA
Sbjct: 6  PQRQLTKEEINRCYLKWQQLRNEHGKNAANVPEFIHLTKILHVAA 50

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 37/53 (69%)

Query: 161 SLFTDEQSLLLKAQIQSLKMMANHMVVPPEIMMVIDRSLTNLLDFKSILLALS 213
           S+FT +QS LL+AQI +LK + N+  VP E   VI +S+ N  DFK +LL+LS
Sbjct: 223 SIFTPQQSELLRAQISALKSLVNNQPVPQEYQKVIQQSINNPPDFKRMLLSLS 275

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, start by similarity
          Length = 1344

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/869 (57%), Positives = 613/869 (70%), Gaps = 52/869 (5%)

Query: 450  IMDYNAMQLLPLQKAIRGYVL-SFEWYQSTLLTNIH--PNFLSKNRGLNI-------QDA 499
            +++  ++++L  QK++R  ++ S       ++ ++   P  L+  R +++       Q A
Sbjct: 285  LVELKSLKMLTKQKSLRKRLIESVAAKSHNIIPSLRDSPYTLAAQRSIHVRPKTIVPQTA 344

Query: 500  LLTRELFKSRXXXXXXXXXXXXXXXLNSILDRCKSIHDLRIDKKAQR---VKLGHRLINL 556
             L  EL +                 +N+I+    SI++   +   QR    ++G  + NL
Sbjct: 345  RLAEELERQELVESRRRERNLRLQRINNIVS---SINERLENDTTQRDRCYQMGRSIGNL 401

Query: 557  HTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQTKDTRITHLLKQTNTFLDSLTKA 616
            H +LEK+E +R+ER AKQRL ALK+NDEEAY+KLLDQTKDTRITHLLKQTN+FLDSL +A
Sbjct: 402  HGHLEKDEQRRMERTAKQRLAALKSNDEEAYLKLLDQTKDTRITHLLKQTNSFLDSLAQA 461

Query: 617  VKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDLERERIDYYEVAHSIKEEVKQQP 676
            V+ QQ+  + K               G++    +D+  ERE+IDYYEV+H IKE V +QP
Sbjct: 462  VRVQQNEVRIK--------------RGEEIPPITDE--EREKIDYYEVSHRIKETVDKQP 505

Query: 677  SILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPF 736
            SILVGGTLKEYQLKGL+WMVSL+NNHLNGILADEMGLGKTIQ+ISL++YLYE K    PF
Sbjct: 506  SILVGGTLKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSISLISYLYEIKNERQPF 565

Query: 737  LVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYIIKE 796
            LVIVPLST+TNW  EF+KWAP LR I +KG P +RK  Q  IK   FDVVLTT+EYIIK+
Sbjct: 566  LVIVPLSTITNWTIEFEKWAPSLRTIVYKGNPNQRKALQHTIKMGNFDVVLTTYEYIIKD 625

Query: 797  RPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLN 856
            RPLL+K  W H IIDEGHRMKNAQSKLS TL  YY +  RLILTGTPLQNNLPELWALLN
Sbjct: 626  RPLLAKHDWAHMIIDEGHRMKNAQSKLSYTLTHYYKTKNRLILTGTPLQNNLPELWALLN 685

Query: 857  FVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDV 916
            FVLPKIFNS K+FDEWFNTPFANTG Q+K+ ++EEETLLVIRRLHKVLRPFLLRRLKK+V
Sbjct: 686  FVLPKIFNSSKTFDEWFNTPFANTGTQEKLEMTEEETLLVIRRLHKVLRPFLLRRLKKEV 745

Query: 917  EKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKI 976
            EKDLPDKVEKV+KCK+S+LQ +LY+QMLKH   FI   +     +  +G NN++MQLRKI
Sbjct: 746  EKDLPDKVEKVVKCKLSSLQQQLYEQMLKHNAFFIGAGTEGATKAGIKGLNNKVMQLRKI 805

Query: 977  CNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDI 1036
            CNHPFVF+EVE+ INP RE +  ++R +GKFELL+R+LPKFKA+GHRVL+FFQMTQVMDI
Sbjct: 806  CNHPFVFDEVENVINPTRENSSILYRVSGKFELLDRVLPKFKASGHRVLMFFQMTQVMDI 865

Query: 1037 MEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTV 1096
            MEDFLR  D+KY+RLDG TK++DRT +L  FNAP+S+YFCFLLSTRAGGLGLNLQTADTV
Sbjct: 866  MEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGGLGLNLQTADTV 925

Query: 1097 IIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQA 1156
            IIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT +SVEE IL++A  KLDIDGKVIQA
Sbjct: 926  IIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQA 985

Query: 1157 GKFDNKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLARNENEIKVFQ 1216
            GKFDNKST                                        LAR E+E  +F+
Sbjct: 986  GKFDNKST------AEEQEEFLRRLLEGDTNKDDEYSGELDDEELNEILARTEDEKVLFK 1039

Query: 1217 ELDAQRIRTQMENGIT-------NRLMENSELPECYNVDIEAKLAEEEKQNVFVGGRGN- 1268
            ++D +R+  +    I         RL+   ELP  +  DI   L      NV     G  
Sbjct: 1040 KIDEERVANEKREAIDLGLRKPLPRLITKEELPSVFTEDITDHL------NVEPAAIGRI 1093

Query: 1269 RERRTAHYSDELSEEQWLRQFEVSENEDE 1297
            RER+  +Y D L+EEQWL+  +  E+ DE
Sbjct: 1094 RERKRVYYDDGLTEEQWLQAVDNDEDLDE 1122

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%)

Query: 1418 ADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFAN 1477
             D+   + IF   PS++ YPDYY +I+ P A E + K ++   Y S+ +V  D   +F N
Sbjct: 1255 TDEHSRTFIFERLPSRKEYPDYYKVIEKPVALETITKKLNKKQYQSINEVKSDLETMFNN 1314

Query: 1478 ARIYNTEDSIIFRDSLELEDAVI 1500
            A++YN E S +F D+  LE+  I
Sbjct: 1315 AKLYNEEGSWVFNDAEALEEFAI 1337

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
            (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/880 (56%), Positives = 620/880 (70%), Gaps = 47/880 (5%)

Query: 428  SLDFCLQQLLESD--SQVKD-KGELIMDYNAMQLLPLQKAIRGYVLS---FEWYQSTLLT 481
            SLD  L+ + + D  S + + K + +++  A++LL  QK++R  ++S    + +Q+    
Sbjct: 204  SLDDALEFITKGDVPSSIDNLKIKALVELKALKLLTKQKSLRQKLISNVTSQSHQTIPYL 263

Query: 482  NIHPNFLSKNRGLNI-------QDALLTRELFKSRXXXXXXXXXXXXXXXLNSILDRCKS 534
                  ++  R +N+       Q A L  EL + +               ++ I++  + 
Sbjct: 264  RDSQYTMAAQRSINVRMKVIVPQTARLAEELERQQLLEKRKRERNLHRQKVSQIVEFIQQ 323

Query: 535  IHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQT 594
                    + +  + G     LH+ +EKEE +RIER AKQRL ALK+NDEEAY+KLLDQT
Sbjct: 324  RQQDFSSHRERAAQFGRICATLHSQMEKEEQRRIERTAKQRLAALKSNDEEAYLKLLDQT 383

Query: 595  KDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDL 654
            KDTRITHLLKQTN+FLDSL +AV+ QQ+  K +               G++    +D+  
Sbjct: 384  KDTRITHLLKQTNSFLDSLAQAVRVQQNEAKLR--------------RGEEIPPVTDE-- 427

Query: 655  ERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLG 714
            ERE+IDYYEVAH IKE+V++QPSILVGGTLKEYQ++GL+WMVSL+NNHLNGILADEMGLG
Sbjct: 428  EREKIDYYEVAHRIKEKVEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLG 487

Query: 715  KTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK 774
            KTIQ+ISL+TYLYE K   GPFLVIVPLST+TNW  EF+KWAP L  + +KG P +R+  
Sbjct: 488  KTIQSISLITYLYEVKKDSGPFLVIVPLSTITNWTLEFEKWAPSLTTVIYKGTPNQRRSL 547

Query: 775  QALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSD 834
            Q  ++  +FDV+LTT+EYIIK+R LL+K +W H IIDEGHRMKNAQSKLS TL  YY + 
Sbjct: 548  QHQVRIGDFDVLLTTYEYIIKDRSLLAKHEWSHMIIDEGHRMKNAQSKLSYTLTHYYKTR 607

Query: 835  YRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETL 894
            +RLILTGTPLQNNLPELWALLNFVLPKIFNS K+FDEWFNTPF+NTGGQ+K+ L+EEE L
Sbjct: 608  HRLILTGTPLQNNLPELWALLNFVLPKIFNSSKTFDEWFNTPFSNTGGQEKLELTEEEAL 667

Query: 895  LVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDD 954
            LVIRRLHKVLRPFLLRRLKK+VEKDLPDKVEKV+KCK+S LQH+LYQQMLKH  LF+   
Sbjct: 668  LVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFVGAG 727

Query: 955  SSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERIL 1014
            +        +G NN+IMQLRKICNHPFVF+EVE  +NP R  +  ++R +GKFELL+R+L
Sbjct: 728  TEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPTRTNSSLLYRVSGKFELLDRVL 787

Query: 1015 PKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDY 1074
            PKFKATGHRVL+FFQMTQVMDIMEDFL+  ++KY+RLDG TK+++RT +LN FNAP+SDY
Sbjct: 788  PKFKATGHRVLMFFQMTQVMDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPDSDY 847

Query: 1075 FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNS 1134
            FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT +S
Sbjct: 848  FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDS 907

Query: 1135 VEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1194
            VEE IL++A  KLDIDGKVIQAGKFDNKST                              
Sbjct: 908  VEEVILERAMQKLDIDGKVIQAGKFDNKST------AEEQEAFLRRLLESESNKDDDDQA 961

Query: 1195 XXXXXXXXXXLARNENEIKVFQELDAQRI-RTQMENGITN------RLMENSELPECYNV 1247
                      LARNE E ++F ++D +R+ R Q E           RL+   ELP+ +  
Sbjct: 962  ELDDVELNEILARNEAEKELFDKIDRERVMREQKEAAARGLKKSLPRLITLEELPDVFTE 1021

Query: 1248 DIEAKLAEEEKQNVFVGGRGNRERRTAHYSDELSEEQWLR 1287
            DIE  L    +      GR  RER+  +Y D L+EEQWL+
Sbjct: 1022 DIEQHL----QTGPTAVGR-IRERKRVYYDDGLTEEQWLQ 1056

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 1418 ADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFAN 1477
             D    +DIF   PS+R YPDYY LI  P + + ++++    VY S+  V  DF  +F N
Sbjct: 1195 TDGHSRTDIFEKLPSRRDYPDYYQLIANPVSIDTILRNTKKGVYTSMVSVRSDFQTMFDN 1254

Query: 1478 ARIYNTEDSIIFRDS 1492
            A+ YN E S ++ D+
Sbjct: 1255 AKFYNQEGSWVYNDA 1269

>Kwal_23.4777
          Length = 1301

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/805 (60%), Positives = 581/805 (72%), Gaps = 34/805 (4%)

Query: 490  KNRGLNIQDALLTRELFKSRXXXXXXXXXXXXXXXLNSILDRCKSIHDLRIDKKAQRVKL 549
            +N+ +  Q A L  EL + +               +N I++  +     +   + +  + 
Sbjct: 278  RNKVIVPQTARLAEELERQQLLEKRRKESNLHMHKVNLIIEHVQEQQTTQTTPRERGAQF 337

Query: 550  GHRLINLHTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQTKDTRITHLLKQTNTF 609
            G   ++LH   EK+E KR+ER AKQRL ALK+NDEEAY+KLLDQTKDTRITHLL+QTNTF
Sbjct: 338  GRLCLSLHNQTEKDEQKRVERTAKQRLAALKSNDEEAYLKLLDQTKDTRITHLLRQTNTF 397

Query: 610  LDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDLERERIDYYEVAHSIK 669
            LDSL +AV  QQ+  K +               G + G  +D+  ERE+IDYYEVAHS+K
Sbjct: 398  LDSLAQAVMVQQNEAKMR--------------AGGEVGPMTDE--EREKIDYYEVAHSVK 441

Query: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729
            E++++QPSILVGGTLKEYQ++GL+WMVSL+NNHLNGILADEMGLGKTIQ+ISL+TYL E 
Sbjct: 442  EKIEKQPSILVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLRET 501

Query: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNREFDVVLTT 789
            K   GPFLVIVPLST+TNW  EF+KWAP L  I +KG P +RK  Q  I+   F+V+LTT
Sbjct: 502  KNEPGPFLVIVPLSTITNWTLEFEKWAPSLATIVYKGTPNQRKSMQHQIRIGNFEVLLTT 561

Query: 790  FEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLP 849
            +EYIIK+R LL+K  W H IIDEGHRMKNAQSKLS TL  YY +  RLILTGTPLQNNLP
Sbjct: 562  YEYIIKDRSLLAKHDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNRLILTGTPLQNNLP 621

Query: 850  ELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLL 909
            ELWALLNFVLPKIFNS K+FDEWFNTPFANTGGQ+K+ L+EEETLLVIRRLHKVLRPFLL
Sbjct: 622  ELWALLNFVLPKIFNSAKTFDEWFNTPFANTGGQEKLELTEEETLLVIRRLHKVLRPFLL 681

Query: 910  RRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQ 969
            RRLKK+VEKDLPDKVEKV+KCK+S LQH+LYQQMLKH  LF    +        +G NN+
Sbjct: 682  RRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFFGAGTEGATKGGIKGLNNK 741

Query: 970  IMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQ 1029
            IMQLRKICNHPFVF+EVE  INP+R  +  ++R AGKFELL+RIL KFK TGHRVL+FFQ
Sbjct: 742  IMQLRKICNHPFVFDEVEGIINPSRANSPLLYRVAGKFELLDRILLKFKVTGHRVLMFFQ 801

Query: 1030 MTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLN 1089
            MTQVMDIMEDFLR   +KYLRLDG TK++DRT +L  FNAPNS+YFCFLLSTRAGGLGLN
Sbjct: 802  MTQVMDIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPNSEYFCFLLSTRAGGLGLN 861

Query: 1090 LQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            LQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT +SVEE IL++A  KLDI
Sbjct: 862  LQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERALQKLDI 921

Query: 1150 DGKVIQAGKFDNKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLARNE 1209
            DGKVIQAGKFDNKST                                        LAR E
Sbjct: 922  DGKVIQAGKFDNKST------AEEQEAFLRRLLENENAKDEDDEAELNDEELNDILARGE 975

Query: 1210 NEIKVFQELDAQRIRTQME----NGITN---RLMENSELPECYNVDIEAKLAEEEKQNVF 1262
            +E K+F ++D +R   +++     G++    RL++  ELPE    DI   L  E    V 
Sbjct: 976  DERKLFDKMDEERRIKELQEAKAQGLSEPLPRLIQLDELPEVLTEDISNHLQTEP---VT 1032

Query: 1263 VGGRGNRERRTAHYSDELSEEQWLR 1287
            VG    RER+  +Y D L+EEQWL+
Sbjct: 1033 VGRI--RERKRVYYDDGLTEEQWLQ 1055

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 48/77 (62%)

Query: 1419 DDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANA 1478
            DD   + +F   PSK+LYPDYY L+K P A + ++K      Y SL++V +D + +F NA
Sbjct: 1213 DDHARTSVFEALPSKKLYPDYYKLVKNPIALDVILKKCKKGAYSSLEEVKQDLNTMFENA 1272

Query: 1479 RIYNTEDSIIFRDSLEL 1495
            + YN E S I+ D+ EL
Sbjct: 1273 QFYNEEGSWIYNDAEEL 1289

>Scas_662.7
          Length = 1342

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/890 (55%), Positives = 622/890 (69%), Gaps = 50/890 (5%)

Query: 428  SLDFCLQQLLESD--SQVKD-KGELIMDYNAMQLLPLQKAIRGYVL---SFEWYQSTLLT 481
            SLD CL+ L +SD  S + + K   +++  ++++L  QK++R  ++   + + + S    
Sbjct: 208  SLDDCLEFLTKSDLPSNIDNLKIRALIELKSLKMLTKQKSLRQKLINNVTGQAHHSIPYL 267

Query: 482  NIHPNFLSKNRGLNI-------QDALLTRELFKSRXXXXXXXXXXXXXXXLNSILDRCKS 534
               P  ++  R + I       Q   L  EL + +               + SI+D  + 
Sbjct: 268  RDSPFTIAAQRSVQIRPKVIVPQTVRLAEELERQQLLEKRKKERNLHLKKIYSIIDFVQE 327

Query: 535  IHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQT 594
              +   + + +  + G    ++H+ +EK+E +RIER+AKQRLQALK+NDEEAY+KLLDQT
Sbjct: 328  NQNSTFNHRDRCAQFGKICQSVHSQIEKDEQRRIERSAKQRLQALKSNDEEAYLKLLDQT 387

Query: 595  KDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDL 654
            KDTRIT LL+QTN+FLDSL +AV+ QQ+  K      L  +E+               D 
Sbjct: 388  KDTRITQLLRQTNSFLDSLAQAVRVQQNEAK-----LLRGEEIPPIT-----------DE 431

Query: 655  ERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLG 714
            ERE+ DYYEVAH IKE++ +QPS+LVGGTLKEYQ++GL+WMVSL+NNHLNGILADEMGLG
Sbjct: 432  EREKTDYYEVAHQIKEKIDKQPSMLVGGTLKEYQIRGLEWMVSLYNNHLNGILADEMGLG 491

Query: 715  KTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK 774
            KTIQ+ISL+TYL+E K   GP+LVIVPLST+TNW  EF+KWAP L  + +KG P +R+  
Sbjct: 492  KTIQSISLITYLFEEKKDPGPYLVIVPLSTITNWTLEFEKWAPSLNTVIYKGTPNQRRNL 551

Query: 775  QALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSD 834
            Q  ++   FDV+LTT+EYIIK+R LL+K +W H IIDEGHRMKNAQSKLS T+  YY + 
Sbjct: 552  QHQVRIGNFDVLLTTYEYIIKDRALLAKHEWTHMIIDEGHRMKNAQSKLSYTITHYYKTR 611

Query: 835  YRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETL 894
            +RLILTGTPLQNNLPELWALLNFVLPKIFNS K+F++WFNTPFANTG  +K+ L+EEETL
Sbjct: 612  HRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTGEKLELTEEETL 671

Query: 895  LVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDD 954
            LVIRRLHKVLRPFLLRRLKK+VEKDLPDKVEKV+KCK+S LQ +LY+QMLKH  LF+ + 
Sbjct: 672  LVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYEQMLKHNALFLGEG 731

Query: 955  SSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERIL 1014
            +     S  +G NN+IMQLRKICNHPFVF+EVE  INP R  ++ ++R +GKFELL R+L
Sbjct: 732  TEGATKSGIKGLNNKIMQLRKICNHPFVFDEVEGVINPTRANSNLLYRVSGKFELLNRVL 791

Query: 1015 PKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDY 1074
            PKFKA GHRVL+FFQMTQVMDIMEDFLR  D+KY+RLDG TK+DDRT +LN FNAP+SDY
Sbjct: 792  PKFKAAGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPDSDY 851

Query: 1075 FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNS 1134
            FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT +S
Sbjct: 852  FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDS 911

Query: 1135 VEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1194
            VEE IL++A  KLDIDGKVIQAGKFDNKST                              
Sbjct: 912  VEEVILERAMQKLDIDGKVIQAGKFDNKST------AEEQEAFLRRLIENESTKDNDDDA 965

Query: 1195 XXXXXXXXXXLARNENEIKVFQELDAQRI----RTQMENGITN---RLMENSELPECYNV 1247
                      LARNE+E  +F ++D +R     R     G++    RL++  ELP+ +  
Sbjct: 966  ELDDDELNEMLARNEDEKILFDKIDKERTKEERREAKAEGLSAPLPRLIQVDELPKIFTE 1025

Query: 1248 DIEAKLAEEEKQNVFVGGRGNRERRTAHYSDELSEEQWLRQFEVSENEDE 1297
            DI   L EE        GR  + +R  +Y D L+EEQ+L   E  ENEDE
Sbjct: 1026 DISDHLKEEP----VAEGRIRKMKR-VYYDDGLTEEQFL---EAVENEDE 1067

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 54/93 (58%)

Query: 1417 NADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFA 1476
            + D   L+ IF   PSK+LYPDYY++I+ P A E +++      Y +L +V ED   +F 
Sbjct: 1250 DTDGHPLTGIFEQLPSKKLYPDYYVIIQNPMALETILRKCKRGEYKNLSEVKEDMQTMFN 1309

Query: 1477 NARIYNTEDSIIFRDSLELEDAVIAKWKEMTNE 1509
            NAR YN E S ++ D+ +L + V   +K+   E
Sbjct: 1310 NARFYNEEGSWVYNDADKLNEFVNQWFKDHQEE 1342

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
            chromatin remodeling complex (RSC), involved in the
            response to DNA damage, DNA helicase of the Snf2p family,
            has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/883 (56%), Positives = 618/883 (69%), Gaps = 46/883 (5%)

Query: 428  SLDFCLQQLLESD-SQVKD--KGELIMDYNAMQLLPLQKAIRGYVL---SFEWYQSTLLT 481
            SLD CL+ + + D S   D  K + +++  +++LL  QK+IR  ++   + + + +    
Sbjct: 217  SLDDCLEFITKDDLSSRMDTFKIKALVELKSLKLLTKQKSIRQKLINNVASQAHHNIPYL 276

Query: 482  NIHPNFLSKNRGLNI-------QDALLTRELFKSRXXXXXXXXXXXXXXXLNSILDRCKS 534
               P   +  R + I       Q   L  EL + +               +NSI+D  K 
Sbjct: 277  RDSPFTAAAQRSVQIRSKVIVPQTVRLAEELERQQLLEKRKKERNLHLQKINSIIDFIKE 336

Query: 535  IHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQT 594
                +  ++ +  + G    +LH  +EK+E KRIER AKQRL ALK+NDEEAY+KLLDQT
Sbjct: 337  RQSEQWSRQERCFQFGRLGASLHNQMEKDEQKRIERTAKQRLAALKSNDEEAYLKLLDQT 396

Query: 595  KDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDL 654
            KDTRIT LL+QTN+FLDSL++AV+ QQ+  + KI    + Q ++              D 
Sbjct: 397  KDTRITQLLRQTNSFLDSLSEAVRAQQN--EAKILHGEEVQPIT--------------DE 440

Query: 655  ERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLG 714
            ERE+ DYYEVAH IKE++ +QPSILVGGTLKEYQL+GL+WMVSL+NNHLNGILADEMGLG
Sbjct: 441  EREKTDYYEVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLG 500

Query: 715  KTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK 774
            KTIQ+ISL+TYLYE K   GPFLVIVPLST+TNW  EF+KWAP L  I +KG P +R   
Sbjct: 501  KTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSL 560

Query: 775  QALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSD 834
            Q  I+   FDV+LTT+EYIIK++ LLSK  W H IIDEGHRMKNAQSKLS T++ YY + 
Sbjct: 561  QHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTR 620

Query: 835  YRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETL 894
             RLILTGTPLQNNLPELWALLNFVLPKIFNS K+F++WFNTPFANTG Q+K+ L+EEETL
Sbjct: 621  NRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETL 680

Query: 895  LVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDD 954
            L+IRRLHKVLRPFLLRRLKK+VEKDLPDKVEKV+KCK+S LQ +LYQQMLKH  LF+   
Sbjct: 681  LIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAG 740

Query: 955  SSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERIL 1014
            +        +G NN+IMQLRKICNHPFVF+EVE  +NP+R  +D ++R AGKFELL+R+L
Sbjct: 741  TEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDLLFRVAGKFELLDRVL 800

Query: 1015 PKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDY 1074
            PKFKA+GHRVL+FFQMTQVMDIMEDFLR  D+KY+RLDG TK+++RT +LN FNAP+SDY
Sbjct: 801  PKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDY 860

Query: 1075 FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNS 1134
            FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT +S
Sbjct: 861  FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDS 920

Query: 1135 VEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1194
            VEE IL++A  KLDIDGKVIQAGKFDNKST                              
Sbjct: 921  VEEVILERAMQKLDIDGKVIQAGKFDNKST------AEEQEAFLRRLIESETNRDDDDKA 974

Query: 1195 XXXXXXXXXXLARNENEIKVFQELDAQRIRTQMENGITN-------RLMENSELPECYNV 1247
                      LAR+ +E  +F ++D +R+  +  +           RL++  ELP+ +  
Sbjct: 975  ELDDDELNDTLARSADEKILFDKIDKERMNQERADAKAQGLRVPPPRLIQLDELPKVFRE 1034

Query: 1248 DIEAKLAEEEKQNVFVGGRGNRERRTAHYSDELSEEQWLRQFE 1290
            DIE    +E+ + +   GR  R+++  +Y D L+EEQ+L   E
Sbjct: 1035 DIEEHFKKEDSEPL---GRI-RQKKRVYYDDGLTEEQFLEAVE 1073

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (58%)

Query: 1424 SDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNT 1483
            + IF   PSKR YPDY+ +I+ P A + ++K+     Y +L++V +    +F NAR YN 
Sbjct: 1275 TSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNE 1334

Query: 1484 EDSIIFRDSLELEDAVIAKWKEMTN 1508
            E S ++ D+ +L +     +KE ++
Sbjct: 1335 EGSWVYVDADKLNEFTDEWFKEHSS 1359

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, hypothetical start
          Length = 1354

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/883 (56%), Positives = 613/883 (69%), Gaps = 47/883 (5%)

Query: 428  SLDFCLQQLLESDSQVK---DKGELIMDYNAMQLLPLQKAIRGYVL---SFEWYQSTLLT 481
            SL+ CL  + ++D+  K    K + I++  +++LL  QK+IR  ++   + + + S    
Sbjct: 200  SLNDCLDFISKNDAPSKIDEHKLKAIIELKSLKLLTKQKSIRQKLINTVASQAHHSIPFL 259

Query: 482  NIHPNFLSKNRGLNI-------QDALLTRELFKSRXXXXXXXXXXXXXXXLNSILDRCKS 534
               P  ++  R + +       Q A +  EL +                 +N+ L   + 
Sbjct: 260  RDSPFTMAAQRSVQVRSKVIVPQTARIAEELERQHLLDKRKKERNLHLQKVNTTLSLIRE 319

Query: 535  IHDLRIDKKAQRVKLGHRLINLHTNLEKEELKRIERNAKQRLQALKANDEEAYIKLLDQT 594
              +    +  +  + G   ++LH  +E++E KRIER AKQRLQALK+NDEEAY++LLDQT
Sbjct: 320  RQENEWSRSDRCAQFGRICMSLHGQIERDEQKRIERTAKQRLQALKSNDEEAYLRLLDQT 379

Query: 595  KDTRITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDL 654
            KDTRIT LL+QTN+FLDSL +AV+ QQ+ TK      L  +E++  N           D 
Sbjct: 380  KDTRITQLLRQTNSFLDSLAQAVRVQQNETK-----ILKGEEITPIN-----------DE 423

Query: 655  ERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLG 714
            +RE+IDYYEVAH IKE++++QPSILVGGTLKEYQL+GL+WMVSL+NNHLNGILADEMGLG
Sbjct: 424  DREKIDYYEVAHRIKEKIEKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLG 483

Query: 715  KTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK 774
            KTIQ+ISL+TYLYE K   GP+LVIVPLST+TNW  EF+KWAP L  I +KG P +R   
Sbjct: 484  KTIQSISLITYLYEVKQEPGPYLVIVPLSTITNWTLEFEKWAPSLTTIIYKGTPNQRHAL 543

Query: 775  QALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSD 834
            Q  I++  FDV+LTT+EYIIK++ LLSK +W H IIDEGHRMKNA SKLS T+  YY + 
Sbjct: 544  QHKIRSGNFDVLLTTYEYIIKDKALLSKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTR 603

Query: 835  YRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETL 894
             RLILTGTPLQNNLPELWALLNFVLPKIFNS K+F++WFNTPFANTG Q+K+ L+EEETL
Sbjct: 604  NRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETL 663

Query: 895  LVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDD 954
            LVIRRLHKVLRPFLLRRLKK+VEKDLPDKVEKV+KCK+S LQ +LYQQMLKH  LF+   
Sbjct: 664  LVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQQQLYQQMLKHNALFVGAG 723

Query: 955  SSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERIL 1014
            +        +G NN+IMQLRKICNHPFVF+EVE  +NP+R  +D ++R AGKFELL+RIL
Sbjct: 724  TEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEAVVNPSRGNSDLLYRVAGKFELLDRIL 783

Query: 1015 PKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDY 1074
            PKFKATGHRVLIFFQMTQVMDIMEDFLR  D+KY+RLDG TK++DR  +L  FN  NS+Y
Sbjct: 784  PKFKATGHRVLIFFQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVENSEY 843

Query: 1075 FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNS 1134
            FCFLLSTRAGGLGLNLQ+ADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT +S
Sbjct: 844  FCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDS 903

Query: 1135 VEEAILDKAHAKLDIDGKVIQAGKFDNKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1194
            VEE IL++A  KLDIDGKVIQAGKFDNKST                              
Sbjct: 904  VEEVILERAMQKLDIDGKVIQAGKFDNKST------AEEQEEFLRRLLENESNRDDDDKA 957

Query: 1195 XXXXXXXXXXLARNENEIKVFQELDAQRIRTQME-------NGITNRLMENSELPECYNV 1247
                      LAR+++E  +F ++D +RI  + +       N    RL+E  ELP  +  
Sbjct: 958  ELDDDELNDILARSDDEKILFDKMDKERIEMEKKHAKELGLNAPQTRLIETDELPSVFTE 1017

Query: 1248 DIEAKLAEEEKQNVFVGGRGNRERRTAHYSDELSEEQWLRQFE 1290
            DIE  L  E    V +G   N +R    Y D L+EEQ+L   E
Sbjct: 1018 DIEKHLKPEP---VALGRMRNTKR--VFYDDGLTEEQFLEAVE 1055

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 47/78 (60%)

Query: 1418 ADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFAN 1477
            +D+  L+ IF   PSKR YPDYY LIK P + + + K+    VY SL  V ED   +F N
Sbjct: 1266 SDEHPLTSIFETLPSKREYPDYYKLIKKPLSIDVIQKNARKGVYKSLDDVKEDIQTMFDN 1325

Query: 1478 ARIYNTEDSIIFRDSLEL 1495
            AR YN E S ++ D+ +L
Sbjct: 1326 ARFYNEEGSWVYNDAEKL 1343

>Scas_665.17
          Length = 1060

 Score =  462 bits (1189), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 229/487 (47%), Positives = 328/487 (67%), Gaps = 17/487 (3%)

Query: 672  VKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKG 731
            V + P+ + GG L++YQ++GL W++SL  N L+GILADEMGLGKT+QTIS L YL   K 
Sbjct: 125  VSESPAFIKGGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKK 184

Query: 732  VHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER-KPKQALIKNREFDVVLTTF 790
            + GPFL++VP STL NW  EF+KW P++  I   G   ER K    ++   +FDV++T++
Sbjct: 185  IDGPFLIVVPKSTLDNWRREFNKWTPEVNAIVLHGDKEERHKILYDIVLEAKFDVLITSY 244

Query: 791  EYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPE 850
            E +IKE+ +L K  W + +IDE HR+KN QS+LS  +  +Y S  RL++TGTPLQNNL E
Sbjct: 245  EMVIKEKNVLKKFAWQYIVIDEAHRIKNEQSQLSQIIRLFY-SKNRLLITGTPLQNNLHE 303

Query: 851  LWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLR 910
            LWALLNF+LP +F     FDEWF               SE++  +V+++LH VL PFLLR
Sbjct: 304  LWALLNFLLPDVFGDSGIFDEWFEQNN-----------SEQDQEIVVQQLHTVLNPFLLR 352

Query: 911  RLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQI 970
            R+K DVEK L  K+E  +   M+ +Q K Y+ +L+ + +   + +  ++   +R  N  +
Sbjct: 353  RIKADVEKSLLPKIETNVYVGMTEMQVKWYKSLLE-KDIDAVNGAVGKREGKTRLLN-IV 410

Query: 971  MQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQM 1030
            MQLRK CNHP++FE  E    P   T++ +  +AGK  +L+++L + K  G RVLIF QM
Sbjct: 411  MQLRKCCNHPYLFEGAEP--GPPYTTDEHLVFNAGKMIVLDKLLKRLKEKGSRVLIFSQM 468

Query: 1031 TQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNL 1090
            ++++DI+ED+  +   +Y R+DG T  +DR   ++ +N PNSD F FLL+TRAGGLG+NL
Sbjct: 469  SRLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGINL 528

Query: 1091 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDID 1150
             TADTVI++D+DWNP  DLQA DRAHRIGQK +V + R +T+N++EE ++++A  KL +D
Sbjct: 529  VTADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRLD 588

Query: 1151 GKVIQAG 1157
              VIQ G
Sbjct: 589  QLVIQQG 595

>Scas_652.17
          Length = 1025

 Score =  453 bits (1165), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/483 (48%), Positives = 325/483 (67%), Gaps = 23/483 (4%)

Query: 680  VGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVI 739
            + GTL+ YQ++GL W+VSL  N L GILADEMGLGKT+QTI+ L YL   +G++GPFLVI
Sbjct: 109  IHGTLRPYQIQGLNWLVSLHKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGINGPFLVI 168

Query: 740  VPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR----EFDVVLTTFEYIIK 795
             P STL NW  E +KW P ++    +G   ER    +LIK +    +FD+V+ ++E II+
Sbjct: 169  APKSTLNNWLREINKWTPDVKAFVLQGDKQER---ASLIKEKLMTCDFDIVVASYEIIIR 225

Query: 796  ERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALL 855
            E+    K  W + IIDE HR+KN +S LS  L  +  S  RL++TGTPLQNNL ELWALL
Sbjct: 226  EKAAFKKFNWEYIIIDEAHRIKNEESLLSQVLREF-TSRNRLLITGTPLQNNLHELWALL 284

Query: 856  NFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKD 915
            NF+LP IF+S + FD+WF++             +EE+   V+++LH VL+PFLLRR+K D
Sbjct: 285  NFLLPDIFSSSQDFDDWFSS-----------ETTEEDQDKVVKQLHTVLQPFLLRRIKND 333

Query: 916  VEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRK 975
            VE  L  K E  L   MS +Q K Y+++L+ + L   +  ++ K S +R  N  +MQLRK
Sbjct: 334  VETSLLPKKELNLYVGMSNMQKKWYKKILE-KDLDAVNGENSSKESKTRLLN-IVMQLRK 391

Query: 976  ICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMD 1035
             CNHP++F+  E    P   T++ +  ++ K ++L+++L K K  G RVLIF QM++V+D
Sbjct: 392  CCNHPYLFDGAEP--GPPYTTDEHLVYNSKKLQVLDKLLKKMKEDGSRVLIFSQMSRVLD 449

Query: 1036 IMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADT 1095
            I+ED+  +   KY R+DG T  +DR   ++ +NAP+SD F FLL+TRAGGLG+NL +AD 
Sbjct: 450  ILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGGLGINLTSADI 509

Query: 1096 VIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQ 1155
            V+++D+DWNP  DLQA DRAHRIGQK +V++ R +TDNSVEE IL++A  KL +D  VIQ
Sbjct: 510  VVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQKLRLDQLVIQ 569

Query: 1156 AGK 1158
              K
Sbjct: 570  QNK 572

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharomyces
            cerevisiae YOR304w ISW2 or sp|P38144 Saccharomyces
            cerevisiae YBR245c ISW1, hypothetical start
          Length = 1039

 Score =  452 bits (1162), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/487 (46%), Positives = 325/487 (66%), Gaps = 17/487 (3%)

Query: 672  VKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKG 731
            V + PS +  G L++YQ++GL WM+SL  N ++GILADEMGLGKT+QTIS L YL   K 
Sbjct: 121  VTESPSYIQSGKLRDYQIQGLNWMISLHENKISGILADEMGLGKTLQTISFLGYLRYVKK 180

Query: 732  VHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK-QALIKNREFDVVLTTF 790
            + GPFLVIVP STL NW  EF KW P +     +G   +R+   Q ++    FDV++T++
Sbjct: 181  IEGPFLVIVPKSTLDNWRREFFKWTPNVSTTVLQGTKEQRQDILQNIVLEARFDVLITSY 240

Query: 791  EYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPE 850
            E +I+E+  L ++ W + +IDE HR+KN QS LS  +  +Y S  RL++TGTPLQNNL E
Sbjct: 241  EMVIREKGYLKRLAWEYIVIDEAHRIKNEQSALSQIIRLFY-SKNRLLITGTPLQNNLHE 299

Query: 851  LWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLR 910
            LWALLNF+LP +F   + FD+WF     N   QD+         +V+++LH VL PFLLR
Sbjct: 300  LWALLNFLLPDVFGDSEVFDDWFQ---QNNSDQDQ--------EVVVQQLHAVLNPFLLR 348

Query: 911  RLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQI 970
            R+K DVEK L  K+E  +   M+ +Q + Y+ +L+ + +   + +  ++   +R  N  +
Sbjct: 349  RIKADVEKSLLPKIETNVYVGMTDMQVQWYKSLLE-KDIDAVNGAVGKREGKTRLLN-IV 406

Query: 971  MQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQM 1030
            MQLRK CNHP++FE  E    P   T++ +  +AGK  +L+++L + K  G RVLIF QM
Sbjct: 407  MQLRKCCNHPYLFEGAEP--GPPYTTDEHLIFNAGKMIVLDKLLKRLKEKGSRVLIFSQM 464

Query: 1031 TQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNL 1090
            ++++DI+ED+  + +  Y R+DG T  ++R   ++ +N PNS+ F FLL+TRAGGLG+NL
Sbjct: 465  SRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLGINL 524

Query: 1091 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDID 1150
             TADTV++FD+DWNP  DLQA DRAHRIGQK +V + R +T+N++EE +L++A  KL +D
Sbjct: 525  VTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKLRLD 584

Query: 1151 GKVIQAG 1157
              VIQ G
Sbjct: 585  QLVIQQG 591

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
            Ume6p-dependent transcriptional repression of several
            meiotic genes, has chromatin remodeling activity, has
            strong similarity to Drosophila nucleosome remodeling
            factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  452 bits (1163), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 228/498 (45%), Positives = 330/498 (66%), Gaps = 19/498 (3%)

Query: 663  EVAHSIKEE--VKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTI 720
            E+  + +E+  V + PS +  G L++YQ++GL W++SL  N L+GILADEMGLGKT+QTI
Sbjct: 161  EIVDTYQEDIFVSESPSFVKSGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTI 220

Query: 721  SLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKP-KQALIK 779
            S L YL   K + GPFL+IVP STL NW  EF KW P +  +   G    R    + +I 
Sbjct: 221  SFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL 280

Query: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839
               FDV++T++E +I+E+  L ++ W + +IDE HR+KN QS LS  +  +Y S  RL++
Sbjct: 281  EARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFY-SKNRLLI 339

Query: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899
            TGTPLQNNL ELWALLNF+LP IF   + FDEWF               SE++  +VI++
Sbjct: 340  TGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQNN-----------SEQDQEIVIQQ 388

Query: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959
            LH VL PFLLRR+K DVEK L  K+E  +   M+ +Q + Y+ +L+ + +   + +  ++
Sbjct: 389  LHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLE-KDIDAVNGAVGKR 447

Query: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKA 1019
               +R  N  +MQLRK CNHP++FE  E    P   T++ +  ++GK  +L+++L + K 
Sbjct: 448  EGKTRLLN-IVMQLRKCCNHPYLFEGAEP--GPPYTTDEHLIFNSGKMIILDKLLKRLKE 504

Query: 1020 TGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLL 1079
             G RVLIF QM++++DI+ED+  + D +Y R+DG T  ++R   ++ +N PNS+ F FLL
Sbjct: 505  KGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLL 564

Query: 1080 STRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAI 1139
            +TRAGGLG+NL TADTVI+FD+DWNP  DLQA DRAHRIGQK +V + R +T+N++EE +
Sbjct: 565  TTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKV 624

Query: 1140 LDKAHAKLDIDGKVIQAG 1157
            +++A  KL +D  VIQ G
Sbjct: 625  IERAAQKLRLDQLVIQQG 642

>CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharomyces
            cerevisiae YBR245c ISW1 or tr|Q08773 Saccharomyces
            cerevisiae YOR304w ISW2, hypothetical start
          Length = 1115

 Score =  451 bits (1161), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 233/487 (47%), Positives = 323/487 (66%), Gaps = 23/487 (4%)

Query: 680  VGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVI 739
            + G L++YQ++GL W+VSL  N + GILADEMGLGKT+QTIS L YL   K + GPFLVI
Sbjct: 171  INGQLRDYQVQGLNWLVSLDKNRIAGILADEMGLGKTLQTISFLGYLRYIKKIPGPFLVI 230

Query: 740  VPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR----EFDVVLTTFEYIIK 795
             P STL NW  E +KW P++     +G   ER     LI+++    +FDVV+ ++E II+
Sbjct: 231  APKSTLNNWLREINKWTPEVNAFILQGDKEER---ARLIQDKFMACDFDVVIASYEIIIR 287

Query: 796  ERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALL 855
            E+    K+ W + +IDE HR+KN +S LS  L  + HS  RL++TGTPLQNNL ELWALL
Sbjct: 288  EKAAFRKMNWEYIMIDEAHRIKNEESMLSQVLREF-HSKNRLLITGTPLQNNLHELWALL 346

Query: 856  NFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKD 915
            NF+LP IF+  + FDEWF+               EE+   ++++LH VL+PFLLRR+K D
Sbjct: 347  NFLLPDIFSDSQDFDEWFSK-----------ETDEEDQEKIVKQLHTVLQPFLLRRIKSD 395

Query: 916  VEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRK 975
            VE  L  K E  +   MS +Q K Y+Q+L+ + +   +  S  K S +R  N  +MQLRK
Sbjct: 396  VETSLLPKKELNVYVGMSPMQKKWYRQILE-KDIDAVNADSGSKESKTRLLN-IVMQLRK 453

Query: 976  ICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMD 1035
             CNHP++F+  E    P   T++ +  ++ K ++L+++L K K  G RVLIF QM++V+D
Sbjct: 454  CCNHPYLFDGAEP--GPPYTTDEHLVYNSEKLKVLDKLLRKLKEAGSRVLIFSQMSRVLD 511

Query: 1036 IMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADT 1095
            I+ED+  + + +Y R+DG T  +DR   ++ +NAP+S  F FLL+TRAGGLG+NL TAD 
Sbjct: 512  ILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGINLTTADV 571

Query: 1096 VIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQ 1155
            V++FD+DWNP  DLQA DRAHRIGQK +VR+ R +TDNSVEE IL++A  KL +D  VIQ
Sbjct: 572  VVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLRLDQLVIQ 631

Query: 1156 AGKFDNK 1162
              +  NK
Sbjct: 632  QNRPTNK 638

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
            complement(1400495..1400512,1400676..1403735) [3078 bp,
            1025 aa]
          Length = 1025

 Score =  448 bits (1153), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/490 (46%), Positives = 332/490 (67%), Gaps = 23/490 (4%)

Query: 672  VKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKG 731
            V + PS +  G L++YQ+ GL W++SL  N L+GILADEMGLGKT+QTIS L YL   K 
Sbjct: 116  VTESPSFVKAGKLRDYQIYGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRFIKD 175

Query: 732  VHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR----EFDVVL 787
            + GPF+V+VP STL NW  EF KW P++  I   G   +R+ +  LI+ R    +FDV++
Sbjct: 176  IDGPFIVVVPKSTLDNWKREFAKWTPEVNTIVLHG---DRETRTQLIEERILTCDFDVLI 232

Query: 788  TTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNN 847
            T++E +IKE+ +L K  W + +IDE HR+KN QS LS  +  +Y S  RL++TGTPLQNN
Sbjct: 233  TSYEMVIKEKAILKKFAWQYIVIDEAHRIKNEQSTLSQIIRLFY-SKSRLLITGTPLQNN 291

Query: 848  LPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPF 907
            L ELWALLNF+LP +F   + FDEWF     N   QD+         +V+++LH VL+PF
Sbjct: 292  LHELWALLNFLLPDVFGESEVFDEWFQ---QNEKAQDQ--------EIVVQQLHAVLQPF 340

Query: 908  LLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFN 967
            LLRR+K DVEK L  K+E  +   M+A+Q + Y+ +L+ + +   + +  ++   +R  N
Sbjct: 341  LLRRVKADVEKSLLPKIETNVYVGMTAMQLQWYRSLLE-KDIDAVNGAVGKREGKTRLLN 399

Query: 968  NQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIF 1027
              +MQLRK CNHP++FE  E    P   T++ +  ++GK  +L+++L + K  G RVLIF
Sbjct: 400  -IVMQLRKCCNHPYLFEGAEP--GPPYTTDEHLIYNSGKMIVLDKLLKRKKKEGSRVLIF 456

Query: 1028 FQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLG 1087
             QM++++DI+ED+  + D +Y R+DG T  ++R A ++ FNA +S  F FLL+TRAGGLG
Sbjct: 457  SQMSRLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLG 516

Query: 1088 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKL 1147
            +NL TADTV+++D+DWNP  DLQA DRAHRIGQK +V + RL+T+N++EE ++++A  KL
Sbjct: 517  INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKL 576

Query: 1148 DIDGKVIQAG 1157
             +D  VIQ G
Sbjct: 577  RLDQLVIQQG 586

>Kwal_14.1600
          Length = 1102

 Score =  446 bits (1147), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 227/484 (46%), Positives = 324/484 (66%), Gaps = 23/484 (4%)

Query: 679  LVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLV 738
             + G L+ YQ++G+ W+VSL  N+L GILADEMGLGKT+QTIS L YL   +   GPF+V
Sbjct: 131  FINGCLRPYQVQGVNWLVSLHRNNLAGILADEMGLGKTLQTISFLGYLRYVEKKPGPFVV 190

Query: 739  IVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR----EFDVVLTTFEYII 794
            I P STL NW  E ++W P +R    +G   ER     L+ N+    +FD+V+ ++E II
Sbjct: 191  IAPKSTLNNWLREINRWTPDVRAFILQGDKEER---AKLVANKLMACDFDIVVASYEIII 247

Query: 795  KERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWAL 854
            KE+    KI W + +IDE HR+KN +S LS  L  +  S  RL++TGTPLQNNL ELWAL
Sbjct: 248  KEKASFKKIAWEYIVIDEAHRIKNEESMLSQVLREFT-SRNRLLITGTPLQNNLHELWAL 306

Query: 855  LNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKK 914
            LNF+LP +F+  ++FD+WF++             SE++   ++++LH VL+PFLLRRLK 
Sbjct: 307  LNFLLPDVFSDSQAFDDWFSS-----------ESSEDDKGKIVKQLHTVLQPFLLRRLKN 355

Query: 915  DVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLR 974
            +VE  L  K E  L   MS++Q + Y+Q+L+ + +   + ++  K S +R  N  +MQLR
Sbjct: 356  EVETSLLPKKELNLYIGMSSMQKRWYKQILE-KDIDAVNGANGNKESKTRLLN-VMMQLR 413

Query: 975  KICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVM 1034
            K CNHP++F+  E    P   T++ +  ++ K ++L+++L KFK  G RVLIF QM++V+
Sbjct: 414  KCCNHPYLFDGAEP--GPPYTTDEHLVYNSAKLKVLDKLLRKFKEEGSRVLIFSQMSRVL 471

Query: 1035 DIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTAD 1094
            DI+ED+  +   +Y R+DG T  +DR   ++ +NAP+S  F FLL+TRAGGLG+NL TAD
Sbjct: 472  DILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAGGLGINLTTAD 531

Query: 1095 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI 1154
             V+++D+DWNP  DLQA DRAHRIGQK +VR+ RL+TDNSVEE IL++A  KL +D  VI
Sbjct: 532  IVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERATQKLRLDQLVI 591

Query: 1155 QAGK 1158
            Q  +
Sbjct: 592  QQSR 595

>Kwal_34.15925
          Length = 1025

 Score =  438 bits (1126), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 225/488 (46%), Positives = 325/488 (66%), Gaps = 23/488 (4%)

Query: 674  QQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVH 733
            + PS +  G L++YQ++GL W++SL +N L+GILADEMGLGKT+QTI+ L YL   K + 
Sbjct: 119  ESPSYIKSGVLRDYQVQGLNWLLSLHDNRLSGILADEMGLGKTLQTIAFLGYLRYLKDID 178

Query: 734  GPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKN----REFDVVLTT 789
            GP +VIVP STL NW  EF KW P++  +   G   ER   Q L+K+     +FDV++T+
Sbjct: 179  GPHIVIVPKSTLNNWKREFSKWTPEVEAVVLSGDKEER---QHLLKDIVLECKFDVLITS 235

Query: 790  FEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLP 849
            +E +IKE+  L +  W + I+DE HR+KN QS LS  +  + HS  RL++TGTPLQNNL 
Sbjct: 236  YEMVIKEKSTLKRFMWQYIIVDEAHRIKNEQSTLSQIIRLF-HSKSRLLITGTPLQNNLH 294

Query: 850  ELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLL 909
            ELWALLNF+LP +F    +FD WF             + +E++  +V+++LH VL PFLL
Sbjct: 295  ELWALLNFLLPDVFGDSDAFDRWFEQ-----------SDTEKDQDVVVQQLHTVLSPFLL 343

Query: 910  RRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQ 969
            RRLK +VE  L  K+E  L   M+ +Q + Y+ +L+ + L   + +  ++  ++R   N 
Sbjct: 344  RRLKSEVETSLLPKIETNLYVGMTDMQVQWYKSLLE-KDLDAVNGAIGKREGNTR-LLNI 401

Query: 970  IMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQ 1029
            +MQLRK CNHP++FE  E    P   T++ +  +AGK  +L+++L K K  G RVLIF Q
Sbjct: 402  VMQLRKCCNHPYLFEGAEP--GPPYTTDEHLIFNAGKMIVLDKLLKKKKEAGSRVLIFSQ 459

Query: 1030 MTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLN 1089
            M++++DI+ED+  + D  Y R+DG T  ++R   ++ FN P S+ F FLL+TRAGGLG+N
Sbjct: 460  MSRLLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTRAGGLGIN 519

Query: 1090 LQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            L TADTV+I+D+DWNP  DLQA DRAHRIGQK +V + R +T+N++EE ++++A  KL +
Sbjct: 520  LVTADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRL 579

Query: 1150 DGKVIQAG 1157
            D  VIQ G
Sbjct: 580  DQLVIQQG 587

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
            ATP-dependent chromatin remodeling factor, has strong
            similarity to Drosophila nucleosome remodeling factor
            ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  437 bits (1123), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 254/577 (44%), Positives = 360/577 (62%), Gaps = 45/577 (7%)

Query: 598  RITHLLKQTNTFLDSL-TKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDLER 656
            R  HLL  +  F   + +KA KD       K    LD   + E+N  +  G     D+ R
Sbjct: 108  RFEHLLSLSGLFKHFIESKAAKDP------KFRQVLD---VLEENKANGKGKGKHQDVRR 158

Query: 657  ERIDYYEVAHSIKEE-----------VKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNG 705
             + ++ E A  +KEE            ++ P+  V G L+ YQ++G+ W+VSL  N + G
Sbjct: 159  RKTEHEEDAELLKEEDSDDDESIEFQFRESPA-YVNGQLRPYQIQGVNWLVSLHKNKIAG 217

Query: 706  ILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFK 765
            ILADEMGLGKT+QTIS L YL   + + GPFLVI P STL NW  E ++W P +     +
Sbjct: 218  ILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQ 277

Query: 766  GPPMERKPKQALIKNR----EFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQS 821
            G   ER     LI+ +    +FDVV+ ++E II+E+  L KI W + IIDE HR+KN +S
Sbjct: 278  GDKEER---AELIQKKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEES 334

Query: 822  KLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTG 881
             LS  L  +  S  RL++TGTPLQNNL ELWALLNF+LP IF+  + FD+WF++  +   
Sbjct: 335  MLSQVLREF-TSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWFSSE-STEE 392

Query: 882  GQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQ 941
             QDKI          +++LH VL+PFLLRR+K DVE  L  K E  L   MS++Q K Y+
Sbjct: 393  DQDKI----------VKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYK 442

Query: 942  QMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIW 1001
            ++L+ + L   + S+  K S +R  N  +MQLRK CNHP++F+  E    P   T++ + 
Sbjct: 443  KILE-KDLDAVNGSNGSKESKTRLLN-IMMQLRKCCNHPYLFDGAEP--GPPYTTDEHLV 498

Query: 1002 RSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRT 1061
             +A K ++L+++L K K  G RVLIF QM++++DI+ED+  + + +Y R+DG T  +DR 
Sbjct: 499  YNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRI 558

Query: 1062 ALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQK 1121
              ++ +NAP+S  F FLL+TRAGGLG+NL +AD V+++D+DWNP  DLQA DRAHRIGQK
Sbjct: 559  QAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQK 618

Query: 1122 NEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGK 1158
             +V++ RL+TDNSVEE IL++A  KL +D  VIQ  +
Sbjct: 619  KQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQNR 655

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
            Saccharomyces cerevisiae YOR304w ISW2, hypothetical start
          Length = 1062

 Score =  433 bits (1113), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/485 (45%), Positives = 325/485 (67%), Gaps = 17/485 (3%)

Query: 674  QQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVH 733
            Q PS +  G L++YQ+ GL W++SL  + L+GILADEMGLGKT+Q+IS L YL   KG+ 
Sbjct: 126  QSPSFIKEGKLRDYQVYGLNWLISLHESKLSGILADEMGLGKTLQSISFLGYLRYIKGIE 185

Query: 734  GPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKP-KQALIKNREFDVVLTTFEY 792
            GP++VIVP STL NW  EF KW P+++ +  +G    RK   +  I    FDV++T++E 
Sbjct: 186  GPYIVIVPKSTLDNWQREFAKWTPEVKTVILQGDKDFRKELIETKILTCNFDVLITSYEM 245

Query: 793  IIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELW 852
            ++KE+  L +  W + +IDE HR+KN QS LS  +  +Y S  RL++TGTPLQNNL ELW
Sbjct: 246  VLKEKLTLKRFAWEYILIDEAHRIKNEQSALSQVIRLFY-SKNRLLITGTPLQNNLHELW 304

Query: 853  ALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRL 912
            ALLNF+LP +F   + FDEWF        G+      EE+  +V+++LH VL+PFLLRR+
Sbjct: 305  ALLNFLLPDVFGDSEVFDEWFQQ-----NGK------EEDQEVVVQQLHSVLQPFLLRRV 353

Query: 913  KKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQ 972
            K +VEK L  K E  L   M+ +Q + Y+ +L+ + +   + +  ++   +R  N  +MQ
Sbjct: 354  KSEVEKSLLPKKEINLYVGMTDMQIEWYKSLLE-KDIDAVNGAVGKREGKTRLLN-IVMQ 411

Query: 973  LRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQ 1032
            LRK CNHP++FE  E    P   T++ +  ++GK  +L+++L K K  G RVLIF QM++
Sbjct: 412  LRKCCNHPYLFEGAEP--GPPYTTDEHLVFNSGKMIVLDKLLKKKKEQGSRVLIFSQMSR 469

Query: 1033 VMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQT 1092
            ++DI+ED+  +   +Y R+DG T  D+R   ++ +N PNS+ F FLL+TRAGGLG+NL T
Sbjct: 470  LLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLGINLVT 529

Query: 1093 ADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGK 1152
            ADTV+++D+DWNP  DLQA DRAHRIGQK +V + R +T+N++EE ++++A  KL +D  
Sbjct: 530  ADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKLRLDQL 589

Query: 1153 VIQAG 1157
            VIQ G
Sbjct: 590  VIQQG 594

>Scas_597.8
          Length = 1065

 Score =  428 bits (1101), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/490 (47%), Positives = 325/490 (66%), Gaps = 27/490 (5%)

Query: 679  LVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLV 738
             + GTL+ YQ++GL W+VSL  + L GILADEMGLGKT+QTIS L YL   + + GPFLV
Sbjct: 127  FINGTLRNYQIQGLNWLVSLHKSKLAGILADEMGLGKTLQTISFLGYLRYVEKIPGPFLV 186

Query: 739  IVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR----EFDVVLTTFEYII 794
            I P STL NW  E +KW P++     +G   ER     L+K++    +FD+V+ ++E II
Sbjct: 187  IAPKSTLNNWLREINKWTPEVNAFILQGDKEERA---QLVKDKLLACDFDIVVASYEIII 243

Query: 795  KERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWAL 854
            +E+    KI W + IIDE HR+KN +S LS  L  +  S+ RL++TGTPLQNNL ELWAL
Sbjct: 244  REKSAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSN-RLLITGTPLQNNLHELWAL 302

Query: 855  LNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKK 914
            LNF+LP IF+  + FD+WF++             +EE+   V+++LH VL+PFLLRRLK 
Sbjct: 303  LNFLLPDIFSDSQDFDDWFSS-----------ETTEEDQEKVVKQLHTVLQPFLLRRLKN 351

Query: 915  DVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLR 974
            DVE  L  K E  L   MS +Q K Y+Q+L+ + +   + S+  K S +R  N  +MQLR
Sbjct: 352  DVETSLLPKQELNLYVGMSNMQKKWYKQILE-KDIDAVNGSNVNKESKTRLLN-IVMQLR 409

Query: 975  KICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVM 1034
            K CNHP++F+  E    P   T++ +  ++ K ++L+++L K K  G RVLIF QM++V+
Sbjct: 410  KCCNHPYLFDGAEP--GPPYTTDEHLVYNSAKLKVLDKLLKKMKEEGSRVLIFSQMSRVL 467

Query: 1035 DIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTAD 1094
            DI+ED+  +   +Y R+DG T  +DR   ++ +N P S  F FLL+TRAGGLG+NL +A+
Sbjct: 468  DILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTRAGGLGINLTSAN 527

Query: 1095 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI 1154
             V++FD+DWNP  DLQA DRAHRIGQK +V++ RL+TDNSVEE IL++A  KL +D  VI
Sbjct: 528  IVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILERATQKLRLDQLVI 587

Query: 1155 QAGKFDNKST 1164
            Q     N+ST
Sbjct: 588  QQ----NRST 593

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
            complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  429 bits (1102), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/481 (47%), Positives = 320/481 (66%), Gaps = 17/481 (3%)

Query: 679  LVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLV 738
             V G L+ YQ++G+ W+VSL  N+L GILADEMGLGKT+QTI+ L YL   +   GPFLV
Sbjct: 139  FVDGRLRPYQVQGVNWLVSLHKNNLAGILADEMGLGKTLQTITFLGYLRYIEKKRGPFLV 198

Query: 739  IVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER-KPKQALIKNREFDVVLTTFEYIIKER 797
            I P STL NW  E ++W P +     +G   ER +  Q  +    FDV + ++E II+E+
Sbjct: 199  IAPKSTLNNWQREINRWTPDVDAFILQGDKEERARLCQERLLACNFDVAIASYEIIIREK 258

Query: 798  PLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNF 857
                KI W + +IDE HR+KN +S LS  L  +  S  RL++TGTPLQNNL ELWALLNF
Sbjct: 259  ASFKKIDWEYIVIDEAHRIKNEESMLSQVLREF-SSRNRLLITGTPLQNNLHELWALLNF 317

Query: 858  VLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVE 917
            +LP IF+   +FDEWF++  A+   +DKI          +++LH +L+PFLLRR+K DVE
Sbjct: 318  LLPDIFSDSAAFDEWFSSE-ASDDDKDKI----------VKQLHTILQPFLLRRIKSDVE 366

Query: 918  KDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKIC 977
              L  K E  L   MS++Q K Y+Q+L+ + L   + S+  K S +R  N  +MQLRK C
Sbjct: 367  TSLLPKKELNLYVGMSSMQRKWYKQILE-KDLDAVNGSNGSKESKTRLLN-IMMQLRKCC 424

Query: 978  NHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIM 1037
            NHP++F+  E    P   T++ +  ++ K ++L+++L K K  G RVLIF QM++++DI+
Sbjct: 425  NHPYLFDGAEP--GPPYTTDEHLVYNSAKLKVLDKLLKKLKEDGSRVLIFSQMSRLLDIL 482

Query: 1038 EDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVI 1097
            ED+  +   +Y R+DG T  +DR   ++ +NAP+S  F FLL+TRAGGLG+NL TAD V+
Sbjct: 483  EDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLGINLTTADVVV 542

Query: 1098 IFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAG 1157
            ++D+DWNP  DLQA DRAHRIGQK +V++ RL+TDNSVEE IL++A  KL +D  VIQ G
Sbjct: 543  LYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQG 602

Query: 1158 K 1158
            +
Sbjct: 603  R 603

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
            cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  426 bits (1095), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/484 (47%), Positives = 322/484 (66%), Gaps = 17/484 (3%)

Query: 680  VGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVI 739
            V G L+ YQ++GL W+V+L  N L GILADEMGLGKT+QTI+ L YL   +  +GPFLVI
Sbjct: 137  VNGQLRPYQIQGLNWLVALHKNQLAGILADEMGLGKTLQTIAFLGYLRYIEKKNGPFLVI 196

Query: 740  VPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER-KPKQALIKNREFDVVLTTFEYIIKERP 798
             P STL NW  E ++W P++     +G   ER K     +   +FD+ + ++E II+E+ 
Sbjct: 197  APKSTLNNWLREINRWTPEVSAFILQGDKEERSKLCHDKLLACDFDICVASYEIIIREKA 256

Query: 799  LLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFV 858
               KI W + +IDE HR+KN +S LS  L  +  S  RL++TGTPLQNNL ELWALLNF+
Sbjct: 257  SFKKIDWEYVVIDEAHRIKNEESMLSQVLREF-SSRNRLLITGTPLQNNLHELWALLNFL 315

Query: 859  LPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEK 918
            LP IF    +FDEWF++             SEE+   V+++LH VL PFLLRR+K DVE 
Sbjct: 316  LPDIFADSATFDEWFSS-----------ESSEEDKEKVVKQLHTVLSPFLLRRIKNDVEG 364

Query: 919  DLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICN 978
             L  K E  +   MS++Q K Y+Q+L+ + +   + S+ QK S +R  N  +MQLRK CN
Sbjct: 365  SLLPKKELNVYVGMSSMQKKWYKQILE-KDIDAVNGSNGQKESKTRLLN-IVMQLRKCCN 422

Query: 979  HPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIME 1038
            HP++F+  E    P   T++ +  ++ K ++L+++L KFK  G RVLIF QM++V+DI+E
Sbjct: 423  HPYLFDGAEP--GPPYTTDEHLVYNSAKLKVLDKLLKKFKEQGSRVLIFSQMSRVLDILE 480

Query: 1039 DFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVII 1098
            D+  + + +Y R+DG T  +DR   ++ +NAP+S  F FLL+TRAGGLG+NL TAD V++
Sbjct: 481  DYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAGGLGINLTTADIVVL 540

Query: 1099 FDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGK 1158
            +D+DWNP  DLQA DRAHRIGQK +VR+ R +TDNSVEE IL++A  KL +D  VIQ G+
Sbjct: 541  YDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLKLDQLVIQQGR 600

Query: 1159 FDNK 1162
              NK
Sbjct: 601  VTNK 604

>Kwal_56.23442
          Length = 1435

 Score =  420 bits (1080), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/510 (44%), Positives = 324/510 (63%), Gaps = 38/510 (7%)

Query: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729
            E++ +QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L  A
Sbjct: 343  EKLVEQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYA 402

Query: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779
            +  +GP LV+VPLST+  W   F+KWAP L  I F G    R           P+    K
Sbjct: 403  RRQNGPHLVVVPLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKK 462

Query: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839
            + +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ RL++
Sbjct: 463  HAKFNVLLTTYEYILKDRAELGAIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 521

Query: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N   QD    +E+ET   IR 
Sbjct: 522  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---QD----AEQETY--IRD 566

Query: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959
            LH  L+PF+LRRLKKDVEK LP K E++L+ ++S +Q   Y+ +L      +   S    
Sbjct: 567  LHSRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTDYYKNILTKNYSALSAGSKGAH 626

Query: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011
            FS      N + +L+K  NHP++F+  ED++       R + + I R    S+GK  LL+
Sbjct: 627  FS----LLNIMNELKKASNHPYLFDMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLD 682

Query: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071
            ++L + K  GHRVLIF QM +++DI+ D+L    + Y RLDG   S  R   ++ FNAP+
Sbjct: 683  QLLTRLKKDGHRVLIFSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPD 742

Query: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131
            S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 743  SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 802

Query: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFDN 1161
             ++VEE +L++A  K+ ++  +I  G  D 
Sbjct: 803  KDTVEEEVLERARKKMILEYAIISLGVTDG 832

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
            Saccharomyces cerevisiae YER164w CHD1 transcriptional
            regulator, start by similarity
          Length = 1476

 Score =  413 bits (1062), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 223/514 (43%), Positives = 321/514 (62%), Gaps = 39/514 (7%)

Query: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729
            E++  QP  + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT++ +++L  A
Sbjct: 377  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFA 436

Query: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779
            +  +GP LV+VPLST+  W   F+KWAP +  I + G    R           PK    K
Sbjct: 437  RRQNGPHLVVVPLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKK 496

Query: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839
              +F+V++TT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ RL++
Sbjct: 497  QIKFNVLMTTYEYILKDRAELGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 555

Query: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +EE    IR 
Sbjct: 556  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---------QDEEQEQYIRD 600

Query: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959
            LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L      +   +   +
Sbjct: 601  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGR 660

Query: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011
            FS      N +  L K  NHP++F+  E+++         + + I R    S+GK  LL+
Sbjct: 661  FS----MLNIMNTLMKASNHPYLFDSAEEKVLEKFGAGNMSRENILRGLIMSSGKMVLLD 716

Query: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071
            ++L + K  GHRVLIF QM +++DI+ D+L    + + RLDG   S+ R   ++ FNAP 
Sbjct: 717  KLLTRLKKDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPG 776

Query: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131
            SD F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 777  SDDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 836

Query: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFD-NKST 1164
             ++VEE +L++A  K+ ++  +I  G  D NK T
Sbjct: 837  KDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 870

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
            cerevisiae YER164w CHD1 transcriptional regulator, start
            by similarity
          Length = 1525

 Score =  411 bits (1057), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/509 (42%), Positives = 318/509 (62%), Gaps = 38/509 (7%)

Query: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729
            E++  QPS + GG L+++QL G+ WM  L++ + NGILADEMGLGKT+QT+S +++L  A
Sbjct: 374  EKLDAQPSFIKGGELRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYA 433

Query: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779
            +  +GP LV+VPLST+  W   FDKWAP L  + + G    R           P+    K
Sbjct: 434  RRQNGPHLVVVPLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKK 493

Query: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839
            + +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ RL++
Sbjct: 494  HLKFNVLLTTYEYILKDRSTLGSIKWQFLAVDEAHRLKNAESSLYESLNSFKVAN-RLLI 552

Query: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +E+    IR 
Sbjct: 553  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---------QDEQQEEYIRD 597

Query: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959
            LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L      +        
Sbjct: 598  LHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTSGIKGGH 657

Query: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011
             S      N + +L+K  NHP++F+  E+++        ++ + I R    S+GK  LL+
Sbjct: 658  VS----LLNVMNELKKASNHPYLFDNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLD 713

Query: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071
            ++L + K  GHRVLIF QM +++DI+ D+L    + + RLDG   S  R   ++ FNA +
Sbjct: 714  KLLTRLKKDGHRVLIFSQMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAED 773

Query: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131
            S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 774  SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 833

Query: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFD 1160
             ++VEE +L++A  K+ ++  +I  G  D
Sbjct: 834  KDTVEEEVLERARKKMILEYAIISLGVTD 862

>Scas_576.6
          Length = 1457

 Score =  409 bits (1051), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 224/525 (42%), Positives = 324/525 (61%), Gaps = 38/525 (7%)

Query: 654  LERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGL 713
            L +   +Y   A    E++ +QPS +  G L+++QL G+ WM  L++ + NGILADEMGL
Sbjct: 352  LPQNSTNYNNSARPKFEKLVEQPSYVKFGELRDFQLTGINWMAFLWSKNDNGILADEMGL 411

Query: 714  GKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER-- 771
            GKT+QT++ +++L  A+  +GP +V+VPLST+  W   FDKWAP L  I + G    R  
Sbjct: 412  GKTVQTVAFISWLIYARRQNGPHIVVVPLSTMPAWQETFDKWAPDLNVICYMGNQRSRDA 471

Query: 772  --------KPKQALIKNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKL 823
                     P     KN +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L
Sbjct: 472  IREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQFLAVDEAHRLKNAESSL 531

Query: 824  SLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQ 883
              +LN++  ++ RL++TGTPLQNN+ EL AL+NF++P  F   +  D      F N    
Sbjct: 532  YESLNSFKVNN-RLLITGTPLQNNIKELAALINFLMPGRFTIDQEID------FEN---- 580

Query: 884  DKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQM 943
                  +EE    IR LHK L+PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +
Sbjct: 581  -----QDEEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNI 635

Query: 944  LKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDT 999
            L      +   S    FS      N + +L+K  NHP++F+  E+++       + + + 
Sbjct: 636  LTKNYSALTAGSKGGHFS----LLNIMSELKKASNHPYLFDNAEERVLKKFGDGQMSREN 691

Query: 1000 IWR----SAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHT 1055
            + R    S+GK  LL+++L K K  GHRVLIF QM +++DI+ D+L    + + RLDG  
Sbjct: 692  VLRGLIMSSGKMVLLDQLLNKLKKDGHRVLIFSQMVRMLDILGDYLSIKGITFQRLDGTV 751

Query: 1056 KSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRA 1115
             S  R   ++ FNAP+S    FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RA
Sbjct: 752  PSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARA 811

Query: 1116 HRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFD 1160
            HRIGQKN V + RL++ ++VEE +L++A  K+ ++  +I  G  D
Sbjct: 812  HRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTD 856

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
            ATP-dependent nucleosome remodeling activity, member of
            the Chromodomain-Helicase-DNA-binding (CHD) family [4407
            bp, 1468 aa]
          Length = 1468

 Score =  404 bits (1037), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 215/514 (41%), Positives = 321/514 (62%), Gaps = 39/514 (7%)

Query: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729
            E++  QP  + GG L+++QL G+ WM  L++   NGILADEMGLGKT+QT++ +++L  A
Sbjct: 362  EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA 421

Query: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779
            +  +GP +++VPLST+  W   F+KWAP L  I + G    R           P+    K
Sbjct: 422  RRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 481

Query: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839
              +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +LN++  ++ R+++
Sbjct: 482  TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVAN-RMLI 540

Query: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +EE    I  
Sbjct: 541  TGTPLQNNIKELAALVNFLMPGRFTIDQEID------FEN---------QDEEQEEYIHD 585

Query: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959
            LH+ ++PF+LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L      +   +    
Sbjct: 586  LHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGH 645

Query: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011
            FS      N + +L+K  NHP++F+  E+++       + T + + R    S+GK  LL+
Sbjct: 646  FS----LLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLD 701

Query: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071
            ++L + K  GHRVLIF QM +++DI+ D+L    + + RLDG   S  R   ++ FN+P+
Sbjct: 702  QLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPD 761

Query: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131
            S+ F FLLSTRAGGLG+NL TADTV+IFD+DWNP  DLQA  RAHRIGQKN V + RL++
Sbjct: 762  SNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVS 821

Query: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFD-NKST 1164
             ++VEE +L++A  K+ ++  +I  G  D NK T
Sbjct: 822  KDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 855

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..985231)
            [4269 bp, 1422 aa]
          Length = 1422

 Score =  399 bits (1025), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 220/514 (42%), Positives = 321/514 (62%), Gaps = 39/514 (7%)

Query: 670  EEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEA 729
            E++  QPS + GG L+++QL G+ WM  L++   NGILADEMGLGKT+QT+S +++L  A
Sbjct: 342  EKLSVQPSFIKGGELRDFQLTGINWMAFLWSKSDNGILADEMGLGKTVQTVSFISWLIFA 401

Query: 730  KGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER----------KPKQALIK 779
            +  +GP LV+VPLST+  W   F+KWAP+L  + + G    R           P     K
Sbjct: 402  RRQNGPHLVVVPLSTMPAWQETFEKWAPELNCVYYMGNQKSRDVIREYEFYTNPHTKGKK 461

Query: 780  NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839
            N +F+V+LTT+EYI+K+R  L  IKW    +DE HR+KNA+S L  +L+++  ++ R+++
Sbjct: 462  NIKFNVLLTTYEYILKDRLELGAIKWQFLAVDEAHRLKNAESSLYESLSSFKVAN-RMLI 520

Query: 840  TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899
            TGTPLQNN+ EL AL+NF++P  F   +  D      F N          +E+    IR 
Sbjct: 521  TGTPLQNNIKELAALVNFLMPGKFTIDQEID------FEN---------QDEKQENYIRD 565

Query: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQK 959
            LHK L+P++LRRLKKDVEK LP K E++L+ ++S +Q + Y+ +L      +   +    
Sbjct: 566  LHKRLQPYILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYNALTAGTKGTH 625

Query: 960  FSSSRGFNNQIMQLRKICNHPFVFEEVEDQI----NPARETNDTIWR----SAGKFELLE 1011
            FS      N + +L+K  NHP++F   E+++         + + I R    S+GK  LL+
Sbjct: 626  FS----LLNIMNELKKASNHPYLFGNAENRVLAKFGDGNRSRENILRGLIMSSGKMVLLD 681

Query: 1012 RILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPN 1071
            ++L + K  GHRVLIF QM +++DI+ D+L    + + RLDG   S  R   ++ FNAP+
Sbjct: 682  KLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPD 741

Query: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131
            S+ F FLLSTRAGGLG+NL TADTVIIFD+DWNP  DLQA  RAHRIGQKN V + R ++
Sbjct: 742  SNDFVFLLSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVS 801

Query: 1132 DNSVEEAILDKAHAKLDIDGKVIQAGKFD-NKST 1164
             ++VEE +L++A  K+ ++  +I  G  D NK T
Sbjct: 802  KDTVEEEVLERARKKMILEYAIISLGVTDGNKYT 835

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
            Snf2/Rad54 subfamily of NTP-dependent DNA helicases [2562
            bp, 853 aa]
          Length = 853

 Score =  368 bits (944), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 215/553 (38%), Positives = 312/553 (56%), Gaps = 70/553 (12%)

Query: 674  QQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVH 733
            +QP +L    LK YQL+GL W+++L+ N LNGILADEMGLGKT+Q+I+LL ++YE     
Sbjct: 212  KQPRLLKNCILKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAFIYEMD-TK 270

Query: 734  GPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKN-----REFDVVLT 788
            GPFLV  PLSTL NW  EF K+AP L  + + G     K + A +KN         +V+T
Sbjct: 271  GPFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTN-GYKERSAKLKNFFKQHGGTGIVIT 329

Query: 789  TFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNL 848
            ++E I+++  L+    W   I+DEGHR+KN   +L   L     S+ RL+LTGTPLQNNL
Sbjct: 330  SYEIILRDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSN-RLLLTGTPLQNNL 388

Query: 849  PELWALLNFVLPKIFNSVKSFDEWFNTPFANTG-GQDKIAL----SEEETLLVIRRLHKV 903
             ELW+LLNF++P IF   + F++WF+    N G G +  AL    ++E    +I  LH +
Sbjct: 389  AELWSLLNFIMPDIFADFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNLISNLHTI 448

Query: 904  LRPFLLRRLKKDVEKD-LPDKVEKVLKCKMSALQHKLYQQMLKH-----------RRLFI 951
            L+PFLLRRLKK V  + LP K E ++ C M++ Q K Y+  L             +  F 
Sbjct: 449  LKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFYKAGLNGKLKKTMFKELIKDFFT 508

Query: 952  FDDSS-------------NQKFS------------------------------SSRGFNN 968
             +D               N K S                              S++   N
Sbjct: 509  LNDEYIGHVSNRSIRDFINYKLSGNETSNTDNKINPTLLQMDKLYKKNLQMEISNKKLQN 568

Query: 969  QIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFF 1028
             +MQLR+I +  F+F      ++P   T +T+ +++GK ++L++++P   + GH+VLI+ 
Sbjct: 569  MMMQLRQIIDSTFLF--YFPYLHPEDLTLETLLKTSGKLQILQKLIPPLISEGHKVLIYS 626

Query: 1029 QMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGL 1088
            Q   ++D++ED+         R+DG   ++ R   L  FN+    +  FLLSTRA GLG+
Sbjct: 627  QFVNMLDLIEDWCDLNSFATFRIDGSVNNETRKDQLEKFNSSKDKHNIFLLSTRAAGLGI 686

Query: 1089 NLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLD 1148
            NL  ADTV++FD+DWNP  DLQA DR HRIGQ++ V + RL  DN++E  IL +A  K +
Sbjct: 687  NLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQESPVIVYRLCCDNTIEHVILTRAANKRN 746

Query: 1149 IDGKVIQAGKFDN 1161
            ++  VIQ GKF+N
Sbjct: 747  LERMVIQMGKFNN 759

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
            cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  364 bits (935), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 222/585 (37%), Positives = 322/585 (55%), Gaps = 79/585 (13%)

Query: 638  SEDNVGDKNGADSDDDLERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVS 697
            ++DN  ++   D   + E ERI             K+QPS L    LK YQ++GL W+++
Sbjct: 185  TDDNRVEEMAVDVKKETEEERI------------AKEQPSYLKNCVLKPYQMEGLNWLIT 232

Query: 698  LFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAP 757
            L+ N LNGILADEMGLGKTIQ+I+LL+++YE     GPFL+  PLST+ NW  EF K+AP
Sbjct: 233  LYENGLNGILADEMGLGKTIQSIALLSFIYEM-DTKGPFLIAAPLSTVDNWMNEFAKFAP 291

Query: 758  K---LRKIAFKGPPMERKPKQALIK--NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDE 812
            +   L+  +  G    +K  +   K  NRE  V++T++E II++  ++   +W   I+DE
Sbjct: 292  EIPILKYYSQNGQDARQKLLKKFFKNNNRE-GVIVTSYEMIIRDANIIMGEQWKFLIVDE 350

Query: 813  GHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEW 872
            GHR+KN   +L   L     S+ RL+LTGTPLQNNL ELW+LLNF+LP IF   + F++W
Sbjct: 351  GHRLKNINCRLIQELKRINTSN-RLLLTGTPLQNNLSELWSLLNFILPDIFADFEIFNKW 409

Query: 873  FNTP----FANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKD-LPDKVEKV 927
            F+       +N+   +K+   E E  L I  LH +L+PFLLRRLK  V KD LP K E +
Sbjct: 410  FDFKDLDLQSNSAKLNKLINDELEKNL-ISNLHTILKPFLLRRLKSVVLKDVLPPKREYI 468

Query: 928  LKCKMSALQHKLYQQMLKHR-RLFIFDD------SSNQK--------------------- 959
            + C +S +Q K Y+  L  + ++ +F +      + NQ+                     
Sbjct: 469  VNCPLSPIQTKFYRMALSGKLKVTVFKELVKAFFTLNQEYIGTVSNKSIRDFIDYKLSEE 528

Query: 960  -----------------------FSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARET 996
                                   F+ ++   N +MQLR++ +   +F      + P   T
Sbjct: 529  PDEDKVTAVIKQMDDIYMEHLNTFTKNQRLQNMMMQLRQVVDSTLLF--FFPYMEPEDIT 586

Query: 997  NDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTK 1056
             D +  S+GK ++L+++       GH++LIF Q   ++D++ED+        LR+DG   
Sbjct: 587  LDYLLASSGKLQMLQKLAIPLIKKGHKILIFSQFVGMLDLLEDWSELNSFNSLRIDGGVD 646

Query: 1057 SDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAH 1116
            ++ R   ++ FN    D+  FLLSTRA GLG+NL  ADTVIIFD+DWNP  DLQA DR H
Sbjct: 647  NESRKEYIDEFNKKGDDHQIFLLSTRAAGLGINLVAADTVIIFDSDWNPQVDLQAMDRCH 706

Query: 1117 RIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDN 1161
            RIGQ   V + R   DN++E  IL +A  K  ++  VIQ GKF N
Sbjct: 707  RIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKLERMVIQMGKFSN 751

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..510862)
            [2415 bp, 804 aa]
          Length = 804

 Score =  360 bits (925), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 217/553 (39%), Positives = 316/553 (57%), Gaps = 81/553 (14%)

Query: 674  QQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVH 733
            QQP+++   TLK YQ++G+ W+++L+ N LNGILADEMGLGKTIQ+I+LL ++YE     
Sbjct: 177  QQPTLVRNCTLKPYQVEGVNWLITLYENGLNGILADEMGLGKTIQSIALLAFIYEM-DTR 235

Query: 734  GPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGP--PMERKP--KQALIKNREFDVVLTT 789
            GPFLV  PLS + NW  EF+K+AP +  + +     P +R    K+   KN    VV+T+
Sbjct: 236  GPFLVTAPLSVVDNWITEFEKFAPSIPVLKYYSADGPGKRHAILKEFFRKNSGEGVVVTS 295

Query: 790  FEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTL---NTYYHSDYRLILTGTPLQN 846
            +E ++++  ++   +W   I+DEGHR+KN   KL   L   NT+     RL+LTGTPLQN
Sbjct: 296  YEIVMRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELKRINTF----NRLLLTGTPLQN 351

Query: 847  NLPELWALLNFVLPKIFNSVKSFDEWFNTPFAN----TGGQ--DKIALSEEETLLVIRRL 900
            NL ELW+LLNF+LP +F   + F +WF+  F++    T  Q  DKI   E E  LV   L
Sbjct: 352  NLAELWSLLNFILPDVFADFEIFSKWFD--FSDLDLKTSSQRWDKIIGEELEKNLVT-NL 408

Query: 901  HKVLRPFLLRRLKKDVEKD-LPDKVEKVLKCKMSALQHKLYQQML--------------- 944
            H +L+PFLLRRLK+ V  D LP K E ++ C ++ LQ + Y+  L               
Sbjct: 409  HTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFYKMALAGKLKRTVFTQAIKE 468

Query: 945  --------------KHRRLFIFDDSSNQKFSSS--------------------RGFNNQI 970
                          K  R FI   +S+++  +S                    +   N +
Sbjct: 469  FFTLNREHIGSVSNKTIREFIDYKTSDEEIQASKVITDMEKLYEQHIHKELRNKRLQNLM 528

Query: 971  MQLRKICNHPFVFE----EVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLI 1026
            MQLR+I +  F+F     + ED   P       + +++GK ++L+++LP+  A  H+VLI
Sbjct: 529  MQLRQIVDSTFLFYFPYLKAEDLQLPV------LLQTSGKLQILQQLLPRLLAAKHKVLI 582

Query: 1027 FFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGL 1086
            F Q   ++D++ED+    +    R+DG   ++ R   +N+F+   S +  FLLSTRAGGL
Sbjct: 583  FSQFVSMLDLIEDWCELNNYSACRIDGSMDNETRREQINSFSEKGSPHSLFLLSTRAGGL 642

Query: 1087 GLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAK 1146
            G+NL  AD+VI+FD DWNP  DLQA DR+HRIGQ++ V + RL  D +VE  IL +A  K
Sbjct: 643  GINLTAADSVILFDNDWNPQVDLQAMDRSHRIGQQHPVIVYRLYCDKTVESVILARATNK 702

Query: 1147 LDIDGKVIQAGKF 1159
              ++  VIQ GKF
Sbjct: 703  RKLEQLVIQMGKF 715

>Kwal_47.18077
          Length = 809

 Score =  356 bits (913), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 212/570 (37%), Positives = 322/570 (56%), Gaps = 71/570 (12%)

Query: 655  ERERIDYYEVAHSIKEEV-----KQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILAD 709
            +R++I  +    + KEE+      QQPS+L    LK YQL+G+ W+++L+ N LNGILAD
Sbjct: 146  KRKKITDFFKKETKKEEIPEPVLHQQPSLLKNCQLKPYQLEGVNWLITLYENGLNGILAD 205

Query: 710  EMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPM 769
            EMGLGKT+Q+I+LL ++ E     GPFL+  PLSTL  W  EF ++AP ++ + +     
Sbjct: 206  EMGLGKTLQSIALLAFITEM-DTGGPFLIAAPLSTLDTWVNEFSRFAPDIQVLKYYS-TQ 263

Query: 770  ERKPKQALIK-----NREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLS 824
             +  +Q+L+K      +   VV+T++E II++  L+   +W   I+DEGHR+KN   KL 
Sbjct: 264  GQSYRQSLLKKFFKSTKGQGVVITSYEIIIRDIELILSYQWKFLIVDEGHRIKNINCKLI 323

Query: 825  LTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTP----FANT 880
              L    ++  RL++TGT LQNNL ELW+LLNF++P IF   + F +WF+       +++
Sbjct: 324  RELKR-INTLNRLLITGTALQNNLSELWSLLNFIMPDIFADFEIFHKWFDFSDLELKSSS 382

Query: 881  GGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDV-EKDLPDKVEKVLKCKMSALQHKL 939
             G +++   E E  L I  LH +L+PFLLRRLKK V    LP K E ++ C ++++Q KL
Sbjct: 383  QGLNRLINDELEKNL-ISNLHAILKPFLLRRLKKVVLAGSLPPKREYIVNCPLTSVQKKL 441

Query: 940  YQQMLKH-----------RRLFIFDDSSNQKFS--SSRGF-------------------- 966
            Y+  L             +  F+ +     + S  S R F                    
Sbjct: 442  YKSALNGKLKQAIFKQAIKDFFVLNSDQIGQVSNKSIRDFMEWKLNANDEDPDTEILQQM 501

Query: 967  -----------------NNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFEL 1009
                              N ++QLR++ +   +F      INP + T D + +S+GK ++
Sbjct: 502  DKLYKQHIHRALLNKRLQNPMVQLRQVVDSTLLF--FFPFINPEKLTLDFLLQSSGKLQI 559

Query: 1010 LERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNA 1069
            L++++P     GH+VLIF Q   ++D++ED+    D++  R+DG   ++ R   +  FN 
Sbjct: 560  LQQLVPPLIKKGHKVLIFTQFVGMLDLIEDWCELNDVRVCRIDGSMGNETRQEHIERFND 619

Query: 1070 PNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRL 1129
            P+  +  FL+STRAGGLG+NL  AD+VI+FD+DWNP  DLQA DR HRIGQ   V + RL
Sbjct: 620  PDDSFDAFLISTRAGGLGINLTAADSVILFDSDWNPQVDLQATDRTHRIGQTKPVIVYRL 679

Query: 1130 ITDNSVEEAILDKAHAKLDIDGKVIQAGKF 1159
              DN++E  IL +A +K  ++  VIQ GKF
Sbjct: 680  CCDNTIEHVILTRAASKRKLEKMVIQLGKF 709

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
            cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  351 bits (901), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 208/545 (38%), Positives = 307/545 (56%), Gaps = 64/545 (11%)

Query: 675  QPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHG 734
            QPS L    LK YQ +GL W+++L+ N LNGILADEMGLGKTIQ+I+LL ++YE     G
Sbjct: 188  QPSFLKNCQLKPYQKEGLNWLITLYENGLNGILADEMGLGKTIQSIALLAFIYEM-DTKG 246

Query: 735  PFLVIVPLSTLTNWNAEFDKWAPKLRKIAF---KGPPMERKPKQALIKNREFD-VVLTTF 790
            PFL+  PLST+ NW  EF ++AP +  + +   +G            KN + + V++T++
Sbjct: 247  PFLIAAPLSTVENWMNEFARFAPDIPVLKYYNSEGQAARHAMMGKFFKNNKGEGVIITSY 306

Query: 791  EYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPE 850
            E II++  L+   +W   I+DEGHR+KN   KL   L     S+ RL+LTGTPLQNNL E
Sbjct: 307  EIIIRDIELILSYQWKFLIVDEGHRLKNINCKLIRELKRINTSN-RLLLTGTPLQNNLGE 365

Query: 851  LWALLNFVLPKIFNSVKSFDEWFNTPFAN-TGGQDKIA--LSEEETLLVIRRLHKVLRPF 907
            LW+LLNF+LP IF+  + F++WF+    N     +K+   +++E    +I  LH +L+PF
Sbjct: 366  LWSLLNFILPNIFSDFEIFNKWFDFSDLNLESSSEKLTKIINDELEKNLISNLHTILKPF 425

Query: 908  LLRRLKKDV-EKDLPDKVEKVLKCKMSALQHKLYQQML---------------------- 944
            LLRRLKK+V    LP K E ++ C ++ LQ K Y+Q L                      
Sbjct: 426  LLRRLKKNVLAGSLPPKREYIITCPVTPLQKKYYKQALKGNLKQTIQKQAIKDFFTLNAE 485

Query: 945  -------KHRRLFI----------------------FDDSSNQKFSSSRGFNNQIMQLRK 975
                   K  R FI                      +D   +++  + R   N ++QLR+
Sbjct: 486  YIGTVSNKSIRDFIEWKLSADSQDIPNDNIGKMEKLYDMHIHKELLNKR-LQNMMIQLRQ 544

Query: 976  ICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMD 1035
            I N  ++F      + P   T + + +++GK ++L++++P+     H+VLIF Q   ++D
Sbjct: 545  IVNSTYLF--YFPLLEPTDLTLENLLKTSGKLQVLQKLVPELIKKKHKVLIFSQFVSMLD 602

Query: 1036 IMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADT 1095
            ++ED+    +    R+DG  +++ R   +  F+   S    FLLSTRA GLG+NL  AD+
Sbjct: 603  LIEDWSELNNFISCRIDGSMQNNSRKEQIEEFSKKGSKANLFLLSTRAAGLGINLTAADS 662

Query: 1096 VIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQ 1155
            VIIFD+DWNP  DLQA DRAHRIGQ   V + RL  DN++E  I+ +A  K  ++  VIQ
Sbjct: 663  VIIFDSDWNPQVDLQAMDRAHRIGQTKPVIVYRLYCDNTIENVIMTRAVNKRKLEKLVIQ 722

Query: 1156 AGKFD 1160
             GKF+
Sbjct: 723  MGKFN 727

>Scas_520.5
          Length = 863

 Score =  322 bits (825), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 196/551 (35%), Positives = 302/551 (54%), Gaps = 67/551 (12%)

Query: 673  KQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGV 732
            ++QPS+L    LK YQL+GL W+++L+ N LNGILAD+MGLGKTIQ+I+LL ++YE    
Sbjct: 260  QEQPSMLKNCVLKPYQLEGLNWLITLYENGLNGILADDMGLGKTIQSIALLAFIYEM-DT 318

Query: 733  HGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKN-----REFDVVL 787
             GPFL+  PLST+ NW  EF+K+AP L  + +  P   +  +  L++N         +V+
Sbjct: 319  KGPFLIAAPLSTVDNWMNEFEKFAPDLPVLKYYHPG-GKNERNKLMRNFFKKTNGTGIVV 377

Query: 788  TTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNN 847
            T++E II++   +   +W   I+DEGHR+KN   +L   L     S+ RL+LTGTPLQNN
Sbjct: 378  TSYEIIIRDADYIMSKQWKFLIVDEGHRLKNVNCRLIQELKRINTSN-RLLLTGTPLQNN 436

Query: 848  LPELWALLNFVLPKIFNSVKSFDEWFNTP----FANTGGQDKIALSEEETLLVIRRLHKV 903
            L ELW+LLNF++P IF   + F++WF+       +N+   +K+ ++EE    +I  LH +
Sbjct: 437  LAELWSLLNFIMPDIFTDFEIFNKWFDFKDLEMESNSSKLNKV-INEELQKNLISNLHTI 495

Query: 904  LRPFLLRRLKKDVEKD-LPDKVEKVLKCKMSALQHKLYQQMLKHR-RLFIFDDSSNQKFS 961
            L+PFLLRRLKK V  + LP K E V+ C ++ +Q K Y++ L+ + +  IF +     F+
Sbjct: 496  LKPFLLRRLKKTVLANILPPKREYVVNCPLTPIQKKFYKRGLEGKLKKTIFKEYVKAFFT 555

Query: 962  SSRGFNNQI--MQLRKICNHPFVFEEVED----QINPARETNDTIWRSAGKFEL----LE 1011
             +  +   +    +R+  ++     E +     Q+N   +  DT++      E+    L+
Sbjct: 556  LNSDYIGSVSNKSIREFIDYKLHEGETDSDGQIQLNDTLQKMDTLFMEYIHKEIANKRLQ 615

Query: 1012 RILPKFKATGHRVLIFF------------------------------------------Q 1029
             ++ + +      LIF+                                          Q
Sbjct: 616  NMMMQLRQIVDSTLIFYFPYLRPEDLTLQELLESSGKLKTLQRLVIPLIAKGHKILIFSQ 675

Query: 1030 MTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLN 1089
               ++D++ED+     +   R+DG   ++ R   L+ FN   + +  FLLSTRA GLG+N
Sbjct: 676  FVNMLDLLEDWCDLNSLAAFRIDGTIDNESRKEQLSKFNDKKNKHMVFLLSTRAAGLGVN 735

Query: 1090 LQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            L  ADTV++FD+DWNP  DLQA DR HRIGQ   V + R   DN++E  IL +A  K  +
Sbjct: 736  LVGADTVVLFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTLEHVILTRAANKRKL 795

Query: 1150 DGKVIQAGKFD 1160
            +  VIQ GKF+
Sbjct: 796  ERLVIQMGKFN 806

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  314 bits (805), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 189/521 (36%), Positives = 295/521 (56%), Gaps = 51/521 (9%)

Query: 678  ILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT---YLYE-----A 729
            + +  TL++YQ +G+ W+  L + HL+GIL D+MGLGKT+QTI ++    YL +      
Sbjct: 1273 VAIKATLRKYQQEGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIASDQYLRQEDYKTT 1332

Query: 730  KGVHG---PFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNREFDVV 786
            K V     P L++ P S   +W  EF+++AP L  + + G P  R P +   K  + D+V
Sbjct: 1333 KSVETRPLPSLIVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTRYPLRG--KLGDADIV 1390

Query: 787  LTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQN 846
            +T+++    +  ++SK  + + ++DEGH +KN+QSKL+  + +   +++RLILTGTP+QN
Sbjct: 1391 VTSYDVARNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSI-RANHRLILTGTPIQN 1449

Query: 847  NLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRP 906
            N+ ELW+L +F++P    S K+F E F  P A +      +  +E   L +  LHK + P
Sbjct: 1450 NVVELWSLFDFLMPGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLP 1509

Query: 907  FLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGF 966
            F+LRRLK+DV  DLP K+ +   C++S LQ +LY+   K ++  +  D  N     S+  
Sbjct: 1510 FMLRRLKEDVLSDLPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIENTMELESKNH 1569

Query: 967  NNQIMQ-LRKICNHPFV--------FEEVEDQIN-PARETNDTIWRSAGKFELLERILPK 1016
              Q +Q +RK+CNHP +        + +V+D ++    + +D     A K   L  +L +
Sbjct: 1570 IFQALQYMRKLCNHPSLVLSKDHPQYNQVQDYLSQTGMDIHDI--AHAPKLGALRNLLLE 1627

Query: 1017 FK-------------------ATGHRVLIFFQMTQVMDIMED--FLRYL-DMKYLRLDGH 1054
                                  + HR LIF Q+  ++D++E+  F +YL  + Y+RLDG 
Sbjct: 1628 CGIGVQDVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYLPSVTYMRLDGS 1687

Query: 1055 TKSDDRTALLNTFNA-PNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQD 1113
             +S DR  ++  FN  P+ D  C LL+T+ GGLGLNL  ADTVI  + DWNP  DLQA D
Sbjct: 1688 VESRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFIEHDWNPMNDLQAMD 1745

Query: 1114 RAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI 1154
            RAHR+GQK  V + R+IT  S+EE I+     K++I   V+
Sbjct: 1746 RAHRLGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTVV 1786

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  305 bits (780), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 203/549 (36%), Positives = 289/549 (52%), Gaps = 74/549 (13%)

Query: 672  VKQQPSILVGGT-LKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAK 730
            ++Q+P +L     LK+YQ  G+ W+  L+ N L+ ILADEMGLGKT Q IS L YL +  
Sbjct: 489  IRQKPKLLSSDVELKDYQQTGINWLHLLYQNDLSCILADEMGLGKTCQVISFLAYLKQTH 548

Query: 731  GVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNRE--FDVVLT 788
              +GP LV+VP STL NW  EF+K+ P L+   + G   ER   + +++  E  +DV++T
Sbjct: 549  H-NGPHLVVVPSSTLENWLREFNKFCPHLKVEPYYGSQQERAELRDILEENEGQYDVIVT 607

Query: 789  TFEYIIKER---PLLSKIKWVHTIIDEGHRMKNAQS-KLSLTLNTYYHSDYRLILTGTPL 844
            T+      +     L    +   + DEGH +KN+ S + +  +    H  +RL+LTGTPL
Sbjct: 608  TYNLAAGTKYDVSFLRNRNFDVVVYDEGHMLKNSMSERFNKLMKINAH--FRLLLTGTPL 665

Query: 845  QNNLPELWALLNFVLPKIFNSVKS-----FDEWFNTPFANTGGQDKIALSEEETLLVIRR 899
            QNNL EL +LL F++P +F S K      F +   T  A+ G    +A         I R
Sbjct: 666  QNNLKELMSLLEFIMPNLFVSKKDDLATVFKQKTRTSDADKGYNPLLAEH------AIER 719

Query: 900  LHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLK----HRRLFIFDDS 955
               +++PF+LRR K  V K LP K   +L C+M+ LQ  LYQQ +K    HRR     + 
Sbjct: 720  AKTMMKPFILRRKKDQVLKHLPRKHNHILHCEMTELQKTLYQQEIKQVMEHRRK--IKEG 777

Query: 956  SNQKFSSSRGFNNQIMQLRKICNHPFVFEEV-EDQI----------NPARETNDTI---- 1000
               + +S     N IM LRK   HP +F  +  D+I           P    N  I    
Sbjct: 778  VKMEKASRNVSKNLIMALRKASIHPLLFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIK 837

Query: 1001 ------------------------------WRSAGKFELLERILPKFKATGH-RVLIFFQ 1029
                                          W ++GK E L+ +L K     H +VL+F  
Sbjct: 838  EDMSYMTDFELHKLCCKFPSLYKFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSL 897

Query: 1030 MTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLN 1089
             TQV+DI+E  L  L++K+LRLDG T+ +DR +L++ F   ++    FLLST+AGG G+N
Sbjct: 898  FTQVLDILEFVLSTLNIKFLRLDGQTQVNDRQSLIDRFYEDDT-IPVFLLSTKAGGFGIN 956

Query: 1090 LQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            L  A+ VIIFD  +NPH D QA DRAHR+GQ  EV++  LI+ +++EE IL  A  KL +
Sbjct: 957  LVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVQVTTLISRDTIEEKILHLAKNKLAL 1016

Query: 1150 DGKVIQAGK 1158
            D  + Q  K
Sbjct: 1017 DTHISQEDK 1025

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  310 bits (795), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 188/520 (36%), Positives = 291/520 (55%), Gaps = 48/520 (9%)

Query: 678  ILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT---YL-YEAKGVH 733
            + +  TL++YQ  G+ W+  L   HL+GIL D+MGLGKT+QTI ++    YL  E   + 
Sbjct: 1307 VAIKATLRKYQQDGINWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYKLS 1366

Query: 734  G-------PFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNREFDVV 786
            G       P L++ P S   +W  EF++++P L+ + + G P  R+P +  + +   D++
Sbjct: 1367 GNIECRPLPSLIVCPPSLTGHWENEFEQYSPFLKIVVYAGGPSVRQPLRKQLSSA--DII 1424

Query: 787  LTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQN 846
            +T+++    +   +S   + + ++DEGH +KNAQSKL+  +     +++RLILTGTP+QN
Sbjct: 1425 ITSYDVARNDLDTISSYDYNYCVLDEGHLIKNAQSKLAKAVK-LIKANHRLILTGTPIQN 1483

Query: 847  NLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRP 906
            N+ ELW+L +F++P    + KSF E F  P A +      +  +E   L +  LHK + P
Sbjct: 1484 NVVELWSLFDFLMPGFLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLP 1543

Query: 907  FLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGF 966
            F+LRRLK+DV  DLP K+ +   C++S LQ +LY+   K ++  +  D  N     S+  
Sbjct: 1544 FMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQNTADVDSKQH 1603

Query: 967  NNQIMQ-LRKICNHP-FVFEEVEDQI----NPARETNDTI--WRSAGKFELLERILPKF- 1017
              Q +Q +RK+CNHP  V      Q+    N  ++T   +   R+A K   L  +L +  
Sbjct: 1604 IFQALQYMRKLCNHPALVLSNDHPQLKQIQNYLKQTGCDLHDIRNAPKLTALRTLLFECG 1663

Query: 1018 --------KATG-----------HRVLIFFQMTQVMDIMED--FLRYL-DMKYLRLDGHT 1055
                    K TG           HR LIF Q+  ++D++E+  F RY+  + Y+RLDG  
Sbjct: 1664 IGEADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLDMIENDLFKRYMPSVSYMRLDGSV 1723

Query: 1056 KSDDRTALLNTFNA-PNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDR 1114
               DR  ++  FN  P+ D  C LL+T+ GGLGLNL  ADTVI  + DWNP  DLQA DR
Sbjct: 1724 DPRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDR 1781

Query: 1115 AHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI 1154
            AHR+GQK  V + R++T  ++EE I+     K++I   V+
Sbjct: 1782 AHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIASTVV 1821

>Scas_549.4
          Length = 1079

 Score =  301 bits (770), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 175/505 (34%), Positives = 266/505 (52%), Gaps = 70/505 (13%)

Query: 687  YQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLT 746
            YQ   +QW+  L+  +  GI+ DEMGLGKTIQ I+ L  L+ +  ++GP L++ P + + 
Sbjct: 307  YQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIIAFLASLHHSGLLNGPVLIVCPATVMK 366

Query: 747  NWNAEFDKWAPKLRKIAF--KGPPMERKP-------KQALI------------KNR---- 781
             W  E   W P LR I     G  M  K        +QA++            +NR    
Sbjct: 367  QWCNELHHWWPPLRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRSKTK 426

Query: 782  ------------------EFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKL 823
                              +  +++TT+  +      L K+ W + ++DEGH+++N  S +
Sbjct: 427  ASLESTFNIQSLIDKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPDSDI 486

Query: 824  SLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQ 883
            SLT      +  R+IL+GTP+QNNL ELW+L +F+ P    ++  F + F  P    G  
Sbjct: 487  SLTCKKI-KTPNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGGYA 545

Query: 884  DKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQM 943
            +   +  +  +     L  ++ P+LLRR+K DV KDLP+K E VL CK++  Q   Y + 
Sbjct: 546  NATNIQVQTGVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYLEF 605

Query: 944  LKHRRLFIFDDSSNQKFSSSRGFNNQIMQ----LRKICNHPFVFEEVEDQINPARETNDT 999
            L    L           +  RG    ++     LRKICNHP + E  E Q     ET+  
Sbjct: 606  LNSNEL-----------TQIRGGRRHVLYGIDILRKICNHPDLLEREERQY----ETDYG 650

Query: 1000 IWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLD-----MKYLRLDGH 1054
              + +GK ++++++L  +   GH+ L+F Q  Q++DI+E F+++ D     +KYLR+DG 
Sbjct: 651  NPKRSGKMQVVKQLLLLWHKEGHKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMDGT 710

Query: 1055 TKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDR 1114
            +    R  L++ FN  N DY  FLL+TR GGLG+NL  A+ +II+D DWNP  D+QA++R
Sbjct: 711  SNISKRQGLVDQFN--NEDYDVFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQARER 768

Query: 1115 AHRIGQKNEVRILRLITDNSVEEAI 1139
            A RIGQK EV I RL+   S+EE I
Sbjct: 769  AWRIGQKREVSIYRLMVSGSIEEKI 793

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  306 bits (784), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 189/526 (35%), Positives = 295/526 (56%), Gaps = 59/526 (11%)

Query: 678  ILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT---YL----YE-A 729
            I +  TL++YQ  G+ W+  L   HL+GIL D+MGLGKT+QTI ++    YL    YE  
Sbjct: 1266 IAIKATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKT 1325

Query: 730  KGVHG---PFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMER---KPKQALIKNREF 783
            + V     P L+I P S   +W  EFD++AP L+ + + G P  R   +P+ +     + 
Sbjct: 1326 RSVESRALPSLIICPPSLTGHWENEFDQYAPFLKVVVYAGGPTVRLTLRPQLS-----DA 1380

Query: 784  DVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTP 843
            D+++T+++    +  +L+K ++ + ++DEGH +KN+QSKL+  +     +++RLILTGTP
Sbjct: 1381 DIIVTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEIT-ANHRLILTGTP 1439

Query: 844  LQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKV 903
            +QNN+ ELW+L +F++P    + K F E F  P A +      +  +E  +L +  LHK 
Sbjct: 1440 IQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQ 1499

Query: 904  LRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSS 963
            + PF+LRRLK+DV  DLP K+ +   C++  LQ +LY    K ++  +  D  N + +  
Sbjct: 1500 VLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIENSEIADG 1559

Query: 964  RGFNNQIMQ-LRKICNHPFV--------FEEVEDQI-NPARETNDTIWRSAGKFELLERI 1013
            +    Q +Q +RK+CNHP +          +V+D +     + +D I  +A K   L  +
Sbjct: 1560 KQHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDII--NAPKLSALRTL 1617

Query: 1014 LPKF---------KA------------TGHRVLIFFQMTQVMDIMED--FLRYL-DMKYL 1049
            L +          KA            + HR LIF Q+  ++D++E+  F +Y+  + Y+
Sbjct: 1618 LFECGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVTYM 1677

Query: 1050 RLDGHTKSDDRTALLNTFNA-PNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQD 1108
            RLDG     DR  ++  FN  P+ D  C LL+T+ GGLGLNL  ADTVI  + DWNP  D
Sbjct: 1678 RLDGSIDPRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMND 1735

Query: 1109 LQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI 1154
            LQA DRAHRIGQK  V + R+IT  ++EE I+     K++I   V+
Sbjct: 1736 LQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVV 1781

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  298 bits (764), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 182/517 (35%), Positives = 264/517 (51%), Gaps = 62/517 (11%)

Query: 687  YQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLT 746
            YQ   +QW+  L+  +  GI+ DEMGLGKTIQ IS L  L+ +  + GP L++ P + + 
Sbjct: 288  YQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIISFLASLHHSGMLDGPILIVCPATVMK 347

Query: 747  NWNAEFDKWAPKLRKIAFK--GPPMERKPK------QALIKN---REFD----------- 784
             W  EF  W P  R +     G  M  K K      + ++ N    EF            
Sbjct: 348  QWCNEFHTWWPPFRAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSKKTK 407

Query: 785  ---------------------VVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKL 823
                                 V++TT+  +      L K+KW + ++DEGH+++N  S +
Sbjct: 408  STMESKLNLTKLVDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPDSDI 467

Query: 824  SLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQ 883
            SLT      S+ R+IL+GTP+QNNL ELW+L +F+ P    ++  F + F  P    G  
Sbjct: 468  SLTCKQLKTSN-RVILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGGYA 526

Query: 884  DKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQM 943
            +   +  +        L  ++ P+LLRR+K DV KDLP K E VL CK++  Q   Y Q 
Sbjct: 527  NATNIQVQTGYKCAVALRDLISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRNKYLQF 586

Query: 944  LKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRS 1003
            L    L    +   Q           I  LRKICNHP +   V D  +      D   + 
Sbjct: 587  LNSGDLVKIKNGKRQVLYG-------IDILRKICNHPDIL--VRDMRHSEESYGDP--KR 635

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLD-----MKYLRLDGHTKSD 1058
            +GK ++++++L  +K  GH+ L+F Q  Q++DI+E F+ Y D     + YLR+DG T   
Sbjct: 636  SGKMQVVKQLLKLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYLRMDGTTNIA 695

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
             R  L++ FN  N  Y  FLL+TR GGLG+NL  A+ +IIFD DWNP  DLQA++RA RI
Sbjct: 696  ARQHLVDKFN--NELYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRI 753

Query: 1119 GQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQ 1155
            GQK EV I RL+   S+EE I  +   K  +  K+++
Sbjct: 754  GQKREVTIYRLMIAGSIEEKIYHRQIFKQFLTNKILK 790

>Scas_664.9
          Length = 1859

 Score =  305 bits (780), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 188/525 (35%), Positives = 291/525 (55%), Gaps = 57/525 (10%)

Query: 678  ILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT---YL-------- 726
            + +  TL++YQ  G+ W+  L    L+GIL D+MGLGKT+QTI ++    YL        
Sbjct: 1261 VAIKATLRKYQQDGVNWLAFLNKYRLHGILCDDMGLGKTLQTICIIASDQYLRAEDYKKT 1320

Query: 727  --YEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNREFD 784
               E + +  P L++ P S   +W  EF+++AP L+ I + G P  R P +  + +   D
Sbjct: 1321 NSVETRKL--PSLIVCPPSLTGHWENEFEQYAPFLKIIVYAGGPSMRIPLRDELGSA--D 1376

Query: 785  VVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPL 844
            +V+T+++    +  +++K  + + ++DEGH +KNAQSKL+  +     +++RLILTGTP+
Sbjct: 1377 IVITSYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQI-SANHRLILTGTPI 1435

Query: 845  QNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVL 904
            QNN+ ELW+L +F++P    + K F E F  P A +      +  +E  +L +  LHK +
Sbjct: 1436 QNNVVELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLALEALHKQV 1495

Query: 905  RPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSR 964
             PF+LRRLK+DV  DLP K+ +   C++S LQ +LYQ   K ++  +  D  N   + + 
Sbjct: 1496 LPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDIENTTDTDNS 1555

Query: 965  GFNNQIMQ-LRKICNHPFV--------FEEVEDQI-NPARETNDTIWRSAGKFELLERIL 1014
                Q +Q +RK+CNHP +          +V+D +     + +D I  +A K   L  +L
Sbjct: 1556 QHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGIDLHDVI--NAPKLNALRTLL 1613

Query: 1015 ---------------PKFKATG------HRVLIFFQMTQVMDIMED--FLRYL-DMKYLR 1050
                           P    TG      HR LIF Q+  ++D++E+  F RY+  + Y+R
Sbjct: 1614 FECGIGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKRYMPSVTYMR 1673

Query: 1051 LDGHTKSDDRTALLNTFNA-PNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDL 1109
            LDG     DR  ++  FN  P+ D  C LL+T+ GGLGLNL  ADTVI  + DWNP  DL
Sbjct: 1674 LDGSVDPRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDL 1731

Query: 1110 QAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI 1154
            QA DRAHR+GQK  V + R+IT  ++EE I+     K++I   V+
Sbjct: 1732 QAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVV 1776

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  304 bits (778), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 184/520 (35%), Positives = 287/520 (55%), Gaps = 49/520 (9%)

Query: 678  ILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT---YL-------- 726
            + +  TL++YQ  G+ W+  L   HL+GIL D+MGLGKT+QTI ++    YL        
Sbjct: 1281 VAIKATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYKKT 1340

Query: 727  YEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNREFDVV 786
               K    P L+I P S   +W  EF +++P L  + + G P  R P Q  +     D+V
Sbjct: 1341 QSEKTRPLPSLIICPPSLTGHWEQEFQQYSPTLNVLVYAGGPSVRYPLQGQVPTA--DIV 1398

Query: 787  LTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQN 846
            +T+++    +   L K  + + ++DEGH +KN+QSKL+  +    +S++RL+LTGTP+QN
Sbjct: 1399 VTSYDVARNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVK-LINSNHRLVLTGTPIQN 1457

Query: 847  NLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRP 906
            N+ ELW+L +F++P    + K F E F  P A++      +  +E   L +  LHK + P
Sbjct: 1458 NVVELWSLFDFLMPGFLGTEKMFQERFAKPIASSRNSKTSSKEQEAGALALEALHKQVLP 1517

Query: 907  FLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGF 966
            F+LRRLK++V  DLP K+ +   C++S LQ +LY   +K ++  +  D  N     ++  
Sbjct: 1518 FMLRRLKEEVLSDLPPKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDIENTAEVENKQH 1577

Query: 967  NNQIMQ-LRKICNHPFV--------FEEVEDQINPARETNDTIWRSAGKFELLERIL--- 1014
              Q +Q +RK+CNHP +        F++V+  ++        I   A K E L+ +L   
Sbjct: 1578 IFQALQYMRKLCNHPSLVLNSSHPQFQQVQSYLSQTGMDLHDIGH-APKLEALKTLLLEC 1636

Query: 1015 --------------PKFK--ATGHRVLIFFQMTQVMDIMEDFL--RYL-DMKYLRLDGHT 1055
                          P      + HRVLIF Q+  ++D++E+ L  ++L  + ++RLDG  
Sbjct: 1637 GIGIQDVEKKSNKNPSIDNVISQHRVLIFCQLKDMLDMVENDLLKKHLPSVTFMRLDGSV 1696

Query: 1056 KSDDRTALLNTFNA-PNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDR 1114
             S DR  ++  FN  P+ D  C LL+T+ GGLGLNL  ADTVI  + DWNP  DLQA DR
Sbjct: 1697 DSRDRQKVVRKFNEDPSID--CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDR 1754

Query: 1115 AHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI 1154
            AHR+GQK  V + R+IT  ++EE I+     K++I   ++
Sbjct: 1755 AHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIV 1794

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
            Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
            recombination protein, start by similarity
          Length = 1033

 Score =  296 bits (759), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 178/526 (33%), Positives = 265/526 (50%), Gaps = 76/526 (14%)

Query: 687  YQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLT 746
            YQ   +QW+  L+     GI+ DEMGLGKTIQ I+ L  L+ ++ ++GP LV+ P + + 
Sbjct: 268  YQKTCVQWLCELYQQGCGGIIGDEMGLGKTIQIIAFLATLHHSRKLNGPVLVVCPATVMK 327

Query: 747  NWNAEFDKWAPKLRKIAF--------KGP--PMERKPKQALIKN---------------- 780
             W  EF  W P  R +          KG   P E   K  +  N                
Sbjct: 328  QWCNEFHTWWPPFRAVILHSIGAGMNKGTQIPEEELEKMLMTSNYGTFTYNDYEKKEKTR 387

Query: 781  -----------------REFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKL 823
                              +  +++TT+  +      L  ++W + I+DEGH+++N  S +
Sbjct: 388  TSLESRKSVKKLLEKVITDGHIIITTYVGLRLHSEALLNVRWGYAILDEGHKIRNPDSDI 447

Query: 824  SLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQ 883
            SLT      +  R+IL+GTP+QNNL ELW+L +FV P    ++  F + F  P    G  
Sbjct: 448  SLTCKQL-KTQNRIILSGTPIQNNLTELWSLFDFVYPGKLGTLPVFQQQFANPINMGGYA 506

Query: 884  DKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQM 943
            +   +  +        L  ++ P+LLRR+K DV KDLP K E VL CK++  Q   Y + 
Sbjct: 507  NASNIQVKTGYKCAVALRDLISPYLLRRVKSDVAKDLPKKNEMVLFCKLTQYQKSKYLEF 566

Query: 944  LKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFE---------EVEDQINPAR 994
            L    L        Q           I  LRKICNHP + +         E  D  NPAR
Sbjct: 567  LHSDELMKIRKGKRQVLYG-------IDILRKICNHPDLLDLKRKKMNDYEDADYGNPAR 619

Query: 995  ETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRY-----LDMKYL 1049
                     +GK ++++++L  + + GH+ L+F Q  Q++DI+++F+ Y      D+K+L
Sbjct: 620  ---------SGKMQVVKQLLLLWHSQGHKTLLFTQSRQMLDILQEFISYKDPELSDLKFL 670

Query: 1050 RLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDL 1109
            R+DG T    R +L++ FN  N  Y  FLL+TR GGLG+NL  A+ +IIFD DWNP  D+
Sbjct: 671  RMDGTTNIGSRQSLVDKFN--NEPYDVFLLTTRVGGLGINLTGANRIIIFDPDWNPSTDM 728

Query: 1110 QAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQ 1155
            QA++RA RIGQK EV I RL+   S+EE I  +   K  +  K+++
Sbjct: 729  QARERAWRIGQKREVTIYRLMIAGSIEEKIYHRQIFKQFLSNKILK 774

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
            (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  294 bits (752), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 177/519 (34%), Positives = 267/519 (51%), Gaps = 62/519 (11%)

Query: 684  LKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLS 743
            L  YQ   +QW+  L   +  GI+ DEMGLGKTIQ +S L  L+ +  + GP LV+ P +
Sbjct: 263  LFSYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQIVSFLASLHHSGKLKGPVLVVCPAT 322

Query: 744  TLTNWNAEFDKWAPKLRKIAFK--GPPM-------ERKPKQALIKNR--EFD-------- 784
             +  W +EF  W P  R +     G  M       E + ++ L+++   EF         
Sbjct: 323  VMKQWCSEFQTWWPPFRAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANLG 382

Query: 785  ------------------------VVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQ 820
                                    +++TT+  +     LL  + W + ++DEGH+++N  
Sbjct: 383  RTKKQLEARRGIESLVQKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNPD 442

Query: 821  SKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANT 880
            + +SLT      + +R+IL+GTP+QNNL ELW+L +F+ P    ++  F + F  P    
Sbjct: 443  AGISLTCKR-LRTPHRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINAG 501

Query: 881  GGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLY 940
            G  +   +  +        L  ++ P+LLRR+K DV KDLP K E VL CKM+  Q + Y
Sbjct: 502  GYANATNIQVQTGYKCAVALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKY 561

Query: 941  QQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTI 1000
             Q L    +    +   Q           I  LRKICNHP + E    +  P+    D  
Sbjct: 562  LQFLNSEDMIKIKNGRRQVLYG-------IDILRKICNHPDLLERDFRKHEPS--FGDP- 611

Query: 1001 WRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLD-----MKYLRLDGHT 1055
             R +GK  +++++L  +K  GH+ L+F Q  Q++DI+E ++ + D     ++YLR+DG T
Sbjct: 612  -RRSGKMTVIKQLLLTWKKQGHKALLFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTT 670

Query: 1056 KSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRA 1115
                R AL++ FN  N  Y  FLL+TR GGLG+NL  A+ +IIFD DWNP  DLQA++RA
Sbjct: 671  NIAHRQALVDRFN--NGPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERA 728

Query: 1116 HRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI 1154
             RIGQK +V I  L+   S+EE I  +   K  +  KV+
Sbjct: 729  WRIGQKRDVTIYLLMVAGSIEEKIYHRQIFKQFLTNKVL 767

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
            Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
            recombination protein, start by similarity
          Length = 1071

 Score =  294 bits (752), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 173/502 (34%), Positives = 264/502 (52%), Gaps = 64/502 (12%)

Query: 687  YQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLT 746
            YQ  G+QW+  LF     GI+ DEMGLGKTIQ  + L  L+ +  + GP L++ P + + 
Sbjct: 300  YQKTGVQWLYELFQQRRGGIIGDEMGLGKTIQVTAFLAALHHSNLLSGPVLIVCPATVMK 359

Query: 747  NWNAEFDKWAPKLRKIAFK--GPPMERKPK-----------QALIKNREFD--------- 784
             W  E  +W P  R +     G  M  K             ++ ++N +F          
Sbjct: 360  QWCNEIHQWWPPFRAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENASKLK 419

Query: 785  ---------------------VVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKL 823
                                 +++TT+  +      L  + W + ++DEGH+++N  S++
Sbjct: 420  SKVETGMHMQNLISKVVADGHIIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPDSEI 479

Query: 824  SLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQ 883
            SLT       + R+IL+GTP+QNNL ELW+L +F+ P    ++  F + F  P  N GG 
Sbjct: 480  SLTCKKLKCKN-RIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPI-NMGGY 537

Query: 884  DKIALSEEET-LLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQ 942
                 ++ +T       L  ++ P+LLRR+K DV KDLP K E VL CK++  Q + Y +
Sbjct: 538  ANATNTQVQTGYRCAVALRDLISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRRKYLE 597

Query: 943  MLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWR 1002
                   F+  D  +Q     R     I  LRKICNHP + +   D I       D   +
Sbjct: 598  -------FLSSDELSQIKGGKRHVLYGIDILRKICNHPDLLDR--DYIKNTSGYGDP--K 646

Query: 1003 SAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRY-----LDMKYLRLDGHTKS 1057
             +GK ++++++L  +K+ GH+ L+F Q  Q++DI+E+F+++      D++YLR+DG T  
Sbjct: 647  RSGKMQVVKQLLKLWKSEGHKTLLFTQSRQMLDILEEFIKFKEPELSDIRYLRMDGTTSI 706

Query: 1058 DDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHR 1117
              R  L++ FN  N  Y  FLL+TR GGLG+NL  A+ +II+D DWNP  DLQA++RA R
Sbjct: 707  QVRQTLVDRFN--NESYDVFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDLQARERAWR 764

Query: 1118 IGQKNEVRILRLITDNSVEEAI 1139
            IGQK EV I RL+   ++EE I
Sbjct: 765  IGQKREVSIYRLMISGTIEEKI 786

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
            involved in transcription-coupled repair in some strain
            backgrounds, may have a role in chromatin remodeling,
            homolog of Cockayne syndrome B gene ERCC-6 [3258 bp, 1085
            aa]
          Length = 1085

 Score =  291 bits (745), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 175/503 (34%), Positives = 263/503 (52%), Gaps = 64/503 (12%)

Query: 687  YQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLT 746
            YQ   +QW+  L+  +  GI+ DEMGLGKTIQ I+ +  L+ +  + GP L++ P + + 
Sbjct: 300  YQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPATVMK 359

Query: 747  NWNAEFDKWAPKLRKI-------------AFKGPP-------MERKP------------- 773
             W  EF  W P LR +              FK          M  KP             
Sbjct: 360  QWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTR 419

Query: 774  -KQALIKNREFD-----------VVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQS 821
             K+AL  +   D           +++TT+  +      L K+KW + ++DEGH+++N  S
Sbjct: 420  TKKALESSYHLDKLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDS 479

Query: 822  KLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTG 881
            ++SLT      +  R+IL+GTP+QNNL ELW+L +F+ P    ++  F + F  P    G
Sbjct: 480  EISLTCKKL-KTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGG 538

Query: 882  GQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQ 941
              +   +  +        L  ++ P+LLRR+K DV KDLP K E VL CK++  Q   Y 
Sbjct: 539  YANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYL 598

Query: 942  QMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIW 1001
            + L    L       NQ  +  R     I  LRKICNHP + +    + NP  +  D   
Sbjct: 599  EFLHSSDL-------NQIQNGKRNVLFGIDILRKICNHPDLLDRDTKRHNP--DYGDP-- 647

Query: 1002 RSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLD-----MKYLRLDGHTK 1056
            + +GK ++++++L  +   G++ L+F Q  Q++DI+E+F+   D     + YLR+DG T 
Sbjct: 648  KRSGKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTN 707

Query: 1057 SDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAH 1116
               R +L++ FN  N  +  FLL+TR GGLG+NL  A+ +IIFD DWNP  D+QA++RA 
Sbjct: 708  IKGRQSLVDRFN--NESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAW 765

Query: 1117 RIGQKNEVRILRLITDNSVEEAI 1139
            RIGQK EV I RL+   S+EE I
Sbjct: 766  RIGQKREVSIYRLMVGGSIEEKI 788

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  290 bits (741), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 198/538 (36%), Positives = 287/538 (53%), Gaps = 68/538 (12%)

Query: 683  TLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPL 742
            +LK+YQ  G+ W+  L+ N ++ ILAD+MGLGKT Q IS   YL +     GP LV+VP 
Sbjct: 571  SLKDYQQTGINWLNLLYQNKMSCILADDMGLGKTCQVISFFAYLKQI-NEPGPHLVVVPS 629

Query: 743  STLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR--EFDVVLTTFEYIIKERPLL 800
            STL NW  EF K+AP L+   + G   ER+  + +++    ++DV++TT+      +  +
Sbjct: 630  STLENWLREFQKFAPALKIEPYYGSLQEREELRDILERNAGKYDVIVTTYNLAAGNKYDV 689

Query: 801  SKIK---WVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNF 857
            S +K   +   + DEGH +KN+ S+    L     +++RL+LTGTPLQNNL EL +LL F
Sbjct: 690  SFLKNRNFNVVVYDEGHMLKNSTSERFAKL-MKIRANFRLLLTGTPLQNNLKELMSLLEF 748

Query: 858  VLPKIFNSVK-SFDEWFNTPFANT-GGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKD 915
            ++P +F S K SFD  F      T   ++   L  +E    I R   +++PF+LRR K  
Sbjct: 749  IMPNLFISKKESFDAIFKQRAKTTDDNKNHNPLLAQE---AITRAKTMMKPFILRRRKDQ 805

Query: 916  VEKDLPDKVEKVLKCKMSALQHKLY----QQMLKHRRLF----IFDDSSNQKFSSSRGFN 967
            V K LP K   +  C+++A+Q K+Y    Q +L+H+R+     +  D+  +    S    
Sbjct: 806  VLKHLPPKHTHIQYCELNAIQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQSSSSK 865

Query: 968  NQIMQLRKICNHPFVFEEV-EDQI----------NPARETN------------------- 997
            N IM LRK   HP +F  +  D+I           PA   N                   
Sbjct: 866  NLIMALRKASLHPLLFRNIYNDKIITKMSDAILDEPAYAENGNKEYIKEDMSYMTDFELH 925

Query: 998  -------DTI---------WRSAGKFELLERILPKFKATGH-RVLIFFQMTQVMDIMEDF 1040
                   +T+         W  +GK + L+++L         +VLIF   TQV+DI+E  
Sbjct: 926  KLCCNFPNTLSKYQLHNDEWMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMV 985

Query: 1041 LRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFD 1100
            L  LD K+LRLDG T+ +DR  L++ F   + D   F+LST+AGG G+NL  A+ VIIFD
Sbjct: 986  LSTLDYKFLRLDGSTQVNDRQLLIDKF-YEDKDIPIFILSTKAGGFGINLVCANNVIIFD 1044

Query: 1101 TDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGK 1158
              +NPH D QA DRAHR+GQ  EV I  LIT +S+EE I   A  KL +D  + +  K
Sbjct: 1045 QSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIHQLAKNKLALDSYISEDKK 1102

>Kwal_26.7123
          Length = 1081

 Score =  288 bits (737), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 199/549 (36%), Positives = 292/549 (53%), Gaps = 81/549 (14%)

Query: 673  KQQPSILVGG-TLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKG 731
            KQ+P +L    TLK+YQ  G+ W+  L+ N+L+ ILADEMGLGKT Q I+ L+YL +   
Sbjct: 512  KQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NN 570

Query: 732  VHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR--EFDVVLTT 789
              GP LV+VP STL NW  EF+K+ P L+   + G   ER   + ++++   ++DV++TT
Sbjct: 571  EPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTT 630

Query: 790  FEYIIKERPLLSKIK---WVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQN 846
            +      +  +S +K   +   + DEGH +KN+ S+   T      +++RL+LTGTPLQN
Sbjct: 631  YNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLLTGTPLQN 689

Query: 847  NLPELWALLNFVLPKIFNSVKS-----FDEWFNTPFANTGGQDKIALSEEETLLVIRRLH 901
            NL EL +LL F++P +F S K+     F +   T  +N   +D   L  +E    I R  
Sbjct: 690  NLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSN---KDYNPLLAQE---AIARAK 743

Query: 902  KVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLY----QQMLKHRRLFIFDDSS- 956
             +++PF+LRR K  V K LP K  K+  C+MS +Q  +Y    QQ+L H+R+    +   
Sbjct: 744  TMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLREREEEG 803

Query: 957  -------NQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQI-----------------NP 992
                    +K   ++   N IM LRK   HP +F    D +                 N 
Sbjct: 804  SAEEPRPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENG 863

Query: 993  ARE------------------------------TNDTIWRSAGKFELLERILPK-FKATG 1021
             +E                               ND  W ++GK   L +IL    +   
Sbjct: 864  NKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDE-WMNSGKITALRKILENIIEHKK 922

Query: 1022 HRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLST 1081
             +VL+F   TQ++DI+E  L  L++ +LRLDG T+ +DR AL++ F+  ++    F+LST
Sbjct: 923  EKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IPVFILST 981

Query: 1082 RAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILD 1141
            +AGG G+NL  A+ VIIFD  +NPH D QA DR+HR+GQ   V I  LIT NS+EE IL 
Sbjct: 982  KAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQ 1041

Query: 1142 KAHAKLDID 1150
             A  KL +D
Sbjct: 1042 LAKNKLALD 1050

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  288 bits (736), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 192/549 (34%), Positives = 285/549 (51%), Gaps = 78/549 (14%)

Query: 683  TLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPL 742
            +LK+YQ  G+ W+  L++N ++ ILAD+MGLGKT Q IS L YL +  G   P L++VP 
Sbjct: 571  SLKDYQQTGINWLNLLYHNQISCILADDMGLGKTCQVISFLAYLKQI-GQPSPHLIVVPS 629

Query: 743  STLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNRE--FDVVLTTFEYIIKERPLL 800
            STL NW  EF K+ P L+   + G   ER   + +++  +  +DV++TT+      +  +
Sbjct: 630  STLENWLREFQKFCPSLKIEPYYGTQQERADLREILERNDGKYDVIVTTYNLAAGNKYDV 689

Query: 801  SKIKWVH---TIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNF 857
            S +K  +    + DEGH +KN+ S+    L    H+++RL+LTGTPLQNNL EL +LL F
Sbjct: 690  SFLKTRNFNVVVYDEGHMLKNSMSERFNKL-MRIHANFRLLLTGTPLQNNLKELMSLLEF 748

Query: 858  VLPKIFNSVKS-----FDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRL 912
            ++P +F S K      F +   T   N G    +A         I R   +++PF+LRR 
Sbjct: 749  IMPNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQ------AITRAKTMMKPFILRRR 802

Query: 913  KKDVEKDLPDKVEKVLKCKMSALQHKLYQQ----MLKHRRLF----IFDDSSNQKFSSSR 964
            K  V K LP K  +   C M+  Q ++Y +    +++H+++     + +D   +    + 
Sbjct: 803  KDQVLKHLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKIENN 862

Query: 965  GFNNQIMQLRKICNHPFVFEEVEDQIN-----------PARETN---------------- 997
               N IM LRK   HP +F  + D              PA   N                
Sbjct: 863  SSKNLIMSLRKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIREDMSFMTDF 922

Query: 998  ----------DTI---------WRSAGKFELLERILPK-FKATGHRVLIFFQMTQVMDIM 1037
                      +T+         W ++GK + L+++L         +VLIF   TQV+DI+
Sbjct: 923  ELHRLCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVLDIL 982

Query: 1038 EDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVI 1097
            E  L  L+ K+LRLDG T+ +DR  +++ F   N+    F+LSTRAGG G+NL  A+ VI
Sbjct: 983  EKVLSTLNYKFLRLDGSTQVNDRQTMIDKFYDDNT-IPIFMLSTRAGGFGINLVCANHVI 1041

Query: 1098 IFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVI--- 1154
            IFD  +NPH D QA DRAHR+GQ  EV +  LIT +S+EE I   A  KL +D +V    
Sbjct: 1042 IFDQSFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLALDSQVSSSE 1101

Query: 1155 -QAGKFDNK 1162
             Q+   DNK
Sbjct: 1102 DQSDLIDNK 1110

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
            (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  283 bits (725), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 207/603 (34%), Positives = 300/603 (49%), Gaps = 96/603 (15%)

Query: 638  SEDNVGDK----------------NGADSDDD----LERERIDYYEVAHSIKEEV---KQ 674
            S DN  D                    +SDDD    + R            K+ V   K+
Sbjct: 401  SADNASDGDYSDENDEDDEEFEDVYEEESDDDDFGKVTRRHPSGRGRGRPEKKNVKFFKR 460

Query: 675  QPSILVGGT-LKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVH 733
            +P +L     LK+YQ  GL W+  L+ ++L+ ILADEMGLGKT Q IS L YL E     
Sbjct: 461  KPKLLAPDIELKDYQQTGLNWINLLYQHNLSCILADEMGLGKTCQVISFLAYLKEQNHT- 519

Query: 734  GPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIK--NREFDVVLTTFE 791
            GP LV+VP STL NW  EF K+ P+L+   + G   ER   + +++  + ++D ++TT+ 
Sbjct: 520  GPHLVVVPSSTLENWLREFKKFCPQLKIEPYYGSQQERAELRDILEENDGQYDAIVTTYN 579

Query: 792  YIIKERPLLSKIK---WVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNL 848
                 +  +S +K   +   I DEGH +KN+ S+   T     H+++RL+LTGTPLQNNL
Sbjct: 580  LASGNKADVSFLKNRQFNVVIYDEGHMLKNSMSE-RFTKLMKIHANFRLLLTGTPLQNNL 638

Query: 849  PELWALLNFVLPKIFNSVKS-----FDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKV 903
             EL +LL F++P +F S K      F +   T  +N   +D   L  +E    I R   +
Sbjct: 639  RELMSLLEFIMPSLFVSKKDELAAVFKQRARTSDSN---KDYNPLLAQE---AIDRAKTI 692

Query: 904  LRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQ----MLKHRRL----FIFDDS 955
            ++PF+LRR K  V K LP K   +  C M+  Q  +Y +    +++HRR+     +  D+
Sbjct: 693  MKPFILRRRKDQVLKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDA 752

Query: 956  SNQKFSSSRGFNNQIMQLRKICNHPFVFE---------EVEDQINPARETNDT------- 999
              +   +     N IM LRK   HP +F          E+ ++I    E  D+       
Sbjct: 753  GERALVAQSTSKNLIMALRKAAIHPLLFRHHYSDDRIAEMSERILAEPEYADSGNRDYIR 812

Query: 1000 -----------------------------IWRSAGKFELLERILPKFKATGHRVLIFFQM 1030
                                          W ++GK   L+ +L    A   + L+F   
Sbjct: 813  EDMSYMCDLELHRLCCRFPSLASFQLSEPTWMASGKVHRLQPLLRAAIARREKTLVFSLF 872

Query: 1031 TQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNL 1090
            TQV+DI+E  L  L + +LRLDG T  +DR AL++ F+  ++D   FLLST+AGG G+NL
Sbjct: 873  TQVLDILELVLSSLGIAFLRLDGSTPVNDRQALIDRFHT-DTDVPVFLLSTKAGGFGINL 931

Query: 1091 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDID 1150
              A+ VIIFD  +NPH D QA DRAHR+GQ  EV +  L++  +VEE IL  A  KL +D
Sbjct: 932  VCANHVIIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLALD 991

Query: 1151 GKV 1153
              V
Sbjct: 992  SSV 994

>Scas_548.4
          Length = 1054

 Score =  284 bits (726), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 189/535 (35%), Positives = 276/535 (51%), Gaps = 72/535 (13%)

Query: 683  TLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPL 742
            TLK+YQ  G+ W+  L++N ++ ILAD+MGLGKT Q IS   YL +     GP LV+VP 
Sbjct: 495  TLKDYQQTGINWLNLLYHNQMSCILADDMGLGKTCQVISFFAYLKQI-NEPGPHLVVVPS 553

Query: 743  STLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR--EFDVVLTTFEYIIKER--- 797
            STL NW  EF K+ P L+   + G   ER   + +++    ++DV++TT+      +   
Sbjct: 554  STLENWLREFQKFCPTLKIEPYYGSQNERADLREILERTAGQYDVIVTTYNLAAGNKYDV 613

Query: 798  PLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNF 857
              L   ++   + DEGH +KN+ S+    L      ++RL+LTGTPLQNNL EL +LL F
Sbjct: 614  SFLRNRQFNVVVYDEGHMLKNSMSERFNKL-MRIQGNFRLLLTGTPLQNNLRELMSLLEF 672

Query: 858  VLPKIFNSVK-SFDEWFNTPFANTG---GQDKIALSEEETLLVIRRLHKVLRPFLLRRLK 913
            ++P +F S K S    F      T    G + + + E      I R   +++PF+LRR K
Sbjct: 673  IMPALFISKKESLASVFKQRAKTTDDNKGHNPLLVQE-----AIERAKTMMKPFILRRRK 727

Query: 914  KDVEKDLPDKVEKVLKCKMSALQHKLY----QQMLKHRRLFIF----DDSSNQKFSSSRG 965
              V K LP K  K+  C M  LQ K+Y    + +++H+++ +     DD   +    S  
Sbjct: 728  DQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMILDGTLPDDPKERAKIQSSS 787

Query: 966  FNNQIMQLRKICNHPFVFEEVEDQINPARETNDTI------------------------- 1000
             +N IM LRK   HP +F  + +    A+ +   I                         
Sbjct: 788  SSNLIMTLRKAALHPLLFRTIYNDALIAKMSKAIINEPQYKVDGNIEFIKEDMSVMTDFE 847

Query: 1001 ---------------------WRSAGKFELLERILPKFK-ATGHRVLIFFQMTQVMDIME 1038
                                 W ++GK + L R+L +       +VLIF   TQV+DI+E
Sbjct: 848  LHRLCLNFPNTLSRYQLKNKEWMNSGKVDTLCRLLKEIIFERKEKVLIFSLFTQVLDILE 907

Query: 1039 DFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVII 1098
              L  L+ K+LRLDG T+ +DR +L++ F   ++    F+LST+AGG G+NL  A+ VII
Sbjct: 908  LVLSELNYKFLRLDGSTQVNDRQSLIDKFYEDDT-IPIFILSTKAGGFGINLVCANNVII 966

Query: 1099 FDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKV 1153
            FD  +NPH D QA DRAHR+GQ  EV I  LIT +S+EE I   A  KL +D  +
Sbjct: 967  FDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQLAKNKLALDSHI 1021

>Kwal_34.16082
          Length = 726

 Score =  267 bits (682), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 159/474 (33%), Positives = 239/474 (50%), Gaps = 62/474 (13%)

Query: 687  YQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLT 746
            YQ   +QW+  LF     GI+ DEMGLGKTIQ I+ L  L+ +  + GP L++ P + L 
Sbjct: 266  YQKTCVQWLYELFQQQCGGIIGDEMGLGKTIQIIAFLASLHHSGKLDGPVLIVCPATVLR 325

Query: 747  NWNAEFDKWAPKLRKIAFK--GPPMERK-------------------------------- 772
             W  EF  W P  R +     G  M +K                                
Sbjct: 326  QWCKEFHTWWPPFRTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSKRTK 385

Query: 773  -------PKQALIKN--REFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKL 823
                    +  LI     E  +++TT+  +      L  ++W + ++DEGH+++N  + +
Sbjct: 386  STLESGMARSKLINKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPDADI 445

Query: 824  SLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQ 883
            SLT      +  R+IL+GTP+QNNL ELW+L +F+ P    ++  F + F+ P    G  
Sbjct: 446  SLTCKKL-KTKNRIILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGGYA 504

Query: 884  DKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQM 943
            +   +  +        L  ++ P+LLRR+K DV KDLP K E VL CK++  Q + Y Q 
Sbjct: 505  NATNIQVQTGYKCAIALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYLQF 564

Query: 944  LKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRS 1003
            L    L    +   Q       F   I  LRKICNHP + E+  D+        D   + 
Sbjct: 565  LNSEDLTKIKNGKRQVL-----FGIDI--LRKICNHPDLLEK--DKRENESSYGDP--KR 613

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLD-----MKYLRLDGHTKSD 1058
            +GK ++++++L  + + GH+ L+F Q  Q++DI+E F+ Y D     + YLR+DG T   
Sbjct: 614  SGKMQVVKQLLRLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRMDGTTNIG 673

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQ 1112
             R AL+++FN  N  Y  FLL+TR GGLG+NL  A+ +IIFD DWNP  D+QA+
Sbjct: 674  SRQALVDSFN--NGLYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQAR 725

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  260 bits (664), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 166/483 (34%), Positives = 261/483 (54%), Gaps = 49/483 (10%)

Query: 606  TNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDLERERIDYYEVA 665
            TN F +    +  +++    D   SH D + L++D+  D N  + D   + E+ D +  A
Sbjct: 549  TNDFENESNSSDTNEEFIMGDSDTSHSDDENLTDDS-EDSNDGEHDTTSDNEKSDLFP-A 606

Query: 666  HSIKEEVKQQ----PSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTIS 721
             +  + +  Q    PS+L  GTL+ YQ +GL W+ SL+NN+ NGILADEMGLGKTIQTIS
Sbjct: 607  DTTNDPLAVQDVPTPSLL-RGTLRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTIS 665

Query: 722  LLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK-QALIKN 780
            LL+YL   K   GP L++VP S L NW  EF ++AP  + + + G P +RK K +   K 
Sbjct: 666  LLSYLACEKHNWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGNPQQRKEKRKGWNKP 725

Query: 781  REFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQS-KLSLTLNTYYHSDYRLIL 839
              F V + +++ I++++    + KW + ++DE H +KN +S +    LN  +++  R++L
Sbjct: 726  DAFHVCIVSYQLIVQDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLN--FNTQRRILL 783

Query: 840  TGTPLQNNLPELWALLNFVLPKI---------FNSVKSFDEWFNTP---FANTGGQDKIA 887
            TGTPLQNN+ ELW+LL F++P+          F  + +F +WF  P      TGG  +  
Sbjct: 784  TGTPLQNNIAELWSLLYFLMPQTVIDGQKVSGFADLDAFQQWFGRPVDKLIETGGTYE-- 841

Query: 888  LSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHR 947
              + ET   + +LH+VLRP+LLRRLK DVEK +P K E ++ CK+S  Q  LY   +   
Sbjct: 842  -QDNETKRTVEKLHQVLRPYLLRRLKADVEKQIPGKYEHIVYCKLSKRQRFLYDDFMSRA 900

Query: 948  RLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKF 1007
            +      S N  F S     N +MQLRK+CNHP +FE     + P + +          F
Sbjct: 901  QTKATLASGN--FMS---IVNCLMQLRKVCNHPDLFE-----VRPIKTS----------F 940

Query: 1008 ELLERILPKFKATGH---RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALL 1064
               E ++ ++    +   R + F     ++D+    L++ +    +   HT + ++ A +
Sbjct: 941  LFGESVIARYSERANSITRRIHFHDKDTLVDLQNINLQFTNNDLEKTSYHTNTINKLACI 1000

Query: 1065 NTF 1067
            N F
Sbjct: 1001 NEF 1003

 Score =  161 bits (407), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 112/177 (63%), Gaps = 1/177 (0%)

Query: 983  FEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLR 1042
            F +V+ ++  A      +    GK + L  +L + K  GHR LIF QMT+V+DI+E FL 
Sbjct: 1156 FHQVQTKLTIAFPDKSLLQYDCGKLQKLAILLQQLKDGGHRALIFTQMTKVLDILEQFLN 1215

Query: 1043 YLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTD 1102
            Y    Y+RLDG TK +DR  L   FN+ +     F+LS+R+GGLG+NL  ADTVI +D+D
Sbjct: 1216 YHGYLYMRLDGATKIEDRQILTERFNS-DPKITVFILSSRSGGLGINLTGADTVIFYDSD 1274

Query: 1103 WNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKF 1159
            WNP  D Q QDR HRIGQ  +V I R ++++++E  IL KA+ K  +D  +IQ G+F
Sbjct: 1275 WNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDDVIIQKGEF 1331

>Scas_669.20
          Length = 1397

 Score =  256 bits (654), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 206/327 (62%), Gaps = 24/327 (7%)

Query: 674 QQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVH 733
           +QP +L   TLKEYQLKGL W+ SL++  +NGILADEMGLGKT+Q+IS+L +L E   + 
Sbjct: 636 EQPKML-ACTLKEYQLKGLNWLASLYDQGINGILADEMGLGKTVQSISVLAHLAEKHNIW 694

Query: 734 GPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQAL--------IKNREFDV 785
           GP+LV+ P STL NW  E  K+ P+ + + + G   +RK  +           K+  F V
Sbjct: 695 GPYLVVTPASTLHNWVNEITKFVPQFKILPYWGNAADRKVLRKFWDRKNLRYTKDSPFHV 754

Query: 786 VLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQ 845
           ++T+++ ++ +   L K+KW + I+DE   +K++QS     L + +H   RL+LTGTP+Q
Sbjct: 755 MITSYQMVVSDVTYLQKMKWQYMILDEAQAIKSSQSSRWKNLLS-FHCRNRLLLTGTPIQ 813

Query: 846 NNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLL---VIRRLHK 902
           NN+ ELWALL+F++P +F+S   F EWF         +D  + +E  T L    +RRLH 
Sbjct: 814 NNMQELWALLHFIMPSLFDSHDEFSEWF--------AKDIESHAEANTQLNHQQLRRLHM 865

Query: 903 VLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLF--IFDDSSNQKF 960
           +L+PF+LRR+KK+V+ +L DK+E  + C ++  Q KLY Q+LK    +  I + + + +F
Sbjct: 866 ILKPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLY-QVLKSTSNYDAIENAAGSDEF 924

Query: 961 SSSRGFNNQIMQLRKICNHPFVFEEVE 987
           SS +   N +MQ RK+CNHP +FE  +
Sbjct: 925 SSDQNLVNTVMQFRKVCNHPDLFERAD 951

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 106/155 (68%), Gaps = 2/155 (1%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
            + K + L+ +L + K  GHRVLI+FQMT++MD+ME++L Y    ++RLDG +K +DR  L
Sbjct: 1219 SAKLKKLDELLVQLKREGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDL 1278

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
            ++ +     + F FLLSTRAGGLG+NL  ADTVI +D+DWNP  D QA DRAHR+GQ  +
Sbjct: 1279 VHDWQTK-PEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQ 1337

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGK 1158
            V + RL+   ++EE + D+A  K  +  +V+  GK
Sbjct: 1338 VTVYRLLIRGTIEERMRDRAKQKEQVQ-QVVMEGK 1371

>Kwal_55.20143
          Length = 1494

 Score =  256 bits (654), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 197/322 (61%), Gaps = 23/322 (7%)

Query: 676 PSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGP 735
           PS+L  GTL+ YQ +GL W+ SL+NN+ NGILADEMGLGKTIQTISLL YL   K   GP
Sbjct: 664 PSLL-RGTLRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKHNWGP 722

Query: 736 FLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK-QALIKNREFDVVLTTFEYII 794
            L+IVP S L NW  EF ++AP  + + + G P +RK K +   +   F V +T+++ ++
Sbjct: 723 HLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNRPDAFHVCITSYQLVV 782

Query: 795 KERPLLSKIKWVHTIIDEGHRMKNAQS-KLSLTLNTYYHSDYRLILTGTPLQNNLPELWA 853
            ++    + KW + I+DE H +KN +S +    LN  ++++ RL+LTGTPLQNNL ELW+
Sbjct: 783 HDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLN--FNTERRLLLTGTPLQNNLAELWS 840

Query: 854 LLNFVLPKI---------FNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVL 904
           LL F++P+          F  +++F +WF  P        +    +EET   + +LH+VL
Sbjct: 841 LLYFLMPQTAGTNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEETRKTVTKLHQVL 900

Query: 905 RPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSR 964
           RP+LLRRLK DVEK +P K E V+ C++S  Q  LY         F+    + +  SS  
Sbjct: 901 RPYLLRRLKADVEKQMPAKHEHVVYCRLSKRQRFLYDD-------FMSRAQTKETLSSGN 953

Query: 965 GFN--NQIMQLRKICNHPFVFE 984
             +  N +MQLRK+CNHP +FE
Sbjct: 954 FMSIINCLMQLRKVCNHPDLFE 975

 Score =  159 bits (402), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 101/156 (64%), Gaps = 1/156 (0%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
             GK + L  +L   K  GHR LIF QMT+V+D++E FL Y    Y+RLDG TK ++R  L
Sbjct: 1216 CGKLQKLATLLRDLKNGGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQIL 1275

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
               FN  N     F+LS+R+GGLG+NL  ADTVI +D+DWNP  D Q QDR HRIGQ  +
Sbjct: 1276 TERFNTDNR-ITAFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKF 1159
            V I R ++++++E  IL KA+ K  +D  VIQ G F
Sbjct: 1335 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQRGDF 1370

>Kwal_27.11388
          Length = 1334

 Score =  254 bits (649), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 140/356 (39%), Positives = 217/356 (60%), Gaps = 27/356 (7%)

Query: 649 DSDDDLERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILA 708
           D DD+L       ++   S+ E    QP +L   TLKEYQLKGL W+ +L++  +NGILA
Sbjct: 566 DEDDELN------FQNPTSLGEITIDQPKLLTC-TLKEYQLKGLNWLANLYDQGINGILA 618

Query: 709 DEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPP 768
           DEMGLGKT+Q+IS+L +L E   + GPF+V+ P STL NW  E  K+ P  + + + G  
Sbjct: 619 DEMGLGKTVQSISVLAHLAENYNIWGPFIVVTPASTLHNWVNEISKFLPDFKILPYWGNG 678

Query: 769 MERKPKQALI--------KNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQ 820
            +RK  +           K+  F V++T+++ ++ +   L K+KW + I+DE   +K++Q
Sbjct: 679 NDRKILRRFWDRKQFRYGKDAPFHVMVTSYQMVVSDAAYLQKMKWQYMILDEAQAIKSSQ 738

Query: 821 SKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANT 880
           S     L + +H   RL+LTGTP+QNN+ ELWALL+F++P +F+S   F +WF+     +
Sbjct: 739 SSRWKNLLS-FHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDI-ES 796

Query: 881 GGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLY 940
             Q    L++++    +RRLH +L+PF+LRR+KK+V+ +L +K+E  + C ++  QHKLY
Sbjct: 797 HAQSNTKLNQQQ----LRRLHMILKPFMLRRIKKNVQSELGEKIEIDVMCDLTRRQHKLY 852

Query: 941 QQMLKHRRLFIFDDSSN----QKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINP 992
            Q+LK +    +D   N     + SS +   N +MQ RK+CNHP +FE  ED  +P
Sbjct: 853 -QVLKSQMSAAYDAIENAAGSDEASSDQNIVNTVMQFRKVCNHPDLFER-EDVRSP 906

 Score =  147 bits (371), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 106/159 (66%), Gaps = 2/159 (1%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
            + K + L+ +L   K   HRVLI+FQMT++MD+ME++L +   K++RLDG +K +DR  L
Sbjct: 1169 STKLKKLDELLVNLKKNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRDL 1228

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
            ++ +     + F FLLSTRAGGLG+NL  ADTVI +D+DWNP  D QA DRAHR+GQ  +
Sbjct: 1229 VHDWQT-KPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQ 1287

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDNK 1162
            V + RL+   ++EE + D+A  K  +  +V+  GK   K
Sbjct: 1288 VTVYRLLIRGTIEERMRDRAKQKEQVQ-QVVMEGKTQEK 1325

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  254 bits (648), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 135/322 (41%), Positives = 195/322 (60%), Gaps = 23/322 (7%)

Query: 676  PSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGP 735
            PS+L  GTL+ YQ +GL W+ SL+NN  NGILADEMGLGKTIQTISLL YL   K   GP
Sbjct: 758  PSLL-RGTLRIYQKQGLNWLASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKENWGP 816

Query: 736  FLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK-QALIKNREFDVVLTTFEYII 794
             L++VP S L NW  EF ++AP  + + + G P +R+ K +   K   F V +T+++ ++
Sbjct: 817  HLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRREKRKGWNKPDAFHVCITSYQLVV 876

Query: 795  KERPLLSKIKWVHTIIDEGHRMKNAQS-KLSLTLNTYYHSDYRLILTGTPLQNNLPELWA 853
             ++    + KW + I+DE H +KN +S +    LN  ++++ RL+LTGTPLQNNL ELW+
Sbjct: 877  HDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLN--FNTERRLLLTGTPLQNNLAELWS 934

Query: 854  LLNFVLPKI---------FNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVL 904
            LL F++P+          F  + +F +WF  P        +    +EET   + +LH+VL
Sbjct: 935  LLYFLMPQTALENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKKTVSKLHQVL 994

Query: 905  RPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSR 964
            RP+LLRRLK DVEK +P K E ++ C++S  Q  LY         F+    + +  +S  
Sbjct: 995  RPYLLRRLKADVEKQMPGKYEHIIYCRLSKRQRFLYDD-------FMSRAQTKETLASGN 1047

Query: 965  GFN--NQIMQLRKICNHPFVFE 984
              +  N +MQLRK+CNHP +FE
Sbjct: 1048 FMSIINCLMQLRKVCNHPDLFE 1069

 Score =  165 bits (417), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 127/206 (61%), Gaps = 5/206 (2%)

Query: 954  DSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERI 1013
            D +N++F  S   ++ + Q+R + N    F +++ +++ A      +    GK + L ++
Sbjct: 1263 DDNNKRFEESVK-HHLVSQMRSLEN---PFHQLQTKLSVAFPDKSLLQYDCGKLQKLAQL 1318

Query: 1014 LPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSD 1073
            L   K  GHR LIF QMT+V+DI+E FL +    Y+RLDG TK +DR  L   FN+ +  
Sbjct: 1319 LQNLKDNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQILTERFNS-DPR 1377

Query: 1074 YFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDN 1133
               F+LS+R+GGLG+NL  ADTVI +D+DWNP  D Q QDR HRIGQ  +V I R ++D+
Sbjct: 1378 ITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSDH 1437

Query: 1134 SVEEAILDKAHAKLDIDGKVIQAGKF 1159
            ++E  IL KA+ K  +D  VIQ G F
Sbjct: 1438 TIESNILKKANQKRHLDNVVIQTGDF 1463

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  253 bits (647), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 196/326 (60%), Gaps = 31/326 (9%)

Query: 676  PSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGP 735
            PS+L  G L+ YQ +GL W+ SL+NNH NGILADEMGLGKTIQTISLL YL   K   GP
Sbjct: 689  PSLL-RGNLRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWGP 747

Query: 736  FLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK-QALIKNREFDVVLTTFEYII 794
             L++VP S L NW  EF ++AP  + + + G P +RK K +   K   F V + +++ ++
Sbjct: 748  HLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNKPDAFHVCIVSYQLVV 807

Query: 795  KERPLLSKIKWVHTIIDEGHRMKNAQS-KLSLTLNTYYHSDYRLILTGTPLQNNLPELWA 853
            +++    + +W + ++DE H +KN +S +    LN  +++  RL+LTGTPLQNNL ELW+
Sbjct: 808  QDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLN--FNTQRRLLLTGTPLQNNLAELWS 865

Query: 854  LLNFVLPKI---------FNSVKSFDEWFNTP---FANTG---GQDKIALSEEETLLVIR 898
            LL F++P+          F  + +F +WF  P      TG   GQDK      ET   + 
Sbjct: 866  LLYFLMPQTVIDGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDK------ETKKTVA 919

Query: 899  RLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQ 958
            +LH+VLRP+LLRRLK DVEK +P K E ++ CK+S  Q  LY   +   +      S N 
Sbjct: 920  KLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGN- 978

Query: 959  KFSSSRGFNNQIMQLRKICNHPFVFE 984
             F S     N +MQLRK+CNHP +FE
Sbjct: 979  -FMS---IVNCLMQLRKVCNHPNLFE 1000

 Score =  160 bits (405), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 103/156 (66%), Gaps = 1/156 (0%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
             GK + L  +L + K  GHR LIF QMT+V+D++E FL Y    Y+RLDG TK +DR  L
Sbjct: 1245 CGKLQKLAILLQQLKDNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQIL 1304

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
               FN  +S    F+LS+R+GGLG+NL  ADTVI +D+DWNP  D Q QDR HRIGQ  +
Sbjct: 1305 TERFNT-DSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1363

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKF 1159
            V I R ++++++E  IL KA+ K  +D  VIQ G F
Sbjct: 1364 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQEGDF 1399

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  253 bits (645), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 196/322 (60%), Gaps = 29/322 (9%)

Query: 679 LVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLV 738
           L+ GTL+ YQ +GL W+ SL+NN+ NGILADEMGLGKTIQTI+LL YL   K   GP L+
Sbjct: 666 LLRGTLRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTIALLAYLACEKENWGPHLI 725

Query: 739 IVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK-QALIKNREFDVVLTTFEYIIKER 797
           IVP S L NW  EF ++AP  + +++ G P +RK K +   K   F V +T+++ ++ ++
Sbjct: 726 IVPTSVLLNWEMEFKRFAPGFKVLSYYGSPQQRKEKRRGWNKLDAFHVCITSYQLVVHDQ 785

Query: 798 PLLSKIKWVHTIIDEGHRMKNAQS-KLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLN 856
               + KW + I+DE H +KN +S +    LN  +++  RL+LTGTPLQNN+ ELW+LL 
Sbjct: 786 HSFKRKKWQYMILDEAHNIKNFKSTRWQALLN--FNTRRRLLLTGTPLQNNIAELWSLLY 843

Query: 857 FVLPKI---------FNSVKSFDEWFNTPFANTGGQDKIALS-----EEETLLVIRRLHK 902
           F++P+          F  + +F +WF  P       DKI  +     ++ET   + +LH+
Sbjct: 844 FLMPQTALENGKISGFADLDAFQQWFGKPV------DKIIAANDSEHDDETRRTVSKLHQ 897

Query: 903 VLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSS 962
           VLRP+LLRRLK DVEK +P K E +L C++S  Q  LY   +   +      S N  F S
Sbjct: 898 VLRPYLLRRLKADVEKQMPAKYEHILYCRLSKRQRFLYDDFMSRAQTKATLASGN--FMS 955

Query: 963 SRGFNNQIMQLRKICNHPFVFE 984
                N +MQLRK+CNHP +FE
Sbjct: 956 ---IINCLMQLRKVCNHPDLFE 974

 Score =  159 bits (401), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 102/156 (65%), Gaps = 1/156 (0%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
             GK + L  +L + K  GHR LIF QMT+V+DI+E FL Y    Y+RLDG TK +DR  L
Sbjct: 1216 CGKLQSLAVLLRRLKEEGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1275

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
               FN  +     F+LS+R+GGLG+NL  ADTVI +D+DWNP  D Q QDR HRIGQ  +
Sbjct: 1276 TERFNT-DPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKF 1159
            V I R  +++++E  IL KA+ K  +D  VIQ G+F
Sbjct: 1335 VHIYRFASEHTIESNILKKANQKRQLDNIVIQKGEF 1370

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  253 bits (645), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/358 (37%), Positives = 216/358 (60%), Gaps = 29/358 (8%)

Query: 647  GADSDDDLERERIDYYEVAHSIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGI 706
              +SDD+ E      ++   S+ E   +QP +L   TLKEYQLKGL W+ +L++  +NGI
Sbjct: 690  STESDDEEEMN----FQNPTSLGEITIEQPKML-ACTLKEYQLKGLNWLANLYDQGINGI 744

Query: 707  LADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKG 766
            LADEMGLGKT+Q+IS+L +L E   + GPFLV+ P STL NW  E  K+ P+ + + + G
Sbjct: 745  LADEMGLGKTVQSISVLAHLAEHHNIWGPFLVVTPASTLHNWVNEISKFVPQFKILPYWG 804

Query: 767  PPMERKPKQALIKNRE--------FDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKN 818
               +RK  +     +         F V++T+++ ++ +   L K+KW + I+DE   +K+
Sbjct: 805  SANDRKVLRKFWDRKNLRYSEKSPFHVMITSYQMVVADASYLQKMKWQYMILDEAQAIKS 864

Query: 819  AQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFA 878
            +QS     L + +H   RL+LTGTP+QNN+ ELWALL+F++P +F+S   F+EWF+    
Sbjct: 865  SQSSRWKNLLS-FHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSHDEFNEWFSRDIE 923

Query: 879  NTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHK 938
             +  +   +L++++    +RRLH +L+PF+LRR+KK+V+ +L DK+E  + C ++  Q K
Sbjct: 924  -SHAEGNSSLNQQQ----LRRLHMILKPFMLRRIKKNVQSELGDKIEIDVMCDLTQRQTK 978

Query: 939  LYQQMLKHRRLFIFDDSSNQKF---------SSSRGFNNQIMQLRKICNHPFVFEEVE 987
            LY Q+LK +    +D   N            +S +   N +MQ RK+CNHP +FE  +
Sbjct: 979  LY-QVLKSQMSSNYDAIENAAAEGSDIAGGGNSDQSIINAVMQFRKVCNHPDLFERAD 1035

 Score =  151 bits (382), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 106/155 (68%), Gaps = 2/155 (1%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
            + K + L+ +L + K   HRVLI+FQMT++MD+ME++L Y    ++RLDG +K +DR  L
Sbjct: 1294 SAKLKKLDELLVELKKNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDL 1353

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
            ++ +   N + F FLLSTRAGGLG+NL  ADTVI +D+DWNP  D QA DRAHR+GQ  +
Sbjct: 1354 VHDWQT-NPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQ 1412

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGK 1158
            V + RL+   ++EE + D+A  K  +  +V+  GK
Sbjct: 1413 VTVYRLLVRGTIEERMRDRAKQKEQVQ-QVVMEGK 1446

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  251 bits (641), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 211/340 (62%), Gaps = 27/340 (7%)

Query: 667  SIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYL 726
            S+ E   +QP IL   TLKEYQLKGL W+ +L++  +NGILADEMGLGKT+Q+IS+L +L
Sbjct: 690  SLGEITIEQPKIL-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL 748

Query: 727  YEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALI-------- 778
             E   + GPFLV+ P STL NW  E  K+ P+ + + + G   +RK  +           
Sbjct: 749  AENHNIWGPFLVVTPASTLHNWVNEISKFLPQFKILPYWGNANDRKVLRKFWDRKNLRYN 808

Query: 779  KNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLI 838
            KN  F V++T+++ ++ +   L K+KW + I+DE   +K++QS     L   +H   RL+
Sbjct: 809  KNAPFHVMVTSYQMVVTDANYLQKMKWQYMILDEAQAIKSSQSSRWKNL-LSFHCRNRLL 867

Query: 839  LTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIR 898
            LTGTP+QN++ ELWALL+F++P +F+S   F+EWF+     +  +    L++++    +R
Sbjct: 868  LTGTPIQNSMQELWALLHFIMPSLFDSHDEFNEWFSKDIE-SHAEANTKLNQQQ----LR 922

Query: 899  RLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFD----- 953
            RLH +L+PF+LRR+KK+V+ +L DK+E  + C ++  Q KLY Q+LK +    +D     
Sbjct: 923  RLHMILKPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLY-QVLKSQISTNYDAIENA 981

Query: 954  ---DSSNQKFSSS---RGFNNQIMQLRKICNHPFVFEEVE 987
               DS++   S+S   +   N +MQ RK+CNHP +FE  +
Sbjct: 982  ATNDSTSNSASNSGSDQNLINAVMQFRKVCNHPDLFERAD 1021

 Score =  156 bits (394), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 109/160 (68%), Gaps = 2/160 (1%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
            + K   L+ +L K K+ GHRVLI+FQMT++MD+ME++L Y    ++RLDG +K +DR  L
Sbjct: 1298 SAKLRKLDELLVKLKSEGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDL 1357

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
            ++ +   N + F FLLSTRAGGLG+NL  ADTVI +D+DWNP  D QA DRAHR+GQ  +
Sbjct: 1358 VHDWQT-NPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQ 1416

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDNKS 1163
            V + RL+   ++EE + D+A  K  +  +V+  GK   K+
Sbjct: 1417 VTVYRLLVRGTIEERMRDRAKQKEQVQ-QVVMEGKTQEKN 1455

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  251 bits (641), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 135/341 (39%), Positives = 209/341 (61%), Gaps = 29/341 (8%)

Query: 667 SIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYL 726
           S+ E   +QP IL   TLKEYQLKGL W+ +L++  +NGILADEMGLGKT+Q+IS+L +L
Sbjct: 639 SLGEITIEQPKIL-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL 697

Query: 727 YEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALI-------- 778
            E   + GPF+V+ P STL NW  E  K+ P  + + + G   +RK  +           
Sbjct: 698 AERYNIWGPFIVVTPASTLHNWVNEIQKFVPDFKILPYWGNGNDRKILRRFWDRKHLRYS 757

Query: 779 KNREFDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLI 838
           K+  F V++T+++ I+ +   L K+KW + I+DE   +K++QS     L + +H   RL+
Sbjct: 758 KDAPFHVMITSYQMIVSDAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLS-FHCRNRLL 816

Query: 839 LTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIR 898
           LTGTP+QN++ ELWALL+F++P +F+S   F++WF+     +  Q    L++++    +R
Sbjct: 817 LTGTPIQNSMQELWALLHFIMPSLFDSHDEFNDWFSKDI-ESHAQSNTQLNQQQ----LR 871

Query: 899 RLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIF------ 952
           RLH +L+PF+LRR+KK+V+ +L DK+E  + C ++  Q KLY Q+LK +    +      
Sbjct: 872 RLHMILKPFMLRRIKKNVQSELGDKIEIDVMCDLTHRQAKLY-QVLKSQVSASYDAIENA 930

Query: 953 ------DDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVE 987
                 DDS N   S S+   N +M+ RK+CNHP +FE  +
Sbjct: 931 ASNSSGDDSGNMSLSDSK-IMNTVMEFRKVCNHPDLFERAD 970

 Score =  155 bits (392), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 109/155 (70%), Gaps = 2/155 (1%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
            + K + L+ +L + KA  HRVLI+FQMT++MD++E++L Y   K++RLDG +K +DR  L
Sbjct: 1239 SAKLKKLDELLVRLKAGEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRRDL 1298

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
            ++ +    SD F FLLSTRAGGLG+NL +ADTVI +D+DWNP  D QA DRAHR+GQ  +
Sbjct: 1299 VHDWQT-KSDIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQ 1357

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGK 1158
            V + RL+   ++EE + D+A  K  +  +V+  GK
Sbjct: 1358 VTVYRLLIKGTIEERMRDRAKQKEHVQ-QVVMEGK 1391

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  250 bits (639), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 132/333 (39%), Positives = 210/333 (63%), Gaps = 20/333 (6%)

Query: 667  SIKEEVKQQPSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYL 726
            S+ E    QP +L   TLKEYQLKGL W+ +L++  +NGILADEMGLGKT+Q+IS+L +L
Sbjct: 730  SLGEITIDQPKML-ACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHL 788

Query: 727  YEAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKP------KQALIKN 780
             +   + GPF+V+ P STL NW  E  ++ P+ + + + G   +RK       ++ L   
Sbjct: 789  ADRYNIWGPFIVVTPASTLHNWVNEISRFVPQFKILPYWGNANDRKTLRKFWDRKHLRYG 848

Query: 781  RE--FDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLI 838
            R+  F V++T+++ ++ +   L K+KW + I+DE   +K++QS    TL + +H   RL+
Sbjct: 849  RDAPFHVMVTSYQMVVSDASYLQKMKWQYMILDEAQAIKSSQSSRWKTLLS-FHCRNRLL 907

Query: 839  LTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIR 898
            LTGTP+QNN+ ELWALL+F++P +F+S   F +WF+     +  +    L++E+    +R
Sbjct: 908  LTGTPIQNNMQELWALLHFIMPSLFDSHDEFSDWFSKDI-ESHAESNTELNQEQ----LR 962

Query: 899  RLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFD----D 954
            RLH VL+PF+LRR+KK+V+ +L DK+E  + C ++  Q KLY Q+LK +    +D     
Sbjct: 963  RLHMVLKPFMLRRIKKNVQSELGDKIEIDVLCDLTFRQAKLY-QVLKSQVSGGYDAIENA 1021

Query: 955  SSNQKFSSSRGFNNQIMQLRKICNHPFVFEEVE 987
            + N   +S +   N +M+ RK+CNHP +FE  +
Sbjct: 1022 AGNDDVTSDQKLVNLVMEFRKVCNHPDLFERAD 1054

 Score =  154 bits (390), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 106/159 (66%), Gaps = 1/159 (0%)

Query: 1004 AGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTAL 1063
            + K + L+ +L K K   HRVLI+FQMT++MD+ME++L Y    ++RLDG +K DDR  L
Sbjct: 1318 SAKLKKLDELLVKLKEEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRDL 1377

Query: 1064 LNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNE 1123
            ++ +     D F FLLSTRAGGLG+NL  ADTVI +D+DWNP  D QA DRAHR+GQ  +
Sbjct: 1378 VHDWQT-KPDIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQ 1436

Query: 1124 VRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKFDNK 1162
            V + RL+   ++EE + D+A  K  +   V++    +NK
Sbjct: 1437 VTVYRLLIRGTIEERMRDRAKQKEHVQQVVMEGKAKENK 1475

>Scas_646.3*
          Length = 1456

 Score =  249 bits (637), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 192/320 (60%), Gaps = 19/320 (5%)

Query: 676 PSILVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGP 735
           PS+L  GTL+ YQ +GL W+ SLFNN+ NGILADEMGLGKTIQTISLL YL   K   GP
Sbjct: 637 PSLL-RGTLRTYQKQGLNWLASLFNNNTNGILADEMGLGKTIQTISLLAYLACEKQNWGP 695

Query: 736 FLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPK-QALIKNREFDVVLTTFEYII 794
            L++VP S L NW  EF ++ P L+ + + G P +RK K +   K   F V + +++ ++
Sbjct: 696 HLIVVPTSVLLNWEMEFKRFCPGLKVLTYYGSPQQRKEKRKGWNKPDAFHVCIVSYQLVV 755

Query: 795 KERPLLSKIKWVHTIIDEGHRMKNAQS-KLSLTLNTYYHSDYRLILTGTPLQNNLPELWA 853
           +++    + KW + ++DE H +KN +S +    LN  +++  RL++TGTPLQNNL ELW+
Sbjct: 756 QDQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLN--FNTRRRLLVTGTPLQNNLAELWS 813

Query: 854 LLNFVLPKI---------FNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVL 904
           LL F++P+          F  + +F +WF  P             + ET   + +LH+VL
Sbjct: 814 LLYFLMPQTVIDGKKVSGFADLDAFQQWFGRPVDKLIETGAGYQQDAETKKTVSKLHQVL 873

Query: 905 RPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSR 964
           RP+LLRRLK DVEK +P K E ++ C++S  Q  LY   +   +      S N  F S  
Sbjct: 874 RPYLLRRLKADVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATLASGN--FMS-- 929

Query: 965 GFNNQIMQLRKICNHPFVFE 984
              N +MQLRK+CNHP +FE
Sbjct: 930 -IVNCLMQLRKVCNHPDLFE 948

 Score =  160 bits (404), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 110/177 (62%), Gaps = 1/177 (0%)

Query: 983  FEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLR 1042
            F +++ ++  A      +    GK + L ++L   K  GHR LIF QMT+V+D++E FL 
Sbjct: 1167 FHQLQTKLTIAFPDKSLLQYDCGKLQKLAKLLQDLKDNGHRALIFTQMTKVLDVLERFLN 1226

Query: 1043 YLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTD 1102
            Y    Y+RLDG TK +DR  L   FN  +     F+LS+R+GGLG+NL  ADTVI +D+D
Sbjct: 1227 YHGYIYMRLDGATKVEDRQILTERFNN-DPRVTVFILSSRSGGLGINLTGADTVIFYDSD 1285

Query: 1103 WNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKF 1159
            WNP  D Q QDR HRIGQ  +V I R ++++++E  IL KA+ K  +D  VIQ G F
Sbjct: 1286 WNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDNVVIQRGGF 1342

>Scas_718.40
          Length = 926

 Score =  226 bits (576), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 174/540 (32%), Positives = 261/540 (48%), Gaps = 76/540 (14%)

Query: 679  LVGGTLKEYQLKGLQWM----VSLFNNH-------------------LNG-ILADEMGLG 714
            L+G  L+ +Q +G+++M    + L  NH                   + G +LADEMGLG
Sbjct: 254  LLGKLLRPHQREGVKFMYDCVMGLATNHQETDEDNTGKSLILEKDSDIGGCLLADEMGLG 313

Query: 715  KTIQTISLLTYLYEAK-----------GV--HG---PFLVIVPLSTLTNWNAEFDKWAPK 758
            KT+ TI+L+  L +             GV  HG     LV+ P++ + NW  EF KW   
Sbjct: 314  KTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGNWKREFAKWL-N 372

Query: 759  LRKIAFKGPPMERKPKQALIKNREFDVVLTTFEY-IIKERPLLSKIKWVHT--------I 809
            L +I          P+      + F  V  TF+  +I    LLS  + +H         I
Sbjct: 373  LNRIGILTLSSRNTPEMDKTAVKNFLRVQRTFQVLVIGYEKLLSVSEELHGSRDLIDLLI 432

Query: 810  IDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSF 869
             DEGHR+KN  SK+ L +        +++L+GTP+QN+L E + +++F+ P I  S   F
Sbjct: 433  CDEGHRLKNGSSKV-LNVLKNLEIKRKILLSGTPIQNDLNEFYTIIDFLNPGILGSYPYF 491

Query: 870  DEWFNTPFA------NTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDK 923
             + F  P        N   +D I L E  +    + +  + R F LRR    + K LP K
Sbjct: 492  KKRFIAPITRGRDTENRHNEDIIELGEGRS----KEMIDITRKFTLRRTNAILSKYLPPK 547

Query: 924  VEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVF 983
             + +L CK +  Q   +  +L   R+    D +N  F+SS G    I   +KICN P + 
Sbjct: 548  TDIILFCKPTQSQLLAFNDILSRSRI----DFANLSFNSSLGL---ITLFKKICNSPTLI 600

Query: 984  EE---VEDQINPARETNDTIWRS--AGKFELLERILPKFKATGH--RVLIFFQMTQVMDI 1036
             +    + +I P     +   RS  +GK ++L  +L K K   +  +V+I    TQ +DI
Sbjct: 601  GDDSYYQSKIRPDGVIQERYDRSLNSGKLKILMTLLEKIKGNTNNEKVVIVSNYTQTLDI 660

Query: 1037 MEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTV 1096
            +++ +    M   RLDG T +  R +++NTFN  N   F FLLS ++GG+GLNL  A  +
Sbjct: 661  IQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNR-NPSIFAFLLSAKSGGVGLNLIGASRL 719

Query: 1097 IIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQA 1156
            I+FD DWNP  DLQA  R HR GQK    I RLIT   ++E IL +   K  +  K + +
Sbjct: 720  ILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQRQLMKHSLSKKFLDS 779

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
            mitotic diploid-specific recombination and repair and for
            meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  226 bits (576), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 187/615 (30%), Positives = 298/615 (48%), Gaps = 73/615 (11%)

Query: 598  RITHLLKQTNTFLDSLTKAVKDQQSFTKDKIESHLDTQELSEDNVGDKNGADSDDDLERE 657
            R   + KQTN   + +T   K  Q+    K     D  ++    V +KN A   D +   
Sbjct: 200  RFKSVTKQTN---EHMTTVPKTSQNSKAKKYYPVFDVNKIDNPIVMNKNAAAEVDVIVDP 256

Query: 658  RIDYYEVAHSIKEEVKQQPSILVG---GTLKEYQLKGLQWMVSLFNNH-LNG-ILADEMG 712
             +  +   H  +E VK     L+G    T++   +      + L N+  ++G +LAD+MG
Sbjct: 257  LLGKFLRPHQ-REGVKFMYDCLMGLARPTIENPDIDCTTKSLVLENDSDISGCLLADDMG 315

Query: 713  LGKTIQTISLLTYL-----YEAK-----------GVHGPFLVIVPLSTLTNWNAEFDKWA 756
            LGKT+ +I+L+  L     + +K           G+    LV+ P++ + NW  EF KW 
Sbjct: 316  LGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGNWKREFGKWL 375

Query: 757  PKLRKIAF------KGPPMERKPKQALIK-NREFDVVLTTFEYIIKERPLLSKIKWV--H 807
              L +I          P M++   +  +K  R + V++  +E ++     L K K +   
Sbjct: 376  -NLSRIGVLTLSSRNSPDMDKMAVRNFLKVQRTYQVLIIGYEKLLSVSEELEKNKHLIDM 434

Query: 808  TIIDEGHRMKNAQSKLSLTLNTYYHSDYR--LILTGTPLQNNLPELWALLNFVLPKIFNS 865
             + DEGHR+KN  SK+   LNT    D R  L+LTGTP+QN+L E + +++F+ P I  S
Sbjct: 435  LVCDEGHRLKNGASKI---LNTLKSLDIRRKLLLTGTPIQNDLNEFFTIIDFINPGILGS 491

Query: 866  VKSFDEWFNTPF------ANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKD 919
              SF   F  P       AN   ++ +   EE +    + + ++ + F+LRR    +EK 
Sbjct: 492  FASFKRRFIIPITRARDTANRYNEELLEKGEERS----KEMIEITKRFILRRTNAILEKY 547

Query: 920  LPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNH 979
            LP K + +L CK  + Q   ++ +L+  RL    D     FSSS G    I  L+K+CN 
Sbjct: 548  LPPKTDIILFCKPYSQQILAFKDILQGARL----DFGQLTFSSSLGL---ITLLKKVCNS 600

Query: 980  P-------FVFEEVEDQINPARETNDTIWRS--AGKFELLERILPKF-KATGHRVLIFFQ 1029
            P       +    ++D      ++ D+  RS  +GK ++L  +L    K T  +V++   
Sbjct: 601  PGLVGSDPYYKSHIKDT-----QSQDSYSRSLNSGKLKVLMTLLEGIRKGTKEKVVVVSN 655

Query: 1030 MTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLN 1089
             TQ +DI+E+ +    M + RLDG   +  R +++ +FN  N   F FLLS ++GG+GLN
Sbjct: 656  YTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNR-NPAIFGFLLSAKSGGVGLN 714

Query: 1090 LQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            L     +I+FD DWNP  DLQA  R HR GQK    I RL+T   ++E IL +   K  +
Sbjct: 715  LVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKILQRQLMKNSL 774

Query: 1150 DGKVIQAGKFDNKST 1164
              K +   +  NK +
Sbjct: 775  SQKFLGDSEMRNKES 789

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
            complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  223 bits (567), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 159/499 (31%), Positives = 254/499 (50%), Gaps = 54/499 (10%)

Query: 695  MVSLFNNHLNG-ILADEMGLGKTIQTISLLTYLYEA----------------KGVHGPFL 737
            M+  +++ + G +LADEMGLGKT  TI+L+  L +                 +G+    L
Sbjct: 283  MILEYDSDVKGCLLADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVL 342

Query: 738  VIVPLSTLTNWNAEFDKWAPKLR----KIAFKGPPMERK--PKQALIKNREFDVVLTTFE 791
            V+ P++ + NW  EF KW P  R     ++ K  P + K   +  L   R + V++  +E
Sbjct: 343  VVCPVTLIGNWKKEFIKWLPMNRIGILTLSSKNTPEKDKNDVRNFLRVQRTYQVLILGYE 402

Query: 792  YIIKERPLL--SKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLP 849
             ++     L  +K K    I DEGHR+KN+ SK+ L   T    + ++ILTGTP+QN+L 
Sbjct: 403  KLLNVFSELDQAKSKLDLLICDEGHRLKNSSSKI-LKCLTDLEIERKVILTGTPIQNDLN 461

Query: 850  ELWALLNFVLPKIFNSVKSFDEWFNTPF-----ANTGGQDKI-ALSEEETLLVIRRLHKV 903
            E + ++NF+ P I  +   F   + TP       N    D+I +L E  +    + L ++
Sbjct: 462  EFYTIINFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRS----QDLIEI 517

Query: 904  LRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSS 963
             + F+LRR    +   LP + + V+ CK +  Q   + Q+L   R+    D  N  F+SS
Sbjct: 518  TKKFILRRTSSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRV----DFQNMSFNSS 573

Query: 964  RGFNNQIMQLRKICNHPFV------FEEVEDQINPARETNDTIWRSAGKFELLERILPKF 1017
             G    I   +KICN P +      F+   +   PA     +   ++GK ++L  +L + 
Sbjct: 574  LGL---ITLFKKICNSPSLVSSDSYFQSKVNGGTPALRIAQST--TSGKLKVLMSLLHQI 628

Query: 1018 --KATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYF 1075
              ++   +V++    TQ +DI+ + +    + YLRLDG T + +R A++N FN   +  F
Sbjct: 629  AHRSDNEKVVVISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQT-IF 687

Query: 1076 CFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSV 1135
             FLLS ++GG+GLNL  A  +I+FD DWNP  DLQA  R HR GQK    I RL+T   +
Sbjct: 688  GFLLSAKSGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCI 747

Query: 1136 EEAILDKAHAKLDIDGKVI 1154
            +E I  +   K ++  K +
Sbjct: 748  DEKIFQRQLMKNNLSKKFL 766

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
            Saccharomyces cerevisiae YBR073w RDH54, hypothetical
            start
          Length = 920

 Score =  221 bits (562), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 159/495 (32%), Positives = 253/495 (51%), Gaps = 52/495 (10%)

Query: 706  ILADEMGLGKTIQTISLLTYLYEA----------------KGVHGPFLVIVPLSTLTNWN 749
            ILAD+MGLGKT+ TI+L+  L +                  G+    +++ P++ + NW 
Sbjct: 311  ILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWK 370

Query: 750  AEFDKWAPKLRKIAF------KGPPMERKPKQALIK-NREFDVVLTTFEYI--IKERPLL 800
             EF KW   L +I            M++   +  IK NR + V++  +E +  ++E  L 
Sbjct: 371  REFKKWL-GLNRIGILTLNPKNNVDMDKISVRNFIKVNRTYQVLILGYEKVLTVQEELLK 429

Query: 801  SKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLP 860
             K K    I DEGHR+KN  SK+   L +    D ++ILTGTP+QN+L E + +++FV P
Sbjct: 430  QKDKLDLLICDEGHRLKNGASKILKVLKSL-DIDKKVILTGTPIQNDLNEFFTIIDFVNP 488

Query: 861  KIFNSVKSFDEWFNTPFA------NTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKK 914
             +  +  SF + +  P +      N      I   EE++     +L +  + F+LRR   
Sbjct: 489  GVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKS----NQLIEFTKRFILRRSNN 544

Query: 915  DVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLR 974
             + K LP K + +L C+ +  Q K ++ ++++ R+    D +N  F++S G  N + ++ 
Sbjct: 545  ILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRV----DMNNITFNTSLGLINLMKKVC 600

Query: 975  K----ICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATG--HRVLIFF 1028
                 +CN P+    V+  I      ++    S+GK  +L  +L + KAT    +V+I  
Sbjct: 601  NSPSLLCNDPYYQSNVDSNIFTVSNKSN----SSGKLTVLLELLLEIKATSPMEKVVIVS 656

Query: 1029 QMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGL 1088
              TQ +DI++  +    +   RLDG T +  R  L+NTFN  N + F FLLS +AGG+GL
Sbjct: 657  NYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNN-NPNIFGFLLSAKAGGVGL 715

Query: 1089 NLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLD 1148
            NL  A  +++FD DWNP  DLQA  R HR GQK    I RLIT   ++E IL +   K +
Sbjct: 716  NLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDEKILQRQLMKHN 775

Query: 1149 IDGKVIQAGKFDNKS 1163
            +  K + +   D  S
Sbjct: 776  LTRKFLSSNTSDTGS 790

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
            Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
            ATPase of the SNF2P family, start by similarity
          Length = 895

 Score =  217 bits (552), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 154/486 (31%), Positives = 239/486 (49%), Gaps = 48/486 (9%)

Query: 706  ILADEMGLGKTIQTISLLTYLYEAKGVHG-----PFLVIVPLSTLTNWNAEFDKW-AP-K 758
            I+ADEMGLGKT+Q ++L+  + + +G  G       +++ P S + NW  E DKW  P  
Sbjct: 329  IMADEMGLGKTLQCLALMWTMLK-QGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGS 387

Query: 759  LRKIAFKGPP--------MERKPKQALIKNREF--DVVLTTFEYIIKERPLLSKIKWVHT 808
            L  +A  G           +     A  + R     V++ +++ + +    L   +    
Sbjct: 388  LSSLAIDGKKSSLNNGNVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLM 447

Query: 809  IIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKS 868
            + DEGHR+KNA S L+ T         R+IL+GTP+QN+L E +ALLNF  P +  S   
Sbjct: 448  LADEGHRLKNADS-LTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRND 506

Query: 869  FDEWFNTPFANTGGQDKIALSEEETLLV--IRRLHKVLRPFLLRRLKKDVEKDLPDKVEK 926
            F + F  P   +  +D +A  EE TL    +R+L  ++  F++RR    + K LP K E 
Sbjct: 507  FRKNFELPILQS--RDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEH 564

Query: 927  VLKCKMSALQHKLYQQMLKHRRLF-IFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEE 985
            V+   ++  Q  LYQ  ++ R +  I    SNQ   +       I  L+K+CNHP + E 
Sbjct: 565  VIFINLTPFQQSLYQHFIESRAVKKIVKGDSNQPLKA-------IGLLKKLCNHPDLLEL 617

Query: 986  VED--------------QINPARETNDTIWRSA--GKFELLERILPKFKA-TGHRVLIFF 1028
             ED               ++     N ++ ++A   KF +L R L K K  +  ++++  
Sbjct: 618  SEDIPGSEELIPDDYQSSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLIS 677

Query: 1029 QMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGL 1088
              TQ +D++E          LRLDG    + R  L++ FN P    F FLLS++AGG G+
Sbjct: 678  NYTQTLDLIEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGI 737

Query: 1089 NLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLD 1148
            NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I  +   K+ 
Sbjct: 738  NLIGANRLILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMS 797

Query: 1149 IDGKVI 1154
            +   V+
Sbjct: 798  LSSCVV 803

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
            complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score =  217 bits (552), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 152/488 (31%), Positives = 238/488 (48%), Gaps = 48/488 (9%)

Query: 706  ILADEMGLGKTIQTISLLTYLYEAKGVHGP----FLVIVPLSTLTNWNAEFDKW------ 755
            I+ADEMGLGKT+Q I+L+  L        P     +++ P S + NW  E  KW      
Sbjct: 327  IMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDAL 386

Query: 756  ---APKLRKIAFKGPPMERKPKQALI---KNREFDVVLTTFEYIIKERPLLSKIKWVHTI 809
               A   RK +     + +  +Q  I   +N    V++ ++E + +    L   K    +
Sbjct: 387  SPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLML 446

Query: 810  IDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSF 869
             DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 447  ADEGHRLKNGDS-LTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQF 505

Query: 870  DEWFNTPFANTGGQDKIALSEEETL--LVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKV 927
             + F  P     G+D  A  +E     + +  L +++  F++RR    + K LP K E +
Sbjct: 506  RKNFEIPILR--GRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHI 563

Query: 928  LKCKMSALQHKLYQQMLKHRRLF-IFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEE- 985
            L   +S +Q  +Y+  ++ R +  +   + +Q   +       I  L+K+CNHP + +  
Sbjct: 564  LFVNLSPMQKAIYEHFVRSREVAKLMKGTGSQPLKA-------IGLLKKLCNHPDLLDLP 616

Query: 986  ---------VEDQINPARETNDTIWRS--------AGKFELLERILPKFK-ATGHRVLIF 1027
                     + D    A   N    RS        + KF +LER L K K  +  ++++ 
Sbjct: 617  DEIAGSTNLIPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLI 676

Query: 1028 FQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLG 1087
               TQ +D++E   RY     LRLDG    + R  L++ FN P+ + F FLLS++AGG G
Sbjct: 677  SNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCG 736

Query: 1088 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKL 1147
            +NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R IT  S+EE I  +   K+
Sbjct: 737  INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKM 796

Query: 1148 DIDGKVIQ 1155
             +   V++
Sbjct: 797  SLSSCVVE 804

>Kwal_27.10513
          Length = 900

 Score =  216 bits (549), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 157/487 (32%), Positives = 243/487 (49%), Gaps = 44/487 (9%)

Query: 701  NHLNG-ILADEMGLGKTIQTISLLTYLYEA----------------KGVHGPFLVIVPLS 743
            N + G +LADEMGLGKT+ TI+L+  L +                 +G+    LV+ P++
Sbjct: 289  NEIQGCLLADEMGLGKTLMTITLVWTLLKQTPIPSKANSSQNGISLQGLCNKILVVCPVT 348

Query: 744  TLTNWNAEFDKW--APKLRKIAFKGPPMERKPKQALIKN-----REFDVVLTTFEYI--I 794
             + NW  EF KW    ++  +         K K   ++N     R + V++  +E +  +
Sbjct: 349  LIGNWKREFSKWLNVNRIGILTLSSKSNAEKDKLT-VRNFLRVQRTYQVLVIGYEKLLSV 407

Query: 795  KERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWAL 854
             E  L +K K    I DEGHR+KN QSK +L   +      +++LTGTP+QN+L E + +
Sbjct: 408  TEELLEAKSKIDLVICDEGHRLKNGQSK-TLKAISSLEVPRKIMLTGTPIQNDLAEFFTI 466

Query: 855  LNFVLPKIFNSVKSFDEWFNTPF--ANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRL 912
             +F+   I  +   F   F  P   A         L +E+     + L ++ + F LRR 
Sbjct: 467  ADFLNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNFTLRRT 526

Query: 913  KKDVEKDLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQ 972
             + + K LP K + VL CK ++ Q   +++ L   +L    D S   F+SS G    I  
Sbjct: 527  AETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQL----DFSRLTFNSSLGL---ITL 579

Query: 973  LRKICNHPFVFEEVE---DQINPARETNDTIWRSAGKFELLERILPKFK--ATGHRVLIF 1027
             +KICN P +  +     + I P  E   +   S GK  +L  +L   +  +   +V+I 
Sbjct: 580  FKKICNSPSLISQDSYYLETIKPNSEVKISAPDS-GKLRVLMALLDNLRKLSPQEKVVIV 638

Query: 1028 FQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLG 1087
               TQ +DI+++ +    + + RLDG T + DR  ++N+FN   S  F FLLS ++GG+G
Sbjct: 639  SNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPS-IFAFLLSAKSGGMG 697

Query: 1088 LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKL 1147
            LNL  A  +I+FD DWNP  DLQA  R HR GQK E  I RL+T   ++E I  +  AK 
Sbjct: 698  LNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGCIDEKIFQRQLAKT 757

Query: 1148 DIDGKVI 1154
             +  K +
Sbjct: 758  SLSSKFM 764

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
            Saccharomyces cerevisiae YBR073w RDH54 required for
            mitotic diploid-specific recombination and repair and
            meiosis, start by similarity
          Length = 931

 Score =  214 bits (546), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 156/526 (29%), Positives = 269/526 (51%), Gaps = 58/526 (11%)

Query: 679  LVGGTLKEYQLKGLQWMVSLFNN--HLNG---------------ILADEMGLGKTIQTIS 721
            L+  TL+ +Q +G++++     N  H  G               +LADEMGLGKT+ TI+
Sbjct: 273  LLSKTLRPHQREGVKFLYDCVMNMVHTKGDESMILERDDDIKGCLLADEMGLGKTLMTIT 332

Query: 722  LLTYLYEA---------KGVH-----GPFLVIVPLSTLTNWNAEFDKWAPKLR----KIA 763
            L+  L +          +GV         L++ P++ + NW  EF KW P  R     + 
Sbjct: 333  LIWTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWKKEFKKWLPMNRIGVLTLH 392

Query: 764  FKGPPMERKPK-QALIK-NREFDVVLTTFEYI--IKERPLLSKIKWVHTIIDEGHRMKNA 819
             +  P E K + ++ +K  R + V++  +E +  IK+     K      I DEGHR+KN 
Sbjct: 393  SRNSPTEDKAQVRSFLKVPRTYQVLIVGYEKLLSIKDELQNEKRNLDLVICDEGHRLKNK 452

Query: 820  QSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFAN 879
             SK+   L +    + +++L+GTP+QN+L E + +++F+ P I  S   F   +  P A 
Sbjct: 453  DSKILKVLQSL-DIEKKIVLSGTPIQNDLEEFYTIIDFINPGILGSFGRFKREYILPIAR 511

Query: 880  T----GGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSAL 935
            +      Q++  +  E+ LL   +L ++ + F+LRR  + +++ LP + + ++ CK +A 
Sbjct: 512  SRDVNAKQNQTLV--EQGLLRSDQLIEITKRFILRRTNEILQQYLPPRTDLIIFCKPTAE 569

Query: 936  QHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEE---VEDQINP 992
            Q + + ++L   +L    + SN  F+SS G    I   +KICN   + +     E++++ 
Sbjct: 570  QVEAFHKILTEGQL----NFSNMTFNSSLGL---ITLFKKICNSTRLIKTDPYYEERLSQ 622

Query: 993  ARETNDTIWRSAGKFELLERILPKFKA-TGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRL 1051
             + ++ +   ++GK  +L  +L + K  T  +V++    TQ +DI+E           RL
Sbjct: 623  VQTSSTSGKFTSGKLRILLSLLHELKTKTDEKVVVISNYTQTLDIIEGHCSSEGYTSARL 682

Query: 1052 DGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQA 1111
            DG T +  R  ++ +FN   S  F FLLS ++GG+GLNL  A  +++FD DWNP  DLQA
Sbjct: 683  DGSTATKTRDQIVTSFNNDPS-IFVFLLSAKSGGVGLNLIGASRLVLFDNDWNPSIDLQA 741

Query: 1112 QDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGKVIQAG 1157
              R HR GQ+    I RL+T   ++E IL +   K+ +  K + + 
Sbjct: 742  MSRIHRDGQRRPCFIYRLVTTGCIDEKILQRQLMKIALSKKFLDSA 787

>Kwal_14.1537
          Length = 842

 Score =  212 bits (540), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 156/491 (31%), Positives = 238/491 (48%), Gaps = 58/491 (11%)

Query: 706  ILADEMGLGKTIQTISLLTYLY----EAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRK 761
            I+ADEMGLGKT+Q I+LL  L     + K      +++ P S + NW  E  KW   L K
Sbjct: 360  IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---LGK 416

Query: 762  IAFKGPPMERKPKQ-------------ALIKNREF--DVVLTTFEYIIKERPLLSKIKWV 806
                  P++ K                AL + R     V++ ++E + +    L+  +  
Sbjct: 417  GTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIG 476

Query: 807  HTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSV 866
              + DEGHR+KNA+S+    L++  +   R+IL+GTP+QN+L E +ALLNF  P +  + 
Sbjct: 477  LLLADEGHRLKNAESQTFTALDSI-NCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 535

Query: 867  KSFDEWFNTPFANTGGQD----KIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPD 922
              F   F  P   +   D    +IA   E+    ++ L  ++  F++RR    + K LP 
Sbjct: 536  SEFRRNFENPILLSRDADATDSEIAKGNEK----LQALSTIVSKFIIRRTNDILSKYLPC 591

Query: 923  KVEKVLKCKMSALQHKLYQQMLKHR--RLFIFDDSS-NQKFSSSRGFNNQIMQLRKICNH 979
            K E VL   +   Q  +Y+ MLK R  +L + D ++ +Q           I  L+K+CNH
Sbjct: 592  KYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPL-------KHIGALKKLCNH 644

Query: 980  PFVFEEVED-----QINPARETNDTI----------WRSAGKFELLERILPKFKA-TGHR 1023
            P + +  ED      + P    N T+          W S GKF +L R L K K  +  +
Sbjct: 645  PDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYS-GKFSILNRFLHKIKTESDDK 703

Query: 1024 VLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRA 1083
            ++I    TQ +D++E   R      +RLDG    + R  L++ FN      F FLLS++A
Sbjct: 704  IVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKA 763

Query: 1084 GGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKA 1143
            GG G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I   ++EE I  + 
Sbjct: 764  GGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQ 823

Query: 1144 HAKLDIDGKVI 1154
              K+ +   V+
Sbjct: 824  SMKMSLSSCVV 834

>Scas_668.18
          Length = 875

 Score =  212 bits (539), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 152/488 (31%), Positives = 235/488 (48%), Gaps = 49/488 (10%)

Query: 706  ILADEMGLGKTIQTISLLTYLY----EAKGVHGPFLVIVPLSTLTNWNAEFDKW-AP-KL 759
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P  L
Sbjct: 309  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKWLGPGTL 368

Query: 760  RKIAFKGPPMERKP------------KQALIKNREFDVVLTTFEYIIKERPLLSKIKWVH 807
              +A  G                    QA  +N    V++ ++E + +    L       
Sbjct: 369  SPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQLRNCDVGL 428

Query: 808  TIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 867
             + DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 429  MLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 487

Query: 868  SFDEWFNTPFANTGGQD----KIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDK 923
             F + F  P   +   D    +I   EE+    +++L  ++  F++RR    + K LP K
Sbjct: 488  EFRKNFELPILRSRDADSTDEEITKGEEQ----LQKLSTIVSKFIIRRTNDILSKYLPCK 543

Query: 924  VEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFN--NQIMQLRKICNHPF 981
             E V+   +   Q  +Y ++LK R +       N+      G      I  L+K+CNHP 
Sbjct: 544  YEHVIFVNLKPFQKDVYHRLLKSRDV-------NKMVKGVGGTQPLKAIGVLKKLCNHPN 596

Query: 982  VFE-----------EVEDQIN-PARETNDTIWRSAGKFELLERILPKFKA-TGHRVLIFF 1028
            +             E+ D+ N    ++ D   + +GKF +LER L K K  +  ++++  
Sbjct: 597  LINLDEEIDDFDDLEIPDEYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLIS 656

Query: 1029 QMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGL 1088
              TQ +D++E   R      +RLDG    + R  L++ FN P    F FLLS++AGG G+
Sbjct: 657  NYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGI 716

Query: 1089 NLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLD 1148
            NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  S+EE I  +   K+ 
Sbjct: 717  NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMS 776

Query: 1149 IDGKVIQA 1156
            +   V+ A
Sbjct: 777  LSSCVVDA 784

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
            Saccharomyces cerevisiae YGL163c RAD54, start by
            similarity
          Length = 942

 Score =  212 bits (540), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 147/484 (30%), Positives = 233/484 (48%), Gaps = 41/484 (8%)

Query: 706  ILADEMGLGKTIQTISLLTYLY----EAKGVHGPFLVIVPLSTLTNWNAEFDKW-APK-L 759
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P  L
Sbjct: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435

Query: 760  RKIAFKGPPME------------RKPKQALIKNREFDVVLTTFEYIIKERPLLSKIKWVH 807
              +A  G                +   QA  +N    V++ +++ + +    L   +   
Sbjct: 436  SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495

Query: 808  TIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 867
             + DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 496  LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554

Query: 868  SFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKV 927
             F   F  P   +   D      +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 555  EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614

Query: 928  LKCKMSALQHKLYQQMLKHRRL--FIFDDSSNQKFSSSRGFNNQIMQLRKICNHP--FVF 983
            +   ++  Q ++Y  ++K R +   +  D  +Q   +       I  L+K+CNHP     
Sbjct: 615  IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKA-------IGVLKKLCNHPDLIKL 667

Query: 984  EEVEDQIN----------PARETNDTIWRSAGKFELLERILPKFKA-TGHRVLIFFQMTQ 1032
            +E  D  N          P  ++ D   + +GKF +LER L K K  +  ++++    TQ
Sbjct: 668  DEELDNYNDLDIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQ 727

Query: 1033 VMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQT 1092
             +D++E   R      +RLDG    + R  L++ FN P    F FLLS++AGG G+NL  
Sbjct: 728  TLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 787

Query: 1093 ADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGK 1152
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I  +   K+ +   
Sbjct: 788  ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSC 847

Query: 1153 VIQA 1156
            V+ A
Sbjct: 848  VVDA 851

>YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-dependent
            ATPase of the Snf2p family, required for mitotic
            recombination and DNA repair of X-ray damage [2697 bp,
            898 aa]
          Length = 898

 Score =  211 bits (538), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 150/486 (30%), Positives = 235/486 (48%), Gaps = 45/486 (9%)

Query: 706  ILADEMGLGKTIQTISLLTYLY----EAKGVHGPFLVIVPLSTLTNWNAEFDKW-APK-L 759
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P  L
Sbjct: 332  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTL 391

Query: 760  RKIAFKGPPMERKP------------KQALIKNREFDVVLTTFEYIIKERPLLSKIKWVH 807
              +A  G                    QA  +N    V++ ++E + +    L       
Sbjct: 392  TPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGL 451

Query: 808  TIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 867
             + DEGHR+KN  S L+ T         R+IL+GTP+QN+L E +ALL+F  P +  S  
Sbjct: 452  MLADEGHRLKNGDS-LTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRA 510

Query: 868  SFDEWFNTPFANTGGQDKIALSEEETL--LVIRRLHKVLRPFLLRRLKKDVEKDLPDKVE 925
             F + F  P     G+D  A  +E T     +++L  ++  F++RR    + K LP K E
Sbjct: 511  EFRKNFENPILR--GRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYE 568

Query: 926  KVLKCKMSALQHKLYQQMLKHRRLFIFDDSS--NQKFSSSRGFNNQIMQLRKICNHPFVF 983
             V+   +  LQ++LY +++K R +         +Q   +       I  L+K+CNHP + 
Sbjct: 569  HVIFVNLKPLQNELYNKLIKSREVKKVVKGVGGSQPLRA-------IGILKKLCNHPNLL 621

Query: 984  EEVEDQIN------------PARETNDTIWRSAGKFELLERILPKFKA-TGHRVLIFFQM 1030
               ++  +            P  +  D   + + KF +LER L K K  +  ++++    
Sbjct: 622  NFEDEFDDEDDLELPDDYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNY 681

Query: 1031 TQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNL 1090
            TQ +D++E   RY     +RLDG    + R  L++ FN P    F FLLS++AGG G+NL
Sbjct: 682  TQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 741

Query: 1091 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDID 1150
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I  +   K+ + 
Sbjct: 742  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLS 801

Query: 1151 GKVIQA 1156
              V+ A
Sbjct: 802  SCVVDA 807

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  164 bits (414), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 123/194 (63%), Gaps = 5/194 (2%)

Query: 970  IMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQ 1029
            ++QLR++ +  F+F      I P   + D + +++GK ++L++++PK    GH+VLIF Q
Sbjct: 1    MVQLRQVVDSTFLF--YFPYIQPEELSLDVLLQTSGKLQILQQLVPKLINEGHKVLIFSQ 58

Query: 1030 MTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFC---FLLSTRAGGL 1086
               ++D++ED+    D +  R+DG   ++ R   +  FN+  +D      FLLSTRAGGL
Sbjct: 59   FVNMLDLIEDWCELNDFQACRIDGSMDNEVRQEQIGKFNSKTTDSHANDVFLLSTRAGGL 118

Query: 1087 GLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAK 1146
            G+NL  AD+V+IFD+DWNP  DLQA DR HRIGQ   V + RL  DN+VE  IL +A +K
Sbjct: 119  GINLTAADSVVIFDSDWNPQVDLQAMDRTHRIGQDRPVIVYRLCCDNTVEHVILTRAVSK 178

Query: 1147 LDIDGKVIQAGKFD 1160
              ++  VIQ GKF+
Sbjct: 179  RKLEKLVIQMGKFN 192

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 104/209 (49%), Gaps = 36/209 (17%)

Query: 687 YQLKGLQWMVSLFNN--HLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLST 744
           +QL+GL WM    NN  +  G+LADEMG+GKT+Q ISLL +  +     GP LV+ P   
Sbjct: 145 FQLEGLHWMALQENNERYRGGVLADEMGMGKTVQMISLLLHANK-----GPTLVVAPTVA 199

Query: 745 LTNWNAEFDKW-APKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEY----------- 792
           L  W  E DK+    LR + F GP      ++        DVVLTT+             
Sbjct: 200 LIQWKNEIDKYTGGALRSLVFHGPGRSAVSEELAAA----DVVLTTYAVLESVYRKQTQG 255

Query: 793 ------IIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQN 846
                 +++E+  L  + +   ++DE H +K+  S  + ++N    +  R  LTGTPLQN
Sbjct: 256 FRRKAGVVREQSPLHAVDFYRVVLDEAHNIKDRSSGTARSVNA-LRAVRRWCLTGTPLQN 314

Query: 847 NLPELWALLNFVLPKIFNSVKSFDEWFNT 875
            + E+++L+ F+       ++ F  +F T
Sbjct: 315 RIGEMYSLIRFL------DIEPFTRYFCT 337

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 78/151 (51%), Gaps = 3/151 (1%)

Query: 1001 WRSAGKFELLERILPKFKATGHRV--LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSD 1058
            WRS+ K E L   L   +++   +  ++F Q T ++D++E  L+    +  +L G     
Sbjct: 571  WRSSTKIEALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPT 630

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
             R   +N F   N     FL+S +AGG+ LNL  A  V I D  WNP  + Q+ DR HRI
Sbjct: 631  QRAETINYF-MDNVHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 689

Query: 1119 GQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            GQ   V+I R   ++S+E  I++    K ++
Sbjct: 690  GQHRPVKITRFCIEDSIESRIIELQEKKANM 720

>Scas_591.10
          Length = 772

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 107/212 (50%), Gaps = 42/212 (19%)

Query: 687 YQLKGLQWMV----SLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPL 742
           +QL+GL W++     +F     G+LADEMG+GKTIQTI+LL      +    P LV+ P 
Sbjct: 169 FQLEGLHWLIQQEEGIFKG---GVLADEMGMGKTIQTIALLMNDLTKR----PSLVVAPT 221

Query: 743 STLTNWNAEFDKWA-PKLRKIAFKGPPMERKPKQALIKN-REFDVVLTTFEY-------- 792
             L  W  E ++    KL+   F G       K   IK   E+DVVLTT+          
Sbjct: 222 VALMQWKNEINQHTDGKLKVYMFHG-----TSKNIDIKTLSEYDVVLTTYAVLESVFRKQ 276

Query: 793 ---------IIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTP 843
                    ++KE  +L  I++   I+DE H +K+ QS  +  +N    +  R  LTGTP
Sbjct: 277 NYGFKRKHGVVKELSVLHNIEFYRVILDEAHNIKDRQSNTARAVNN-LKTQKRWCLTGTP 335

Query: 844 LQNNLPELWALLNFVLPKIFNSVKSFDEWFNT 875
           LQN + E+++L+ F+      +++ F ++F T
Sbjct: 336 LQNRIGEMYSLIRFL------NIEPFSKYFCT 361

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 3/151 (1%)

Query: 1001 WRSAGKFELLERILPKFKATGHRV--LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSD 1058
            W+S+ K E L   L K ++    +  ++F Q T ++D++E  L+    + ++L G     
Sbjct: 597  WQSSTKIEALVEELYKLRSPVRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPT 656

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
             R   +  F   N +   FL+S +AGG+ LNL  A  V I D  WNP  + Q+ DR HRI
Sbjct: 657  QRDETIKYF-MNNIECEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 715

Query: 1119 GQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            GQ   V+I R   ++S+E  I++    K ++
Sbjct: 716  GQFRPVKITRFCIEDSIESRIIELQEKKANM 746

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 110/221 (49%), Gaps = 37/221 (16%)

Query: 675 QPSILVGGTLKEYQLKGLQWMVSLFNNHLNG-ILADEMGLGKTIQTISLLTYLYEAKGVH 733
           QP+ + G  L  +QL+GL WM+S  ++  NG +LADEMG+GKTIQTI+LL      K   
Sbjct: 217 QPADM-GVKLLPFQLEGLHWMLSQEDSIYNGGVLADEMGMGKTIQTIALLMNDRSKK--- 272

Query: 734 GPFLVIVPLSTLTNWNAEFDKWA-PKLRKIAFKGPPMERKPKQALIKN-REFDVVLTTFE 791
            P LV+ P   L  W  E ++     L    + G       +   I + ++ DV+LTT+ 
Sbjct: 273 -PSLVVAPTVALMQWKNEIEQHTNGALSTYIYHGA-----SRTINIHDLKDIDVILTTYS 326

Query: 792 Y-----------------IIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSD 834
                             ++KE+ LL  I +   I+DE H +K+  S  S  +N    + 
Sbjct: 327 VLESVFRKQNYGFRRKNGLVKEKSLLHNIDFYRAILDEAHNIKDRTSNTSRAVNA-LKTQ 385

Query: 835 YRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNT 875
            R  L+GTPLQN + E+++L+ F+       +  F ++F T
Sbjct: 386 KRWCLSGTPLQNRIGEMYSLIRFL------DINPFAKYFCT 420

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 79/151 (52%), Gaps = 3/151 (1%)

Query: 1001 WRSAGKFELLERILPKFKATGHRV--LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSD 1058
            WRS+ K E L   L K ++    V  ++F Q T ++D++E  L+    + ++L G     
Sbjct: 655  WRSSTKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPT 714

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
             R   +  F   N +   FL+S +AGG+ LNL  A  V I D  WNP  + Q+ DR HRI
Sbjct: 715  QRDQTIKYF-MDNIECEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 773

Query: 1119 GQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            GQ   V+I R   ++S+E  I++    K ++
Sbjct: 774  GQYRPVKITRFCIEDSIEARIIELQEKKANM 804

>Kwal_23.3660
          Length = 768

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (51%), Gaps = 28/191 (14%)

Query: 687 YQLKGLQWMVSLFNNHLNG-ILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTL 745
           +QL+GL W++S  ++  NG +LADEMG+GKTIQTI+LL      K    P LV+ P   L
Sbjct: 165 FQLEGLHWLISQEHSVYNGGVLADEMGMGKTIQTIALLMNDVTKK----PSLVVAPTVAL 220

Query: 746 TNWNAEFDKW-APKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEY------------ 792
             W  E ++    KL+   F G        +     ++ DV+LTT+              
Sbjct: 221 MQWKNEIEQHTGGKLKTHIFHGANRTSNVGEF----KDVDVLLTTYAVLESVFRKQNYGF 276

Query: 793 -----IIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNN 847
                + KE  +L  + +   I+DE H +K+ QS  +  +N+   ++ +  LTGTPLQN 
Sbjct: 277 KRKSGVYKEPSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLL-TEKKWCLTGTPLQNR 335

Query: 848 LPELWALLNFV 858
           + E+++L+ F+
Sbjct: 336 IGEMYSLIRFL 346

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 78/151 (51%), Gaps = 3/151 (1%)

Query: 1001 WRSAGKFELLERILPKFKATGHRV--LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSD 1058
            WRS+ K E L   L   ++    +  ++F Q T ++D++E  L+    + ++L G     
Sbjct: 593  WRSSTKIEALVEELYNLRSDRRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPT 652

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
             R   +  F   N+    FL+S +AGG+ LNL  A  V I D  WNP  + Q+ DR HRI
Sbjct: 653  QRDQTIKYF-MDNTHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 711

Query: 1119 GQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            GQ   V+I R   ++S+E  I++    K ++
Sbjct: 712  GQYRPVKITRFCIEDSIESRIIELQEKKANM 742

>Scas_721.100
          Length = 1137

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 97/180 (53%), Gaps = 17/180 (9%)

Query: 967  NNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLERI-LPKFKATGHRVL 1025
            +N+++ + KI    F  +  E+ + PA+ +            LL+ + L +  + G +V+
Sbjct: 936  SNRLLTVEKIEAETFKLKHYENNLKPAKLS-----------ALLKHLQLLQDSSAGEQVV 984

Query: 1026 IFFQMTQVMDIMEDFLRY---LDM-KYLRLDGHTKSDDRTALLNTFNAPN-SDYFCFLLS 1080
            IF Q +  +DI+ED L+     D+ K  + DG     +R+ +L  F   + S     LLS
Sbjct: 985  IFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLKERSTVLQDFQIKDLSRQKILLLS 1044

Query: 1081 TRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
             +AGG+GLNL  A    + D  W+P  + QA DR HRIGQ N V+++R I +NS+EE +L
Sbjct: 1045 LKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHRIGQTNNVKVVRFIIENSIEEKML 1104

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 147/322 (45%), Gaps = 61/322 (18%)

Query: 705 GILADEMGLGKTIQTISL-LTYLYEAKGVHG------------------PF-----LVIV 740
           GIL+DEMGLGKTI T++L L+  Y+++ V                    P+     L++V
Sbjct: 502 GILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIVV 561

Query: 741 PLSTLTNWNAEFDKW--APKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYI----- 793
           P+S L  WN EF+K   +  +R   + G  +    K     +    VV+TT+  +     
Sbjct: 562 PMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSSLKKLLTKTHNPPTVVITTYGIVQSEWS 621

Query: 794 -----------IKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGT 842
                      I+    L  + +   +IDEGH ++N ++ L+        S  + +LTGT
Sbjct: 622 KIFKKQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRN-RTTLTSKAIMDLTSKCKWVLTGT 680

Query: 843 PLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHK 902
           P+ N L +L++L+ F+  + ++ +  +  + +TPF N   +    +           ++ 
Sbjct: 681 PIINRLDDLYSLVRFLKLEPWSQIGYWKMFVSTPFENKNFKQAFDV-----------VNA 729

Query: 903 VLRPFLLRRLK--KDVEK----DLPDKVEKVLKCKMSALQHKLYQQML-KHRRLFIFDDS 955
           +L P LLRR K  KD++     +LP K   V + K+S  Q+ +Y+ +L +  +  I   +
Sbjct: 730 ILEPVLLRRTKQMKDIDGKPLVELPPKEVIVERLKLSKAQNAVYKYLLDRAEQSVILGLA 789

Query: 956 SNQKFSSSRGFNNQIMQLRKIC 977
                         I++LR++C
Sbjct: 790 RGDLLKQYSTILVHILRLRQVC 811

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 95/191 (49%), Gaps = 28/191 (14%)

Query: 687 YQLKGLQWMVSLFNNHLNG-ILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTL 745
           +QL+GL W+     +  NG +LADEMG+GKTIQTI+LL      K    P LV+ P   L
Sbjct: 197 FQLEGLHWLQQQEESDYNGGVLADEMGMGKTIQTIALLMSDITRK----PSLVVAPTVAL 252

Query: 746 TNWNAEFDKWA-PKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYI----------- 793
             W  E ++    KL    + G          L   ++ DV+LTT+  +           
Sbjct: 253 MQWKNEIEQHTNKKLSVYMYHGA----NRTNNLGDFKDVDVILTTYAVLESVYRKQVYGF 308

Query: 794 ------IKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNN 847
                 +KE+ LL  I +   I+DE H +K+  S  +  +N+   +  R  L+GTPLQN 
Sbjct: 309 KRKAGTVKEKSLLHSINFYRVILDEAHNIKDRTSNTAKAVNS-LQTKKRWCLSGTPLQNR 367

Query: 848 LPELWALLNFV 858
           + E+++L+ F+
Sbjct: 368 IGEMYSLIRFL 378

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 74/143 (51%), Gaps = 3/143 (2%)

Query: 1001 WRSAGKFELLERILPKFKATGHRV--LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSD 1058
            WRS+ K E L   L   ++    +  ++F Q T ++D++E  L+    + ++L G     
Sbjct: 625  WRSSTKIEALVEELYNLRSDKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPT 684

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
             R   +  F   N     FL+S +AGG+ LNL  A  V I D  WNP  + Q+ DR HRI
Sbjct: 685  QRDQTIKYF-MENIHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 743

Query: 1119 GQKNEVRILRLITDNSVEEAILD 1141
            GQ   V+I R   ++S+E  I++
Sbjct: 744  GQFRPVKITRFCIEDSIESRIIE 766

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 72/129 (55%), Gaps = 9/129 (6%)

Query: 1019 ATGHRVLIFFQMTQVMDIMEDFLRYL----DMKYLRLDGHTKSDDRTALLNTFNAPNSDY 1074
            + G +V++F Q +  +DI+E  L  +     +K  + DG     +RTA+L  F     DY
Sbjct: 991  SAGEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLKERTAVLEDFKV--KDY 1048

Query: 1075 FC---FLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131
                  LLS +AGG+GLNL  A    + D  W+P  + QA DR HRIGQ N V+++R + 
Sbjct: 1049 AVQKVLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQTNSVKVIRFVI 1108

Query: 1132 DNSVEEAIL 1140
            D S+EE +L
Sbjct: 1109 DGSIEEKML 1117

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 143/332 (43%), Gaps = 76/332 (22%)

Query: 705 GILADEMGLGKTIQTISLLTY-----------LY------------------EAKGVHGP 735
           GIL+DEMGLGKTI  +SL+             L+                  E    +  
Sbjct: 509 GILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAYKT 568

Query: 736 FLVIVPLSTLTNWNAEFDKW---APKLRKIAFKGPPMERKPKQALIKNREF-DVVLTTFE 791
            L+IVP+S LT W  EFDK    A    ++ + G       K  LIK +    VVLTT+ 
Sbjct: 569 TLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNV--SSLKSLLIKRKNPPTVVLTTYG 626

Query: 792 YIIKERPLLSK----------------IKWVHTIIDEGHRMKNAQ---SKLSLTLNTYYH 832
            +  E   LSK                I++   I+DEGH ++N     SK  L L+    
Sbjct: 627 IVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKSTITSKAVLELS---- 682

Query: 833 SDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEE 892
           S YR ILTGTP+ N L +L++L+ F+  + ++ +  + ++   PF     +    +    
Sbjct: 683 SKYRWILTGTPIINRLDDLYSLVKFLKLEPWSQIGYWKQFITNPFEERNFKQAFDV---- 738

Query: 893 TLLVIRRLHKVLRPFLLRRLKKDVEKD------LPDKVEKVLKCKMSALQHKLYQQMLKH 946
                  ++ ++ P LLRR K+  + D      LP K   + K ++S  Q  +Y++ L+ 
Sbjct: 739 -------VNAIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFLQR 791

Query: 947 -RRLFIFDDSSNQKFSSSRGFNNQIMQLRKIC 977
             + F     S             I++LR++C
Sbjct: 792 AEKTFRSGLQSGDLLKKYSTILVHILRLRQVC 823

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 106/216 (49%), Gaps = 36/216 (16%)

Query: 681 GGTLK--EYQLKGLQWMVSLFNN-HLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFL 737
           G T+K   +QL+GL W++S   + +  G+LADEMG+GKTIQTI+LL           P L
Sbjct: 179 GMTIKLLPFQLEGLHWLISQEESIYAGGVLADEMGMGKTIQTIALLM----NDLTKSPSL 234

Query: 738 VIVPLSTLTNWNAEFDKWAP-KLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEY---- 792
           V+ P   L  W  E ++    +L+   + G       K      + +DVVLTT+      
Sbjct: 235 VVAPTVALMQWKNEIEQHTKGQLKIYIYHGASRTTDIKDL----QGYDVVLTTYAVLESV 290

Query: 793 -------------IIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839
                        + K+  +L  I +   I+DE H +K+ QS  +  +N    +  R  L
Sbjct: 291 FRKQNYGFRRKNGLFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNN-LKTQKRWCL 349

Query: 840 TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNT 875
           +GTPLQN + E+++L+ F+      ++  F ++F T
Sbjct: 350 SGTPLQNRIGEMYSLIRFL------NINPFTKYFCT 379

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 78/151 (51%), Gaps = 3/151 (1%)

Query: 1001 WRSAGKFELLERILPKFKATGHRV--LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSD 1058
            W+S+ K E L   L K ++    +  ++F Q T ++D++E  L+    + ++L G     
Sbjct: 615  WQSSTKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPT 674

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
             R   +  F   N     FL+S +AGG+ LNL  A  V I D  WNP  + Q+ DR HRI
Sbjct: 675  QRDETIKYF-MNNIQCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 733

Query: 1119 GQKNEVRILRLITDNSVEEAILDKAHAKLDI 1149
            GQ   V+I R   ++S+E  I++    K ++
Sbjct: 734  GQYRPVKITRFCIEDSIEARIIELQEKKANM 764

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 127/278 (45%), Gaps = 47/278 (16%)

Query: 684  LKEYQLKGLQWMVSL-FNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPL 742
            L  +Q  GLQW+++   +    G+LAD+MGLGKT+Q I+L+     +       L++ P+
Sbjct: 733  LLRHQRLGLQWLLNAETSKRKGGLLADDMGLGKTVQAIALMLANRSSNESKKTNLIVAPV 792

Query: 743  STLTNWNAEFD---KWAPKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYII----- 794
            S L  W  E +   K +       + G    +      + N  FDV+L +++ +      
Sbjct: 793  SVLRVWKGEIETKIKESSDFNSAIYGGVNGIKFRSWDKLSN--FDVILVSYQTLANELKK 850

Query: 795  ----------KERPLLSKIKWVHT---------------------IIDEGHRMKNAQSKL 823
                      K+ P +  IK +++                     I+DEG  +KN +++ 
Sbjct: 851  HWPERLKTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEGQNIKNMKTQA 910

Query: 824  SLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQ 883
            +    T  +S YR IL+GTP+QNN+ EL++L+ F+    +N  + F +    PF+N    
Sbjct: 911  AKACCTV-NSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIGRPFSNL--- 966

Query: 884  DKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLP 921
             K     E     I+++  +LR  +LRR K D    +P
Sbjct: 967  -KQNYDSESRKQAIKKVRVLLRAIMLRRSKTDKIDGVP 1003

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 77/143 (53%), Gaps = 2/143 (1%)

Query: 1018 KATGHRVLIFFQMTQVMDIMEDFL-RYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFC 1076
            K+   +++IF Q T  +D++E  L   L +  L+  G   +  R+ +++ F +   D   
Sbjct: 1247 KSDSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYSE-EDKRV 1305

Query: 1077 FLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVE 1136
             L+S +AG  GL L  A+ V+I D  WNP+ + QAQDR +RI Q  EV + RL   NSVE
Sbjct: 1306 LLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVE 1365

Query: 1137 EAILDKAHAKLDIDGKVIQAGKF 1159
            + IL+    K D+    + A K 
Sbjct: 1366 DRILELQKLKRDMVDAAMDAKKI 1388

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 80/143 (55%), Gaps = 4/143 (2%)

Query: 1002 RSAGKFELLERILPKF--KATGHRVLIFFQMTQVMDIMEDFLRY-LDMKYLRLDGHTKSD 1058
            + + K E+   I+ K     T  +++IF Q T   +I+  F++  L + +LR DG   S 
Sbjct: 1425 KESKKVEMCLDIIKKVTDSNTDEKLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSS 1484

Query: 1059 DRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI 1118
             R+A + +F   N +Y   L+S +AG  GL L  A+ VI+ D  WNP  + QA DR HRI
Sbjct: 1485 QRSACIESFYQDN-NYRVMLISMKAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRI 1543

Query: 1119 GQKNEVRILRLITDNSVEEAILD 1141
             Q+ EV + RL+   SVE+ I++
Sbjct: 1544 SQEREVYVHRLLIKMSVEDRIVE 1566

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 139/302 (46%), Gaps = 56/302 (18%)

Query: 660  DYYEVAHSIKEEVKQQ---PSILVGGTLKEYQLKGLQWMVSL-FNNHLNGILADEMGLGK 715
            D  E    I+ EV+ +   P+ L    LK +Q +GL+W+VS+  ++   G+LAD+MGLGK
Sbjct: 893  DLLEGLKEIETEVEGEDLTPNELTVNLLK-HQRQGLRWLVSMEKSSKRGGLLADDMGLGK 951

Query: 716  TIQTISLLTYLY-EAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRK------IAFKGPP 768
            T+Q+++LL     E K      LV+ P++ L  W    D+ A K++K      + F G  
Sbjct: 952  TVQSLALLMANKPEPKSAIKTTLVVAPVAVLRVWK---DEVAVKIKKDVNVKVVIFGGGE 1008

Query: 769  MERKPKQALIKNREFDVVLTTFEYIIKE--------------RP--------LLSKIK-- 804
                  ++     E+D+VL +++ +  E              +P        L++++K  
Sbjct: 1009 NNSSKFRSWKDLAEYDIVLVSYQTLASEFKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSS 1068

Query: 805  -------------WVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPEL 851
                         +   I+DE   +KN +++ +    T   S +R  L+GTP+QNN+ EL
Sbjct: 1069 DEYFSPFYRNDSEFYRVILDEAQNIKNKKTQAAKACCT-ISSTFRWALSGTPIQNNIGEL 1127

Query: 852  WALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRR 911
            ++L+ F+    +N    F              D    ++ E    ++++  +LR  +LRR
Sbjct: 1128 YSLIRFLRIPPYNKEAKFHSDIGAVLNTKKPYD---YNDSERQRAMKKVQVLLRAIMLRR 1184

Query: 912  LK 913
             K
Sbjct: 1185 TK 1186

>Kwal_14.1868
          Length = 1357

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 72/126 (57%), Gaps = 2/126 (1%)

Query: 1017 FKATGHRVLIFFQMTQVMDIMEDFLRY-LDMKYLRLDGHTKSDDRTALLNTFNAPNSDYF 1075
             K+   ++++F Q T   D+++ F+R  L  +YLR DG   S  R A +  F   + +  
Sbjct: 1190 LKSKTEKIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEEFYR-SLERR 1248

Query: 1076 CFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSV 1135
              L+S +AG  GL L  A+ VI+ D  WNP  + QA DR +RI Q  +V++ RL+  NSV
Sbjct: 1249 ILLISMKAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQVHRLLVKNSV 1308

Query: 1136 EEAILD 1141
            E+ IL+
Sbjct: 1309 EDRILE 1314

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 159/348 (45%), Gaps = 62/348 (17%)

Query: 684  LKEYQLKGLQWMVSL-FNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHG--PFLVIV 740
            L ++Q +GL W++++  +N   G+LAD+MGLGKT+Q I+L+  L    GV      L++ 
Sbjct: 675  LMKHQRQGLHWLLTVEKSNRKGGLLADDMGLGKTVQAIALM--LANKSGVENCKTNLIVA 732

Query: 741  PLSTLTNWNAEFD---KWAPKLRKIAFKGPPMER-KPKQALIKNREFDVVLTTFEYI--- 793
            P++ L  W AE     K    L+ + + G    + +  ++L+++   DVVL +++ +   
Sbjct: 733  PVAVLRVWQAEVKTKVKKTSGLKVLIYGGGNGAKVENYRSLLRH---DVVLVSYQTLASE 789

Query: 794  -----------------------------IKERP------LLSKIKWVHTIIDEGHRMKN 818
                                         +KER         ++ K+   I+DE   +KN
Sbjct: 790  LKKHWPARLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRIILDEAQNIKN 849

Query: 819  AQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFA 878
             +++ +    T   + YR  L+GTP+QNN+ EL++L+ F+  KI  S    ++ F     
Sbjct: 850  KKTQSAKACCTL-DATYRWALSGTPMQNNIMELYSLIRFL--KI--SPYKREQKFKLDIG 904

Query: 879  NTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKD------LPDKVEKVLKCKM 932
            N  G+        +    I+++  +LR  +LRR  KD + D      LP+K+    +  +
Sbjct: 905  NPLGKATNDYDSHDRQQAIKKVQVLLRAIMLRRT-KDSKIDGKPILELPEKIITNREDVL 963

Query: 933  SALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNHP 980
               + + Y  +    +  +    +N+   S       +++LR+ C HP
Sbjct: 964  QGAELQFYSDLEAKNQKKVEKLLNNRAKGSYSSILTLLLRLRQACCHP 1011

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
           Saccharomyces cerevisiae YLR032w RAD5 DNA helicase,
           start by similarity
          Length = 1114

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 90/348 (25%), Positives = 154/348 (44%), Gaps = 76/348 (21%)

Query: 704 NGILADEMGLGKTIQTISLLTY------------------------------LYEAKGVH 733
            GILADEMGLGKTI  ++L+                                L  ++  H
Sbjct: 479 GGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHKH 538

Query: 734 GPF-----LVIVPLSTLTNWNAEFDKWAPKLRKIA--FKGPPMERKPKQALIKNREFDVV 786
             +     L++VP+S L  W +EF+K    L+K    + G  ++      L  N    V+
Sbjct: 539 DTYAYRTTLIVVPMSLLNQWQSEFEKANKDLKKRCEIYYGNNIKDLRAYVLGPNAP-SVI 597

Query: 787 LTTF-----EYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTG 841
           +TT+     EY       L  + +   I+DEGH ++N  ++ S  +     S  + ILTG
Sbjct: 598 ITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAV-IALRSSRKWILTG 656

Query: 842 TPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLH 901
           TP+ N L +L++L+ F+  + ++ +  +  + + PF          +           ++
Sbjct: 657 TPIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYAQAFDV-----------IN 705

Query: 902 KVLRPFLLRRLK--KDVEK----DLPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDS 955
            VL P LLRR K  KDV+      LP K   V K ++S+ + ++YQ ML+       D  
Sbjct: 706 AVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLE-------DAE 758

Query: 956 SNQKFSSSRG-----FNN---QIMQLRKICNHPFVFEEVEDQINPARE 995
           ++ K   ++G     + N    I++LR++C H  + ++  D  +P  E
Sbjct: 759 NSVKEGLAKGDLLKNYTNILVHILRLRQVCCHLDLLKKTPDLGDPDLE 806

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 80/146 (54%), Gaps = 11/146 (7%)

Query: 1004 AGKFELLERILPKFKAT--GHRVLIFFQMTQVMDIMEDFLRYL----DMKYLRLDGHTKS 1057
            + K + L R L + + T  G ++++F Q +  +DI+E  LR       +   + DG    
Sbjct: 938  STKIKALLRHLKQIQETSPGEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDM 997

Query: 1058 DDRTALLNTFNAPNSDYFC---FLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDR 1114
             +RT +L  F+  + D  C    LLS + GG+GLNL  A    + D  W+P  + QA DR
Sbjct: 998  KERTRILEQFH--DKDLSCIKLLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDR 1055

Query: 1115 AHRIGQKNEVRILRLITDNSVEEAIL 1140
             HRIGQ+  V+++R I DNSVEE +L
Sbjct: 1056 IHRIGQQQTVKVVRFIIDNSVEEKML 1081

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 146/354 (41%), Gaps = 75/354 (21%)

Query: 684  LKEYQLKGLQWMVSLFNNHL-NGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPL 742
            L ++Q +GL W++   ++    G+LAD+MGLGKT+Q I+L+     A       LV+ P+
Sbjct: 896  LLKHQRQGLYWLLKTESSKFKGGLLADDMGLGKTVQAIALMLANRSADSTCKTNLVVGPV 955

Query: 743  STLTNWNAEFDKWAPKLRKIA------FKGPPMERKPKQALIKNREFDVVLTTFEYIIKE 796
            + L  W+ E +    K  + +      F G  +E            +DVVL +++ +  E
Sbjct: 956  AVLRVWHDEINTKVKKQAQFSVMIYGGFGGKKVEN-----FKAMHNYDVVLVSYQTLAVE 1010

Query: 797  ------------------RPLLSKIKWVHT---------------------IIDEGHRMK 817
                               P ++ IK +++                     I+DE   +K
Sbjct: 1011 FKKHWPARLQGTSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQNIK 1070

Query: 818  NAQS---KLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFN 874
            N Q+   K   TLN      YR  L+GTP+QNN+ EL++LL F+    +N  + F E   
Sbjct: 1071 NKQTQAAKACCTLN----GTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIG 1126

Query: 875  TPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLP---------DKVE 925
                + GG         +T   ++++  +LR  +LRR K       P          K E
Sbjct: 1127 NALLSRGGD----FDSMDTKRALKKVRVLLRAIMLRRAKTSQINGQPILELPAKHIRKKE 1182

Query: 926  KVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQKFSSSRGFNNQIMQLRKICNH 979
             +L  +       L  +     R  +    + +K SSS      +++LR+ C H
Sbjct: 1183 DILDGQDLEFYKSLEHETAIQARALL----NERKASSSSNILTLLLRLRQACCH 1232

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 75/124 (60%), Gaps = 2/124 (1%)

Query: 1019 ATGHRVLIFFQMTQVMDIMEDFLR-YLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCF 1077
            +T  ++++F Q T   DI++ F++  L++ YLR DG    + R +++  F    ++    
Sbjct: 1416 STDEKLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYREKNERL-L 1474

Query: 1078 LLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEE 1137
            L+S +AG  GL L  A+ VI+ D  WNP+ + QA DR +RI Q+ EV I RL+  N++E+
Sbjct: 1475 LISMKAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIED 1534

Query: 1138 AILD 1141
             I++
Sbjct: 1535 RIVE 1538

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 73/127 (57%), Gaps = 5/127 (3%)

Query: 1019 ATGHRVLIFFQMTQVMDIMEDFLRYL---DM-KYLRLDGHTKSDDRTALLNTFNAPN-SD 1073
            + G +V+IF Q +  +DI+E  L +    D+ K  + DG     +RT++L  F   + S 
Sbjct: 1010 SAGEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYSR 1069

Query: 1074 YFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDN 1133
                LLS +AGG+GLNL  A    + D  W+P  + QA DR HRIGQ N V+++R I  +
Sbjct: 1070 QKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTNSVKVMRFIIQD 1129

Query: 1134 SVEEAIL 1140
            S+EE +L
Sbjct: 1130 SIEEKML 1136

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 139/333 (41%), Gaps = 72/333 (21%)

Query: 705 GILADEMGLGKTIQTISLL-----------TYLYEAKGV-------------HGPF---- 736
           GIL+DEMGLGKT+   SL+             L++ +                 P+    
Sbjct: 528 GILSDEMGLGKTVAAYSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKPYASKT 587

Query: 737 -LVIVPLSTLTNWNAEFDKW--APKLRKIAFKGPPMERKPKQALIKNREFDVVLTTFEYI 793
            L++VP+S LT W+ EF K   +P +    + G  +               VVLTT+  +
Sbjct: 588 TLIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNVSSLKTLLTKTKTPPTVVLTTYGIV 647

Query: 794 IKERPLLSK----------------IKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRL 837
             E    SK                + +   IIDEGH ++N  +  S  +        + 
Sbjct: 648 QNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSKAV-MALQGKCKW 706

Query: 838 ILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVI 897
           +LTGTP+ N L +L++L+ F+    +  +  +  + +TPF +   +    +         
Sbjct: 707 VLTGTPIINRLDDLYSLVKFLELDPWRQINYWKTFVSTPFESKNYKQAFDV--------- 757

Query: 898 RRLHKVLRPFLLRRLKKDVEKD------LPDKVEKVLKCKMSALQHKLYQQMLKHRRLFI 951
             ++ +L P LLRR K+  +KD      LP K   + +   S  Q  LY+ +L    + +
Sbjct: 758 --VNAILEPVLLRRTKQMKDKDGKPLVELPPKEVVIKRLPFSKSQDLLYKFLLDKAEVSV 815

Query: 952 FDDSSN----QKFSSSRGFNNQIMQLRKICNHP 980
               +     +K+S+       I++LR++C HP
Sbjct: 816 KSGIARGDLLKKYST---ILVHILRLRQVCCHP 845

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 84/165 (50%), Gaps = 10/165 (6%)

Query: 983  FEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATG--HRVLIFFQMTQVMDIMEDF 1040
             E++  ++ P   +N    + + K   L R L   + T    +V++F Q +  +DI+E+ 
Sbjct: 891  LEDINGKLEPVPYSNT---KKSSKIVALIRHLKHLQDTSANEQVVVFSQFSSYLDILENE 947

Query: 1041 LRYL----DMKYLRLDGHTKSDDRTALLNTFNAPN-SDYFCFLLSTRAGGLGLNLQTADT 1095
            LR        +  + DG     +R+ +L  F   +       LLS +AGG+GLNL  A  
Sbjct: 948  LRQSFASDICEIYKFDGRLDLKERSNVLAKFTEKSLVKMKVLLLSLKAGGVGLNLTCASH 1007

Query: 1096 VIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
              I D  W+P  + QA DR HRIGQ N V+I R I +NS+EE +L
Sbjct: 1008 AFIMDPWWSPGMEDQAMDRIHRIGQSNTVKIYRFIVENSIEEKML 1052

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 140/338 (41%), Gaps = 88/338 (26%)

Query: 704 NGILADEMGLGKTIQTISLLT--------------------YLYEAKGVHG--PF----- 736
            GILADEMGLGKTI  ++L+T                    +L    G+    P+     
Sbjct: 455 GGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTT 514

Query: 737 LVIVPLSTLTNWNAEFDKW---------------APKLRKIAFKGPPMERKPKQALIKNR 781
           L++VP+S L  W  EF +                   LR +  K    ++ P   ++   
Sbjct: 515 LIVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLLVK----QKSPPSVVLTT- 569

Query: 782 EFDVV------LTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDY 835
            + VV      L  F+Y      L S +++   I+DEGH ++N  +K S  +     S  
Sbjct: 570 -YGVVQTEWSKLQQFDYEASNEGLFS-VEFFRIILDEGHNIRNRTTKTSKAVMA-LTSRR 626

Query: 836 RLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLL 895
           + +LTGTP+ N L +L++L+ F+         +F+ W    +      D     +  + L
Sbjct: 627 KWVLTGTPIMNRLDDLFSLIKFM---------NFEPWCKIDYWRQFVSDPFEKKDYSSAL 677

Query: 896 VIRRLHKVLRPFLLRRLKKDVEKD------LPDKVEKVLKCKMSALQHKLYQQMLKHRRL 949
            +  +  V+ P LLRR K   ++D      LP K   +   + S  +  LY       + 
Sbjct: 678 EV--IQAVMGPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLY-------KY 728

Query: 950 FIFDDSSNQKFSSSRG-----FNN---QIMQLRKICNH 979
           F+     + K S +RG     ++     I++LR++C H
Sbjct: 729 FLSKAEHSVKESLARGDLLKKYSTILLHILRLRQVCCH 766

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 73/125 (58%), Gaps = 5/125 (4%)

Query: 1021 GHRVLIFFQMTQVMDIMEDFL----RYLDMKYLRLDGHTKSDDRTALLNTF-NAPNSDYF 1075
            G +V++F Q +  +DI+E+ L       D K  + DG     DR+ +L+TF     S   
Sbjct: 970  GEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNLKDRSRVLDTFATKDLSKLK 1029

Query: 1076 CFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSV 1135
              LLS +AGG+GLNL  A    + D  W+P  + QA DR HRIGQ++ V+I+R I +NS+
Sbjct: 1030 ILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVHRIGQESNVKIIRFIMENSI 1089

Query: 1136 EEAIL 1140
            EE +L
Sbjct: 1090 EEKML 1094

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 141/334 (42%), Gaps = 78/334 (23%)

Query: 704 NGILADEMGLGKTIQTISLLT-----------------------YLYEAKGVHGP--FLV 738
            G+LADEMGLGKTI T+++++                       Y Y++   +     L+
Sbjct: 495 GGLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLI 554

Query: 739 IVPLSTLTNWNAEFDKWA--PKLR-KIAFKGPPMERKPKQALIKNREFDVVLTTFEYIIK 795
           +VP+S L  W  EF+K    P    +I + G            KN    ++LT++  I  
Sbjct: 555 VVPMSLLFQWQKEFEKANNNPNAHCEIYYGGRAGNLITLLTKTKNPP-TIILTSYGVIQS 613

Query: 796 ERPLLSK----------------IKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 839
           E   L +                +++   +IDEGH ++N  ++ S  +     S  + +L
Sbjct: 614 EWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAVMDL-SSSRKWVL 672

Query: 840 TGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRR 899
           TGTP+ N L +L++L+ F+  + ++ +  +  + + PF     +    +           
Sbjct: 673 TGTPIINRLDDLFSLVKFMKLEPWSQIGYWKSFVSGPFEKKNYKQAFDV----------- 721

Query: 900 LHKVLRPFLLRRLK--KDVEKD----LPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFD 953
           +  VL P LLRR K  KD+       LP K   + K K +  +  LY       + F+  
Sbjct: 722 VSSVLEPVLLRRTKQMKDINGKPLVTLPLKEIVIEKVKFNTSEDILY-------KFFLNK 774

Query: 954 DSSNQKFSSSRG--------FNNQIMQLRKICNH 979
             ++ K S +RG            I++LR++C H
Sbjct: 775 AENSVKESLARGDLLKKYSTILVHILRLRQVCCH 808

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 88/375 (23%), Positives = 160/375 (42%), Gaps = 68/375 (18%)

Query: 663  EVAHSIKEEVKQQPSILVGGTLK---------EYQLKGLQWMVSLFNN-HLNGILADEMG 712
            E   ++ E VKQ  SI+ G  L          ++Q  GL W++ + N+    G+LAD+MG
Sbjct: 913  EQIRALLENVKQSESIIDGEALTPEDMTVNLLKHQRLGLHWLLQVENSAKKGGLLADDMG 972

Query: 713  LGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNWNAEFD---KWAPKLRKIAFKGPPM 769
            LGKTIQ I+L+      +      L++ P+S L  W  E +   K   K     F G   
Sbjct: 973  LGKTIQAIALMLANRSEESKCKTNLIVAPVSVLRVWKGELETKVKKRAKFTTFIFGGSGN 1032

Query: 770  ER-KPKQALIKNREFDVVLTTFEYIIKE---------------RPLLSKIK--------- 804
             + K  + L +   +D VL +++ +  E                P +  I+         
Sbjct: 1033 GKVKHWRDLAR---YDAVLVSYQTLANEFKKHWPKKLDGEQNQLPAVPHIQALNRLKTSN 1089

Query: 805  ------------WVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELW 852
                        +   ++DEG  +KN  ++ S    T  +  YR +L+GTP+QN++ EL+
Sbjct: 1090 EYYSPFFCNDSTFYRILLDEGQNIKNKNTRASKACCT-INGMYRWVLSGTPIQNSMDELY 1148

Query: 853  ALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRL 912
            +L+ F+    ++  + F       F       +     E+    +R++  +L   +LRR 
Sbjct: 1149 SLIRFLRIPPYHKEQRFKLDIGRFFQRN---KQYQYDNEDRKNALRKVRVLLNAIMLRRS 1205

Query: 913  KKDVEK-----DLPDKVEKVLKCKMSALQHKLYQQMLKHRRLF---IFDDSSNQKFSSSR 964
            K D        +LP K+ +V + ++   + K Y  +    +     + ++S+   +SS  
Sbjct: 1206 KADKIDGKPLLELPPKIVEVDESRLKGEELKFYTALESKNQALAKKLLNNSTRGSYSSVL 1265

Query: 965  GFNNQIMQLRKICNH 979
                 +++LR+ C H
Sbjct: 1266 TL---LLRLRQACCH 1277

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 85/154 (55%), Gaps = 4/154 (2%)

Query: 1007 FELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLR-YLDMKYLRLDGHTKSDDRTALLN 1065
             ++++R+  +  +   +++IF Q T   +I+E FL+  L+  YL+  G   +  R+ ++N
Sbjct: 1449 IQVIQRVFDE--SATEKIIIFSQFTTFFEILEHFLKNKLNFPYLKYIGSMNAQRRSDVIN 1506

Query: 1066 TFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVR 1125
             F   + +    L+S +AG  GL L  A+ V+I D  WNP+ + QAQDR +RI Q  +V+
Sbjct: 1507 EF-YRDPEKRILLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQ 1565

Query: 1126 ILRLITDNSVEEAILDKAHAKLDIDGKVIQAGKF 1159
            + +L   +SVE+ I +    K ++    +  GK 
Sbjct: 1566 VHKLFIKDSVEDRISELQKRKKEMVDSAMDPGKI 1599

>Scas_674.12d
          Length = 1323

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 66/119 (55%), Gaps = 2/119 (1%)

Query: 1022 HRVLIFFQMTQVMDIMEDFL-RYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLS 1080
             +++IF Q T   DI + FL + L + YL+  G   +  R  ++  F    ++    L+S
Sbjct: 1166 EKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITKFYRQANERI-LLIS 1224

Query: 1081 TRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAI 1139
             +AG  GL L  A+ VII D  WNP+ + QAQDR +RI Q  EV + RL   +SVE+ I
Sbjct: 1225 MKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLFIKDSVEDRI 1283

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 141/326 (43%), Gaps = 59/326 (18%)

Query: 642 VGDKNGADSDDDLERERI---DYYEVAHSIKEEVKQQPSILVGGTLK---------EYQL 689
           +GD N  +SD+      I   D  E    + + VKQ  S   G TL          ++Q 
Sbjct: 596 IGDMNAFNSDNQFRVANILAGDDQEHIRELLQNVKQTESESEGETLTPEDMTVNLLKHQK 655

Query: 690 KGLQWMVSL-FNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPLSTLTNW 748
            GL W++++  +    G+LAD+MGLGKT+Q I+L+             L++ P++ L  W
Sbjct: 656 IGLHWLLNVEASKKKGGLLADDMGLGKTVQGIALMLANRSKDQACKTNLIVAPVAVLRVW 715

Query: 749 NAEFDKWAPKLRKIA-FKGPPMERKPKQALIKN-REFDVVLTTFEYII------------ 794
             E +    K++K A F         K A  K   E+D ++ ++  +             
Sbjct: 716 GGELE---TKIKKEANFSAFIYGGGDKLATWKELSEYDAIMVSYPTLAIEFKKHWPASLG 772

Query: 795 ---KERPLLSKIKWVHT---------------------IIDEGHRMKNAQSKLSLTLNTY 830
              K+ P + ++  +++                     I+DEG  +KN +++ +    + 
Sbjct: 773 KDQKQLPAIPQLAAMNSLKKKDEYFSPFFCNESTFYRIILDEGQNIKNKKTRAAKACCS- 831

Query: 831 YHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSE 890
             + YR + +GTP+QN++ EL++L+ F+    ++  + F      PF    G       +
Sbjct: 832 LDATYRWVFSGTPIQNSMDELYSLIRFLRIPPYHREERFMADIGRPFLRKNGN----YDD 887

Query: 891 EETLLVIRRLHKVLRPFLLRRLKKDV 916
            +    I+++  +L   +LRR K D+
Sbjct: 888 FDRKQAIKKVQVLLSAIMLRRSKSDM 913

>Kwal_47.17771
          Length = 972

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 68/125 (54%), Gaps = 5/125 (4%)

Query: 1021 GHRVLIFFQMTQVMDIMEDFLRYL----DMKYLRLDGHTKSDDRTALLNTFNAPNSDYF- 1075
            G ++++F Q +  +DI+E  +         K  + DG     +R+ +L  F   +     
Sbjct: 815  GEQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERSKVLQDFAVKDMTRLK 874

Query: 1076 CFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSV 1135
              LLS +AGG+GLNL  A    + D  W+P  + QA DR HRIGQ N V+++R I ++S+
Sbjct: 875  ILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNNVKVVRFIIEHSI 934

Query: 1136 EEAIL 1140
            EE +L
Sbjct: 935  EEKML 939

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 88/339 (25%), Positives = 145/339 (42%), Gaps = 84/339 (24%)

Query: 704 NGILADEMGLGKTIQTISLL-------TY----LYEAK---------------GVHGPF- 736
            GILADEMGLGKTI  ++++       +Y    L EA                G   P+ 
Sbjct: 335 GGILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYA 394

Query: 737 ----LVIVPLSTLTNWNAEFDKWAPKLR---KIAFKGPPMERKPKQALIKNREFDVVL-T 788
               LV+VP+S L+ W  EF+K +       +I + G       K  L K +    VL T
Sbjct: 395 SGTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNT--SSLKSLLTKTKSPPTVLIT 452

Query: 789 TFEYIIKERP-LLSK-------------IKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSD 834
           T+  +  E   LL+K             +++   +IDEGH ++N  ++ S +L     S 
Sbjct: 453 TYGTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSRSLMDL-KST 511

Query: 835 YRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETL 894
              ILTGTP+ N L +L++L+ F+  + ++ +  +  + + PF     +    +      
Sbjct: 512 RSWILTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPFEKKNYKAAFDI------ 565

Query: 895 LVIRRLHKVLRPFLLRRLK--KDVEK----DLPDKVEKVLKCKMSALQHKLYQQMLKHRR 948
                +  +L P +LRR K  +DV+     +LP K   + K   +  +  LY       +
Sbjct: 566 -----VSSILEPVILRRTKGMRDVDGKRLVELPPKEVIIEKVAFNKNEDALY-------K 613

Query: 949 LFIFDDSSNQKFSSSRG--------FNNQIMQLRKICNH 979
            F+    S+ K    RG            I++LR++C H
Sbjct: 614 YFLNKAESSVKEGLDRGDLLKKYSTILVHILRLRQVCCH 652

>Scas_670.13
          Length = 900

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 60/111 (54%), Gaps = 6/111 (5%)

Query: 1399 QEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDL 1458
            Q++  + R+L+D     ++ +   +  IF   P K+ YPDYY++IK P +F  + K   L
Sbjct: 5    QQLRGQLRQLFDSLFTIKDENGLAIHPIFDALPPKKEYPDYYIIIKKPVSFNTIKKR--L 62

Query: 1459 NVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELE----DAVIAKWKE 1505
            + Y   +  + D   I  NA+ YN + S I+R + +LE    D+++ K K+
Sbjct: 63   SQYIDAQDFINDLAQIPWNAKTYNAQGSPIYRCATDLENFIKDSILPKLKQ 113

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%)

Query: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131
            SD  C LL+ R+ G GLNL  A  + + D   N ++++QA  R +RIGQ+ E  +   + 
Sbjct: 1345 SDITCLLLNIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFML 1404

Query: 1132 DNSVEEAIL 1140
            +N+VEE+I+
Sbjct: 1405 ENTVEESIM 1413

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/277 (20%), Positives = 111/277 (40%), Gaps = 56/277 (20%)

Query: 623 FTKDKIESHLDTQELSEDNVGDKNGADSDDDLERERIDYYEVAHS-------IKEEVKQQ 675
           F KD +   L+ +   + NV     +D   +     + Y+ + HS       IK+ V +Q
Sbjct: 261 FQKDSLLWLLEKEHYFDCNVSKTTTSDQKHEDSVSELLYF-LNHSVSFGYSTIKDLVSKQ 319

Query: 676 PSI---LVGGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISL---------- 722
                   G  L + +++ L+   + +     G+LA+EMGLGKT++ ++L          
Sbjct: 320 FYFWNKYTGYILSQEEVRSLKSSFNEYEVGAKGVLAEEMGLGKTLEILALICINKRKYKA 379

Query: 723 ---LTYLYEAKGV---HGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKP--- 773
              L ++ E+  V       L++ P S L  W  E     P ++   + G    +K    
Sbjct: 380 DEPLDFVSESGKVISKCSTTLIVCPGSILKQWIDEMQSTHPAIKIYHYGGFIAVKKEFAC 439

Query: 774 ---KQALIKNREFDVVLTTFEYIIKERPL----------------------LSKIKWVHT 808
                 + K  ++D+V+T++  +  E                         LS +++   
Sbjct: 440 DNINTIVQKLSQYDIVITSYNVVSNEVHYAQFNNAFRQNRRRHVQYDYSSPLSLMQFYRI 499

Query: 809 IIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQ 845
           I+DE   + +  +K ++   +  H  +   ++GTP+Q
Sbjct: 500 ILDELQMLHSGSTKAAIC-TSLLHRVHTWGVSGTPIQ 535

>Kwal_47.18059
          Length = 880

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 1396 KERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKH 1455
            ++++E+ ++ + LY+  +  +      +  IF + P ++ YPDYY LIK+P +   V K 
Sbjct: 3    EDKKELQKRLKPLYEEILEIKEPSGLEVYPIFQILPPRKDYPDYYKLIKHPMSLSTVKKR 62

Query: 1456 IDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDAV 1499
            ++ + Y + ++ V+D   I  NAR YNT  S I+  +  L+D +
Sbjct: 63   LNHH-YSNAQEFVQDLAQITWNARTYNTRQSDIYLYATILDDHI 105

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%)

Query: 1423 LSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYN 1482
            ++  F  +P +   P YY +I  P + +++ K +    Y + +   +DF L+ +N ++Y+
Sbjct: 279  ITAAFDRQPDEEREPQYYQVISNPISIDDIRKKVKQRKYKTFQLFQQDFKLVISNYQLYH 338

Query: 1483 TEDSIIFRDSLELE 1496
                   R + ELE
Sbjct: 339  RSQPADLRRAAELE 352

>Sklu_2218.3 YLR357W, Contig c2218 5323-7877
          Length = 852

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 1396 KERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKH 1455
            +ER+ + +K R LYD     +      +  IF + P ++ YPDYY +IK P +   V K 
Sbjct: 3    EERKALGKKLRVLYDGVFLLKEERGMEIYPIFQILPPRKDYPDYYAIIKKPMSLSTVKKK 62

Query: 1456 IDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDAV 1499
              L  Y   ++ V D   I  NAR YNT++S I+  +L ++  +
Sbjct: 63   --LGNYKDAQEFVCDLVQITWNARTYNTKESEIYHYALIMDKYI 104

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%)

Query: 1431 PSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFR 1490
            P +   P YY +I  P + E + K +    Y   +   +DF L+  N ++Y+    +  R
Sbjct: 329  PDEEQEPQYYTVITSPISVEEIRKKVKQRKYKDFQAFQQDFKLVITNYQLYHRTQPLELR 388

Query: 1491 DSLELE 1496
             + ELE
Sbjct: 389  RAAELE 394

>Scas_573.9
          Length = 1502

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 68/130 (52%), Gaps = 4/130 (3%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            ++L++ Q    + ++   L   D+++L    ++ +  +   +  F +  S+  C LL+ +
Sbjct: 1333 QILLYSQSANFLKVLGKILTKNDIEHLTCLSNSSTIGKK--IARFKS-QSNITCLLLNVK 1389

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDK 1142
              G GLNL  A  + + D   N   +LQA +R +RIGQK E  +  LI +NSVEE I  K
Sbjct: 1390 TLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVEENIF-K 1448

Query: 1143 AHAKLDIDGK 1152
               KL+ + K
Sbjct: 1449 YKCKLESERK 1458

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 76/183 (41%), Gaps = 43/183 (23%)

Query: 705 GILADEMGLGKTIQTISLLTYLYEAKGVHGPF--------------LVIVPLSTLTNWNA 750
           G+L++EMGLGKTI+ ++L+            F              L++ P + LT W  
Sbjct: 371 GLLSEEMGLGKTIEVLALIMLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQWIN 430

Query: 751 EFDKWAPKLRKIAFKGPPMER------KPKQALIKNREFDVVLTTFEYI----------- 793
           E +     L+   + G    R        ++ L +  E+D+++T+++ +           
Sbjct: 431 ETNAHTENLKIFHYMGSLATRIQFDTDNIQEILDRLSEYDIIITSYDIVSAEIHYAEYNA 490

Query: 794 -IKER----------PLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGT 842
            I+ R            LS +++   I+DE   ++ + S  +    +  H  +   ++GT
Sbjct: 491 NIRSRRQKSPKYDYSSPLSLLEFFRIILDEVQMLR-SNSTNAAKCTSLLHRIHTWGVSGT 549

Query: 843 PLQ 845
           P+Q
Sbjct: 550 PIQ 552

>YGR056W (RSC1) [2019] chr7 (601663..604449) Component of the abundant
            RSC complex involved in chromatin remodeling [2787 bp,
            928 aa]
          Length = 928

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 1409 YDYAVYYRNADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVV 1468
            YD   + ++ +   +  IF V P K+ YPDYY++I+ P +   + K   L  Y S +  V
Sbjct: 17   YDAVFHLKDENGIEIYPIFNVLPPKKEYPDYYIIIRNPISLNTLKKR--LPHYTSPQDFV 74

Query: 1469 EDFHLIFANARIYNTEDSIIFRDSLELEDAVIAK 1502
             DF  I  NA  YN +DS+I++ ++ LE  +  K
Sbjct: 75   NDFAQIPWNAMTYNAKDSVIYKYAILLESFIKGK 108

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 1419 DDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANA 1478
            +++ L+  F   P +   P YY +I  P    ++ K +    Y +     EDF L+  N 
Sbjct: 255  NNKTLTLCFEKLPDRNEEPTYYSVITDPICLMDIRKKVKSRKYRNFHTFEEDFQLMLTNF 314

Query: 1479 RIYNTED-SIIFRDSL 1493
            ++Y ++D S I R  L
Sbjct: 315  KLYYSQDQSNIIRAQL 330

>YLR357W (RSC2) [3739] chr12 (841330..843999) Component of the
            abundant RSC complex involved in chromatin remodeling
            [2670 bp, 889 aa]
          Length = 889

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 1423 LSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYN 1482
            +S IF V P K+ YPDYY +IK P +F  + K I    Y   +Q + D   I  NA+ YN
Sbjct: 39   ISPIFNVLPPKKDYPDYYAVIKNPVSFNTLKKRIPH--YTDAQQFMNDVVQIPWNAKTYN 96

Query: 1483 TEDSIIFRDSLELE 1496
            T DS I++ +L LE
Sbjct: 97   TRDSGIYKYALVLE 110

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1423 LSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYN 1482
            L+D+F   P +    +YY++I  P + +++ K +    Y + ++   DF+L+  N RI +
Sbjct: 299  LTDLFERLPDRHRDANYYIMIANPISLQDINKKVKTRRYKTFQEFQNDFNLMLTNFRISH 358

Query: 1483 TED--SIIFRDSLELEDAVIAKWK 1504
              D  SI   + LE     +A+++
Sbjct: 359  RGDPESIKISNILEKTFTSLARFE 382

>CAGL0B02816g complement(271482..274166) similar to sp|Q06488
            Saccharomyces cerevisiae YLR357w RSC2 or sp|P53236
            Saccharomyces cerevisiae YGR056w RSC1, hypothetical start
          Length = 894

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 1417 NADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFA 1476
            N ++  +S +F V P ++ YPDYY +IK P +   + K   L  Y + +Q ++D   I  
Sbjct: 23   NEENVNISPVFTVLPPRKDYPDYYDVIKKPISINTLKKR--LTTYTNAQQFMDDLVHIPW 80

Query: 1477 NARIYNTEDSIIFRDSLELEDAV 1499
            NA++YNT++S I++ +L LE  +
Sbjct: 81   NAKVYNTKESEIYKYALTLEKFI 103

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 3/118 (2%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            +V+++ Q T+ + ++   L+   +++L    +T +   T  +N F    S   C LL+ +
Sbjct: 1381 QVILYSQKTEYLKVIGKVLKLYHIEHLACLSNTANVGET--INNFKRQPS-VTCLLLNVK 1437

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
              G GLNL  A  + + D   N   +LQA  R +RIGQ  E  +   +  N+VEE IL
Sbjct: 1438 TLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTVEENIL 1495

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 81/183 (44%), Gaps = 42/183 (22%)

Query: 705 GILADEMGLGKTIQTISL-LTYLYEAKGVHGPFL--------------VIVPLSTLTNWN 749
           G+LA+EMGLGKTI+ +SL L    + K     F+              +I P + L  W 
Sbjct: 387 GVLAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWL 446

Query: 750 AEFDKWAPKLRKIAFKGPPMERKP----KQALIKNREFDVVLTTFEYI------------ 793
            E +  A  L+   ++G     K      +A+ +  ++D+++T++  I            
Sbjct: 447 EEIELHANSLKWYTYRGYNEIMKDCKTVDEAVQQLCQYDIIVTSYNIIATEVHHAEFNRS 506

Query: 794 IKERPL----------LSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTP 843
           I+ R L          L+ +++   I+DE   ++++ S  S    +  H  +   ++GTP
Sbjct: 507 IRSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSS-STYSAKCTSLLHRIHTWGVSGTP 565

Query: 844 LQN 846
           +QN
Sbjct: 566 IQN 568

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 62/118 (52%), Gaps = 3/118 (2%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            +++I+ Q  ++++I+   L+   +K+L    + +  +   ++ TF A + +  C LL T+
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQNSIKFLTTTKNVR--NFAKVVETFKA-DPEITCLLLDTK 1415

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
                GL L  A  V + +   N   + QA +R HRIGQ +E  +   +  N+VE +IL
Sbjct: 1416 RQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSIL 1473

>Kwal_14.1287
          Length = 1518

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 4/118 (3%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            +++I+ Q ++ + ++   L+   +++    G  K    + ++  F   N +  C LL+  
Sbjct: 1332 QIIIYSQYSEFLGLLSKVLKQHSIQHCNTAGSGKF---SKIVEKFK-KNPEVTCLLLNVT 1387

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
                GL L  A  V I D   N   +LQA +R HRIGQ  E  +   +  N+VE+ I+
Sbjct: 1388 RQATGLTLVNATHVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIV 1445

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 14/74 (18%)

Query: 689 LKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLL-----------TYLYEAKGV---HG 734
           L+  Q + +    H  G+L++EMGLGKT++ ++L+           T+L ++K       
Sbjct: 339 LQDAQELTNSLPKHAKGVLSEEMGLGKTLEILALMLVHKRTINGAPTFLSDSKKTILKTA 398

Query: 735 PFLVIVPLSTLTNW 748
             L++ P S L  W
Sbjct: 399 TNLIVCPDSILQQW 412

>KLLA0B13211g complement(1155757..1158504) similar to sp|Q06488
            Saccharomyces cerevisiae YLR357w RSC2 member of RSC
            complex, which remodels the structure of chromatin, start
            by similarity
          Length = 915

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 2/77 (2%)

Query: 1423 LSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYN 1482
            +  IF + P KR YPDYY +I++P +   V K   +  Y + ++ V D   +  NAR YN
Sbjct: 29   IHPIFHLLPPKRDYPDYYQIIEHPISLSTVRKR--MTQYKNPQEFVNDLARVTWNARTYN 86

Query: 1483 TEDSIIFRDSLELEDAV 1499
            T+DS ++  ++ L+  V
Sbjct: 87   TKDSDVYHYAVILDKCV 103

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 684 LKEYQLKGLQWMVSL-FNNHLNGILADEMGLGKTIQTISLLTYLYEAKGVHGPFLVIVPL 742
           L ++Q +GL W++++  +N   G+LAD+MGLGKT+Q I+L+             L++ P+
Sbjct: 885 LLKHQRRGLHWLLNVEKSNKRGGLLADDMGLGKTVQAIALMIANRSELESCKTNLIVAPV 944

Query: 743 STLTNWNAEF 752
           + L  W AE 
Sbjct: 945 AVLRVWQAEI 954

>Scas_478.4
          Length = 600

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 63/117 (53%), Gaps = 3/117 (2%)

Query: 1382 RNYLRSADNATKTLKERQEISQKARELYDYAVY--YRNADDR-RLSDIFLVKPSKRLYPD 1438
            RN+L + D  ++ LK  Q++     +  D A+   ++++D+  +LSD F+    +   P+
Sbjct: 176  RNFLINEDIRSRLLKHLQKLMDATEKQIDKALGEPFKDSDNTVKLSDPFMELVDRDTLPE 235

Query: 1439 YYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLEL 1495
            YY  I  P A   +  +++  VY  L   + D  L+F NA I+N   S+I++D+ +L
Sbjct: 236  YYEAIHKPMALNIIKTNLESGVYVRLYDFIIDVDLVFQNALIFNDPSSLIYQDAKKL 292

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/69 (21%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENV-MKHIDLNVYDSLKQVVEDFHLIFANARIYNTED 1485
            F+  PS++ +P YY  I+ P +   +  +  + +  + ++  + D  L+  N   +N  D
Sbjct: 91   FIKLPSRKFHPQYYYKIENPISINEIKSRDYETDKEEGIRNFLLDVELLAKNCDSFNEPD 150

Query: 1486 SIIFRDSLE 1494
            S+I +++ +
Sbjct: 151  SLIVKNAFQ 159

>ABL005C [587] [Homologous to ScYLR357W (RSC2) - SH; ScYGR056W (RSC1)
            - SH] (386890..389439) [2550 bp, 849 aa]
          Length = 849

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 1426 IFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTED 1485
            IF   P ++ YPDYY +IK P +   V K   LN Y   ++ V D   I  NAR+YNT++
Sbjct: 28   IFYTLPLRKDYPDYYRIIKKPLSLATVKKK--LNHYKRAQEFVNDLVRITWNARMYNTKE 85

Query: 1486 SIIF 1489
            S I+
Sbjct: 86   SEIY 89

>KLLA0A05115g complement(455456..457006) some similarities with
            sp|Q03330 Saccharomyces cerevisiae YGR252w GCN5 histone
            acetyltransferase, hypothetical start
          Length = 516

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 42/80 (52%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL   +K   PDYY  IK P    ++   ++ N Y+ ++  + D  LIF N R YN E++
Sbjct: 429  FLQPVNKEEVPDYYEFIKEPMDLSSMEMKLNGNRYEKMENFIYDARLIFNNCRAYNGENT 488

Query: 1487 IIFRDSLELEDAVIAKWKEM 1506
              F+ +  LE    +K KE+
Sbjct: 489  SYFKYANRLEKFFNSKVKEI 508

>AEL291C [2214] [Homologous to ScYKR008W (RSC4) - SH] (94483..96138)
            [1656 bp, 551 aa]
          Length = 551

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%)

Query: 1422 RLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIY 1481
            +L   FL   S+  +PDYY +I  P + E +  ++ L  Y  +     D  L+F NA+++
Sbjct: 211  KLCHPFLELVSQEDFPDYYEVIHKPISLEMIKNNLQLGYYTKIYDFYVDVQLLFQNAQVF 270

Query: 1482 NTEDSIIFRDSLEL 1495
            N  +++I++DS  L
Sbjct: 271  NDPETLIYQDSQRL 284

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            F+  PS++ +P Y+  I+ P +  N +K+ D    D  KQ + D  LI  N   YN  DS
Sbjct: 85   FIKLPSRKFHPGYFYKIEQPISI-NEIKNRDYEYKDGEKQFLLDVELIRKNCYAYNETDS 143

Query: 1487 IIFRDSLE 1494
            +I ++S++
Sbjct: 144  LIVKNSMQ 151

>YKR008W (RSC4) [3264] chr11 (451844..453721) Component of abundant
            chromatin remodeling complex (RSC) [1878 bp, 625 aa]
          Length = 625

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1416 RNADDR-RLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLI 1474
            +N DD+ +LS+ F+    K   P+YY ++  P A   V +++++  Y  +   + D  L+
Sbjct: 201  KNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLV 260

Query: 1475 FANARIYNTEDSIIFRDSLEL 1495
            F NA I+N   ++I++D+  L
Sbjct: 261  FQNAHIFNDPSALIYKDATTL 281

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            F+  PS++ +P YY  I+ P +  N +K  D    D     + D  L+  N + YN  DS
Sbjct: 80   FIKLPSRKFHPQYYYKIQQPMSI-NEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDS 138

Query: 1487 IIFRDSLEL 1495
            +I ++S+++
Sbjct: 139  LIVKNSMQV 147

>KLLA0A02959g 260627..262306 similar to sp|Q02206 Saccharomyces
            cerevisiae YKR008w RSC4 member of RSC complex, which
            remodels the structure of chromatin, start by similarity
          Length = 559

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 62/131 (47%), Gaps = 12/131 (9%)

Query: 1377 VRKNGRNYLRSADNATK-----------TLKERQEISQKARELYDYAVYYRNADDR-RLS 1424
            V+   RN+L + D  T+           T K+  EI  +  ++   A    N DD   + 
Sbjct: 165  VKNATRNFLVNDDVKTRFIAIFDTLLNVTDKQMAEILAEDDDVKLEAASNNNLDDTLNIC 224

Query: 1425 DIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTE 1484
              FL    K  YP+Y  +I+ P +   V  +++L  Y  +   + D +L F NA ++N E
Sbjct: 225  QPFLELVDKDEYPEYEEVIRLPNSLNLVKNNLELGYYHKIYDFITDVNLTFQNALVFNDE 284

Query: 1485 DSIIFRDSLEL 1495
            D+ I+ D+L+L
Sbjct: 285  DTTIYSDALKL 295

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            F+  PS++ +P YY  I  P +  N +K  D        + + D  LI+ N   YN  DS
Sbjct: 87   FIKLPSRKFHPQYYYKIDQPISI-NEIKSRDYEYSGGETKFLLDCELIYKNCLAYNDPDS 145

Query: 1487 IIFRDS 1492
            +I +++
Sbjct: 146  LIVKNA 151

>Scas_683.14
          Length = 894

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 6/85 (7%)

Query: 1426 IFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTED 1485
            IF   P K+ YPDYY +I  P +   + K +    Y   +  ++D   I  NA+ YNT+D
Sbjct: 37   IFNTCPPKKDYPDYYAVITNPVSLNTLKKRVPH--YTDPQAFIDDIVRIPWNAKTYNTKD 94

Query: 1486 SII--FRDSLE--LEDAVIAKWKEM 1506
            SII  + D LE  L++ ++   KE 
Sbjct: 95   SIIYAYADILEKFLKEKIVPTLKEF 119

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 1439 YYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELEDA 1498
            Y  ++  P + +++ K I +  Y   +Q   DF L+ AN ++Y+  D  +   +  LE  
Sbjct: 310  YRQMVPNPMSLDDIRKKIKMRKYKQFQQFEFDFKLMVANFKLYHRSDPGMLEYAKLLE-- 367

Query: 1499 VIAKWKEMTNEQ 1510
               KW E  + Q
Sbjct: 368  ---KWYEKFSRQ 376

>CAGL0K04389g 414810..417614 similar to sp|P53236 Saccharomyces
            cerevisiae YGR056w Chromatin remodeling complex protein,
            start by similarity
          Length = 934

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 1397 ERQEISQKARELYDYAVYYRNADDRRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHI 1456
            E  E+    R+ Y+     +      +  IF V P K+ YPDYY +IK P +   + K  
Sbjct: 6    EFGELRTDLRKQYEAIFSLKEESGANIFPIFNVLPIKKDYPDYYAIIKNPISLNTLKKR- 64

Query: 1457 DLNVYDSLKQVVEDFHLIFANARIYNTEDSIIF 1489
             L  Y S +  V D   I  NA+ YN++ S+I+
Sbjct: 65   -LPHYTSPQDYVNDVSQIPWNAKTYNSKGSLIY 96

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 1416 RNADD--RRLSDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHL 1473
            R  DD  + L+  F   P    +P Y  +I  P   +++ + +    Y +     +DF L
Sbjct: 300  REVDDNNQTLTLTFEKLPDPERHPAYRQIISNPVCLDDIRRRVKTRKYKNFGSFQDDFTL 359

Query: 1474 IFANARIYNTEDSIIFRDSLELE 1496
            +  N + YN  + ++   +  +E
Sbjct: 360  MIENYKKYNQNNPMLLNTARLME 382

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNA-PNSDYFCFLLST 1081
            +++IF   +  + I+   L   ++ + R   +TK       ++TF   PN    C LL+ 
Sbjct: 1353 QIVIFSSHSAFLSILSTLLTAHNVTHARPLRNTKF---AKAVDTFRKDPNCT--CLLLNV 1407

Query: 1082 RAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
             +   GL L  A  +I+ +   +   + QA  R HRIGQK+   +   +  N+VEE+I+
Sbjct: 1408 HSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYVWNFMVRNTVEESIM 1466

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 77/193 (39%), Gaps = 57/193 (29%)

Query: 705 GILADEMGLGKTIQTISLLT-----YLYEAKGVHGPF-----------LVIVPLSTLTNW 748
           G+LADEMGLGKTI+ ++L++        E+     P            L++ P S L  W
Sbjct: 353 GVLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESILQQW 412

Query: 749 NAEFD----KWAPKLRKIAFKGPPMER------KPKQALIKNREFDVVLTTF-------- 790
             E D    K     +   ++G    R       P + +    ++DVV+ ++        
Sbjct: 413 IDEIDLHINKKVSDFKVFHYEGFEKTRNKFNTDSPAEIVELMSQYDVVICSYYTMSAEVH 472

Query: 791 --EYIIKERPL------------LSKIKWVHTIIDE----GHRMKNAQSKLSLTLNTYYH 832
             E+   +RP             LS +++   I+DE    G  M NA    SL      H
Sbjct: 473 YAEFSKIQRPSRDSTRRYDYTSPLSIMEFHRVILDEAQLLGGGMTNASRCTSLI-----H 527

Query: 833 SDYRLILTGTPLQ 845
             +   ++GTP++
Sbjct: 528 RVHTWGVSGTPVE 540

>CAGL0L02189g complement(256073..257743) similar to sp|Q02206
            Saccharomyces cerevisiae YKR008w RSC4 member of RSC
            complex which remodels the structure of chromatin, start
            by similarity
          Length = 556

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 35/56 (62%)

Query: 1437 PDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDS 1492
            P+YY +I+ P + + +  +I +  Y  L   + D  L+F NAR+YN  +++I++D+
Sbjct: 220  PEYYEIIQNPISLDVIATNITIGKYKQLYDFITDVQLVFLNARVYNDVNTLIYQDA 275

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            F+  PS++ +P YY  I+ P +  N +K  D    D     + D  LI  N   YN ED+
Sbjct: 79   FIKLPSRKFHPQYYYKIEKPISI-NEIKSRDYETNDGNLAFLLDVELIAKNCVSYNEEDT 137

Query: 1487 IIFRDS---LELEDAVIAKWKEM 1506
            +I ++S   + L +A + K K M
Sbjct: 138  LIVKNSEQVVNLIEAEVLKTKNM 160

>Scas_645.12
          Length = 455

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL   +K   PDYY  IK P     +   ++ N Y  ++  + D  L+F N R YN E++
Sbjct: 368  FLQPVNKEEVPDYYEFIKEPMDLSTMEMKLENNKYQKMEDFIYDARLVFNNCRKYNGENT 427

Query: 1487 IIFRDSLELEDAVIAKWKEM 1506
              F+ +  LE     K KE+
Sbjct: 428  SYFKYANRLEKYFNGKIKEI 447

>AER297C [2799] [Homologous to ScYGR252W (GCN5) - SH]
            (1182316..1183674) [1359 bp, 452 aa]
          Length = 452

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%)

Query: 1437 PDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELE 1496
            PDYY  IK P     +   ++ N Y+ ++  + D  LIF N R YN E++  F+ +  LE
Sbjct: 375  PDYYEFIKEPMDLSTMEIKLENNRYEKMEDFIYDARLIFNNCRAYNGENTSYFKYANRLE 434

Query: 1497 DAVIAKWKEM 1506
                 K KE+
Sbjct: 435  KFFNTKMKEI 444

>KLLA0E12617g 1118642..1122544 similar to sp|P35177 Saccharomyces
            cerevisiae YBR081c SPT7 involved in alteration of
            transcription start site selection, start by similarity
          Length = 1300

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%)

Query: 1424 SDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNT 1483
            S  FL K SKR  P+YY +IK P     V+K +    Y S  + V+D  LI+ N   YN+
Sbjct: 464  STAFLNKVSKREAPNYYQIIKKPMDLNTVLKKLKTFQYKSKHEFVDDIMLIWRNCLTYNS 523

Query: 1484 EDSIIFR 1490
            +     R
Sbjct: 524  DPKHFLR 530

>Kwal_56.24776
          Length = 424

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL   +K    DYY  IK P     +   ++ N Y+ ++  V D  LIF N R YN E++
Sbjct: 337  FLQPVNKEEVADYYEFIKEPMDLSTMEMKLENNRYEKMENFVYDARLIFNNCRAYNGENT 396

Query: 1487 IIFRDSLELEDAVIAKWKEM 1506
              F+ +  LE    +K KE+
Sbjct: 397  SYFKYANRLEKFFNSKMKEI 416

>AER172C [2675] [Homologous to ScYBR081C (SPT7) - SH] (955996..959802)
            [3807 bp, 1268 aa]
          Length = 1268

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%)

Query: 1424 SDIFLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNT 1483
            S  FL K SKR  P+YY +IK P     V+K +    Y S +Q  +D  LI+ N   YN+
Sbjct: 414  STAFLNKVSKRDAPNYYQIIKKPMDLNTVLKKLKTFQYRSKQQFTDDIMLIWKNCLTYNS 473

Query: 1484 EDSIIFR 1490
            +     R
Sbjct: 474  DPKHFLR 480

>Sklu_2273.8 YGR252W, Contig c2273 11152-12471
          Length = 439

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL   +K   PDYY  IK P     +   ++ N Y+ ++  + D  LIF N R YN E++
Sbjct: 352  FLQPVNKEEVPDYYEFIKEPMDLSTMEIKLENNRYEKMEDFIYDARLIFNNCRAYNGENT 411

Query: 1487 IIFRDSLELEDAVIAKWKEM 1506
              F+ +  LE    +K  E+
Sbjct: 412  SYFKYANRLEKFFNSKISEI 431

>YBR081C (SPT7) [270] chr2 complement(401210..405208) Component of the
            nucleosomal histone acetyltransferase
            (Spt-Ada-Gcn5-Acetyltransferase or SAGA) complex and the
            SLIK (SAGA-like) complex [3999 bp, 1332 aa]
          Length = 1332

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL K SKR  P+Y+ +IK       V+K +    YDS ++ V+D  LI+ N   YN++ S
Sbjct: 466  FLNKVSKREAPNYHQIIKKSMDLNTVLKKLKSFQYDSKQEFVDDIMLIWKNCLTYNSDPS 525

Query: 1487 IIFR 1490
               R
Sbjct: 526  HFLR 529

>YGR252W (GCN5) [2199] chr7 (996873..998192) Catalytic component of
            two nucleosomal histone acetyltransferase complexes: SAGA
            (Spt-Ada-Gcn5-Acetyltransferase) and ADA [1320 bp, 439
            aa]
          Length = 439

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL   +K   PDYY  IK P     +   ++ N Y  ++  + D  L+F N R+YN E++
Sbjct: 352  FLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENT 411

Query: 1487 IIFRDSLELEDAVIAKWKEM 1506
              ++ +  LE     K KE+
Sbjct: 412  SYYKYANRLEKFFNNKVKEI 431

>AGR333C [4644] [Homologous to ScYMR290C (HAS1) - SH]
            (1352668..1354182) [1515 bp, 504 aa]
          Length = 504

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 18/173 (10%)

Query: 953  DDSSNQKFSSSRGFNNQIMQLRKICNHP---FVFEEVEDQINPAR--ETNDTIWRSAGKF 1007
            +D  +  FS+++    ++  L +I   P   F+  + E + + A   E    +  S  +F
Sbjct: 217  EDRQSMLFSATQ--TTKVEDLARISLRPGPLFINVDSEKETSTADGLEQGYVVCDSDKRF 274

Query: 1008 ELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTF 1067
             LL   L KF+    ++++F      +    + L Y+D+  L L G  K   RT   NTF
Sbjct: 275  LLLFTFLKKFQ--NKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRT---NTF 329

Query: 1068 NAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
                +     L+ T     GL++   D +I FD   +P      +D  HR+G+
Sbjct: 330  FEFCNAERGILVCTDVAARGLDIPAVDWIIQFDPPDDP------RDYIHRVGR 376

>Kwal_56.24760
          Length = 433

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 3/124 (2%)

Query: 1025 LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAG 1084
            +IF   T   +I+   L+ LD++   L       +RT  L+ F A  +     L++T   
Sbjct: 259  IIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAAR---VLIATDVA 315

Query: 1085 GLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAH 1144
              GL++ T   V+ +D   NP   +    R  R G+K E        D S  +AI ++ +
Sbjct: 316  SRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESICFVAQRDVSRIQAIEERIN 375

Query: 1145 AKLD 1148
             K++
Sbjct: 376  KKME 379

>CAGL0M01738g 197743..201900 similar to sp|P35177 Saccharomyces
            cerevisiae YBR081c SPT7 Transcriptional activator,
            hypothetical start
          Length = 1385

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL K SK+  P+Y+L+IK       V+K +    Y+S ++ V+D  LI+ N   YN++ S
Sbjct: 443  FLNKVSKKDAPNYHLVIKKSMDLNTVLKKLKALQYNSKQEFVDDIMLIWKNCLTYNSDPS 502

Query: 1487 IIFR 1490
               R
Sbjct: 503  HFLR 506

>CAGL0F08283g 825860..827500 similar to sp|Q03330 Saccharomyces
            cerevisiae YGR252w GCN5 histone acetyltransferase,
            hypothetical start
          Length = 546

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL   +K   PDYY  IK P     +   ++ N Y+ +++ + D  L+  N R+YN E++
Sbjct: 459  FLRPVNKEEVPDYYEFIKEPMDLSTMELKLENNKYEKMEEFIYDARLVCNNCRLYNGENT 518

Query: 1487 IIFRDSLELEDAVIAKWKEM 1506
              ++ +  LE     K KE+
Sbjct: 519  SYYKYANRLEKFFNNKVKEI 538

>Kwal_26.7948
          Length = 551

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 62/125 (49%), Gaps = 19/125 (15%)

Query: 1382 RNYLRSA-------DNATKTL----KERQEISQKARELYDYAVYYRNADDRRLSDIFLVK 1430
            RNYL +A       D+  K L    K   E+++K+ E  D        D   +S+ F+  
Sbjct: 167  RNYLINAEVKRYLEDSLDKVLNATDKSIAELTEKSSEGLD--------DTLHISEPFMEL 218

Query: 1431 PSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFR 1490
              K   P+YY +I  P A + V  ++++N Y  +     D  L+F NA ++N  +++I++
Sbjct: 219  VLKDELPEYYEVIHRPTALKLVKNNLEMNYYTKIYDFYIDVLLVFENALVFNDFETLIYQ 278

Query: 1491 DSLEL 1495
            D+ +L
Sbjct: 279  DAEKL 283

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            F+  PS++ +P Y+  +  P +  N +K  D    +  +  + D  LI  N   YN  DS
Sbjct: 84   FIKLPSRKFHPGYFYKVDQPISI-NEIKSRDYEYLNGHRTFLLDIELIQKNCFSYNDPDS 142

Query: 1487 IIFRDSLEL 1495
            +I ++++++
Sbjct: 143  LIVKNAMQV 151

>KLLA0A05203g complement(462167..463474) highly similar to sp|P38719
            Saccharomyces cerevisiae YHR169w DBP8, start by
            similarity
          Length = 435

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 62/141 (43%), Gaps = 7/141 (4%)

Query: 1010 LERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNA 1069
            L +IL   K      +IF   T   +I+   L+ LD++   L       +RT  +  F A
Sbjct: 245  LYQILTSEKYVKSSCIIFVNRTVTAEILRRTLKSLDVRVTSLHSQMPQQERTNSVQRFRA 304

Query: 1070 PNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRL 1129
              +     L++T     GL++   + V+ +D   NP   +    R  R G+  E   L  
Sbjct: 305  QAARV---LIATDVASRGLDIPIVELVVNYDIPGNPDTFIHRAGRTARAGRHGES--LCF 359

Query: 1130 ITDNSVE--EAILDKAHAKLD 1148
            +T+  ++  EAI ++ + K++
Sbjct: 360  VTEKDIQRVEAIEERINKKME 380

>YMR290C (HAS1) [4244] chr13 complement(850073..851590) RNA helicase
            of the DEAD/DEAH box family [1518 bp, 505 aa]
          Length = 505

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 62/154 (40%), Gaps = 6/154 (3%)

Query: 982  VFEEVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFL 1041
            V  E ++      E    +  S  +F LL   L + +    ++++F      +    + L
Sbjct: 252  VVPETDNSTADGLEQGYVVCDSDKRFLLLFSFLKRNQK--KKIIVFLSSCNSVKYYAELL 309

Query: 1042 RYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDT 1101
             Y+D+  L L G  K   RT   NTF    +     L+ T     GL++   D +I FD 
Sbjct: 310  NYIDLPVLELHGKQKQQKRT---NTFFEFCNAERGILICTDVAARGLDIPAVDWIIQFDP 366

Query: 1102 DWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSV 1135
              +P   +    R  R G K + + L  +T N +
Sbjct: 367  PDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNEL 399

>Kwal_23.4288
          Length = 492

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 63/155 (40%), Gaps = 14/155 (9%)

Query: 985  EVEDQINPARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYL 1044
            E E+      E    +  S  +F LL   L + +    +V++F      +    + L Y+
Sbjct: 241  EKENSTVDGLEQGYVVCESDKRFLLLFSFLKRNQK--KKVIVFLSSCNSVRYYAELLNYI 298

Query: 1045 DMKYLRLDGHTKSDDRTALLNTF----NAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFD 1100
            D+  L L G  K   RT   NTF    NA      C  ++ R    GL++   D +I FD
Sbjct: 299  DLPVLELHGKQKQQKRT---NTFFEFCNAERGTLVCTDVAAR----GLDIPAVDWIIQFD 351

Query: 1101 TDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSV 1135
               +P   +    R  R G K + + L  +T N +
Sbjct: 352  PPDDPRDYIHRVGRTAR-GSKGKGKSLMFLTPNEL 385

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%)

Query: 1071 NSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLI 1130
            +S   C L++ +    GL L  A  VI+ +         QA +R HRIGQ  +  +  L+
Sbjct: 1346 DSSITCLLMNPKWCSRGLKLTNATHVILMEPMSEGRIQEQAVERIHRIGQGKDTFVWHLM 1405

Query: 1131 TDNSVEEAIL 1140
            T N+ EE+ L
Sbjct: 1406 TRNTAEESTL 1415

>Scas_718.29
          Length = 1313

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%)

Query: 1427 FLVKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDS 1486
            FL K SKR  P+Y+ +IK       V+K +    Y S ++ V+D  LI+ N   YN++ +
Sbjct: 457  FLNKVSKREAPNYHQIIKKSMDLNTVLKKLKTFQYQSKQEFVDDIMLIWKNCLTYNSDPT 516

Query: 1487 IIFR 1490
               R
Sbjct: 517  HFLR 520

>Sklu_2341.7 YMR290C, Contig c2341 11365-12867 reverse complement
          Length = 500

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 4/113 (3%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            ++++F      +    + L Y+D+  L L G  K   RT   NTF    +     L+ T 
Sbjct: 286  KIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRT---NTFFEFCNAERGILVCTD 342

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSV 1135
                GL++   D +I FD   +P   +    R  R G K + + L  +T N +
Sbjct: 343  VAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNEL 394

>Sklu_2273.4 YHR169W, Contig c2273 4981-6288
          Length = 435

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 3/124 (2%)

Query: 1025 LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAG 1084
            +IF   T   +I+   L+ LD++   L       +RT  L+ F A  +     L++T   
Sbjct: 262  IIFVNRTVTAEILRRTLKGLDVRVASLHSQMPQQERTNSLHRFRANAAR---VLIATDVA 318

Query: 1085 GLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAH 1144
              GL++ +   V+ +D   NP   +    R  R G+  E        D +  E+I ++ +
Sbjct: 319  SRGLDIPSVALVVNYDIPANPDTFIHRAGRTARAGRSGESICFVTQRDITRIESIEERIN 378

Query: 1145 AKLD 1148
             K+D
Sbjct: 379  KKMD 382

>CAGL0C02541g 255821..257752 similar to sp|P35817 Saccharomyces
            cerevisiae YLR399c BDF1 sporulation protein, hypothetical
            start
          Length = 643

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 4/72 (5%)

Query: 1421 RRLSDI--FL--VKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFA 1476
            +RL D   FL  V P     P Y+  IK P   + + + ++ N Y++ +Q+ EDF+L+  
Sbjct: 124  KRLKDARPFLQPVDPVALNIPLYFNFIKRPMDLQTIERKLNANAYETPEQITEDFNLMVE 183

Query: 1477 NARIYNTEDSII 1488
            N+  +N   ++I
Sbjct: 184  NSAKFNGPTAVI 195

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%)

Query: 1437 PDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELE 1496
            P Y+  +K P     V K +    Y++L Q   D  LIF N   +N + +I+      LE
Sbjct: 321  PTYFDYVKEPMDLGTVSKKLSNWEYENLDQAEHDIRLIFQNCYAFNPDGTIVNMMGHRLE 380

Query: 1497 DAVIAKW 1503
            D    KW
Sbjct: 381  DIFNTKW 387

>ADR011C [1752] [Homologous to ScYIR002C (MPH1) - SH] (721695..724928)
            [3234 bp, 1077 aa]
          Length = 1077

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 1075 FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDN- 1133
            +  L+ T  G  GL++   D +I +DT  +P +++Q   R  R G+K + RI+ L++DN 
Sbjct: 573  YNVLVCTSIGEEGLDIGEVDMIICYDTTSSPIKNIQ---RMGRTGRKRDGRIVLLLSDNE 629

Query: 1134 --SVEEAILDKAH 1144
                E+A+ D A 
Sbjct: 630  PRKFEQAMEDYAQ 642

>Scas_719.22
          Length = 678

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%)

Query: 1437 PDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSII 1488
            P YY  +K P     + K +++N Y + +Q+ EDF+L+ +N+  +N   ++I
Sbjct: 181  PLYYNYVKRPMDLSTIEKKLNVNAYATPEQITEDFNLMVSNSIAFNGPTAVI 232

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 32/72 (44%)

Query: 1437 PDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELE 1496
            P Y+  +K P     V   +    Y S+    +D  L+F N   +N + +I+      LE
Sbjct: 355  PTYFDYVKEPMDLGTVATKLSNWEYQSMDDFKKDVDLVFKNCYAFNPDGTIVNMMGHRLE 414

Query: 1497 DAVIAKWKEMTN 1508
            +  ++KW +  N
Sbjct: 415  EVFVSKWADRPN 426

>CAGL0I02354g 209279..210592 highly similar to sp|P38719 Saccharomyces
            cerevisiae YHR169w DBP8, hypothetical start
          Length = 437

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 7/125 (5%)

Query: 1025 LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAG 1084
            +IF   T   +++   L+ LD++   L       +RT  ++ F A  +     L++T   
Sbjct: 265  IIFVNRTTAAEVLRRTLKALDVRVASLHSQMPQQERTNSMHRFRANAAR---VLIATDVA 321

Query: 1085 GLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVE--EAILDK 1142
              GL++ T + VI +D   +P   +    R  R G+K +   +  IT   V   EAI  +
Sbjct: 322  SRGLDIPTVELVINYDIPSDPDTFIHRSGRTARAGRKGDA--ISFITQRDVSRIEAIEAR 379

Query: 1143 AHAKL 1147
             + K+
Sbjct: 380  INMKM 384

>Sklu_2281.4 YLR399C, Contig c2281 8444-10300 reverse complement
          Length = 618

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 1421 RRLSDI--FL--VKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFA 1476
            +RL D   FL  V P     P Y+  +K P     + + ++ N Y+S +QV EDF+L+  
Sbjct: 100  KRLKDAKPFLQPVDPVALNIPFYFNYVKRPMDLSTIERKLNANAYESPEQVTEDFNLMVE 159

Query: 1477 NARIYNTEDSII 1488
            N   +N   S+I
Sbjct: 160  NCCKFNGNTSVI 171

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 32/67 (47%)

Query: 1437 PDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELE 1496
            P Y+  +K P     V + ++   Y++  +V  D  L+F N   +N + +I+      LE
Sbjct: 285  PTYFDYVKEPMDLGTVSRKLNNWEYENADEVERDVRLVFKNCYAFNPDGTIVNMMGHRLE 344

Query: 1497 DAVIAKW 1503
            D   ++W
Sbjct: 345  DIFNSRW 351

>CAGL0M13519g complement(1329252..1330736) highly similar to sp|Q03532
            Saccharomyces cerevisiae YMR290c HAS1 helicase associated
            with SET1P, hypothetical start
          Length = 494

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 9/98 (9%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            ++++F      +    + L Y+D+  L L G  K   RT   NTF    +     L+ T 
Sbjct: 278  KIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRT---NTFFEFCNAERGILICTD 334

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
                GL++   D +I FD   +P      +D  HR+G+
Sbjct: 335  VAARGLDIPAVDWIIQFDPPDDP------RDYIHRVGR 366

>KLLA0A09669g complement(847036..848529) highly similar to sp|Q03532
            Saccharomyces cerevisiae YMR290c HAS1 helicase associated
            with SET1P, start by similarity
          Length = 497

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 9/98 (9%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            +V++F      +    + L Y+D+  L L G  K   RT   NTF    +     L+ T 
Sbjct: 283  KVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRT---NTFFEFCNAERGILVCTD 339

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
                GL++   D +I FD   +P      +D  HR+G+
Sbjct: 340  VAARGLDIPAVDWIIQFDPPDDP------RDYIHRVGR 371

>Scas_720.17
          Length = 519

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 10/113 (8%)

Query: 1008 ELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTF 1067
            +LLE +L K+ +   +VLIF    +    +E  LRY       + G    + RT  L  F
Sbjct: 343  KLLE-LLKKYHSKKEKVLIFALYKKEAARVERTLRYNGYDVAAIHGDLSQEQRTKALGEF 401

Query: 1068 NAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
             +  S+    LL+T     GL++    TVI      N    L  +D  HRIG+
Sbjct: 402  KSGKSN---LLLATDVAARGLDIPNVKTVI------NLTFPLTVEDYVHRIGR 445

>Scas_684.29
          Length = 508

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 19/103 (18%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFC-----F 1077
            ++++F      +    + L Y+D+  L L G  K   RT   NTF       FC      
Sbjct: 293  KIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRT---NTFFE-----FCNADRGI 344

Query: 1078 LLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
            L+ T     GL++   D ++ FD   +P      +D  HR+G+
Sbjct: 345  LICTDVAARGLDIPAVDWIVQFDPPDDP------RDYIHRVGR 381

>AER068C [2573] [Homologous to ScYLR399C (BDF1) - SH; ScYDL070W (BDF2)
            - SH] (761479..763182) [1704 bp, 567 aa]
          Length = 567

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 1421 RRLSDI--FL--VKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFA 1476
            +RL D   FL  V P K   P Y+  IK P     + + + +  Y++ +QV +DF+L+  
Sbjct: 25   KRLKDAKPFLQPVDPVKLNVPHYFQHIKRPMDLSTIERKLAVGAYETPEQVAQDFNLMVD 84

Query: 1477 NARIYNTEDSII 1488
            N   +N   S+I
Sbjct: 85   NCAKFNGASSVI 96

>YHR169W (DBP8) [2456] chr8 (442180..443475) Essential nucleolar RNA
            helicase required for biogenesis of 40S ribosomal
            subunits [1296 bp, 431 aa]
          Length = 431

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 3/129 (2%)

Query: 1025 LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAG 1084
            +IF   T   +I+   L+ L+++   L       +RT  L+ F A  +     L++T   
Sbjct: 258  IIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAAR---ILIATDVA 314

Query: 1085 GLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAH 1144
              GL++ T + V+ +D   +P   +    R  R G+  +        D S  +AI D+ +
Sbjct: 315  SRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVTQRDVSRIQAIEDRIN 374

Query: 1145 AKLDIDGKV 1153
             K+    KV
Sbjct: 375  KKMTETNKV 383

>Scas_645.10
          Length = 437

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 3/129 (2%)

Query: 1025 LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAG 1084
            +IF   T   +I+   L +L+++   L       +RT  L+ F A   +    L++T   
Sbjct: 263  IIFVNRTMTAEILRRTLYHLEVRVASLHSQMPQQERTNSLHRFRA---NVARVLIATDVA 319

Query: 1085 GLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAH 1144
              GL++ T + VI +D   +P   +    R  R G+  +        D S  EAI  + +
Sbjct: 320  SRGLDIPTVELVINYDIPADPDTFIHRAGRTARAGRSGDAISFVTQRDVSRIEAIEKRIN 379

Query: 1145 AKLDIDGKV 1153
             K+    KV
Sbjct: 380  KKMTESDKV 388

>KLLA0B03113g 282503..284488 similar to sp|P35817 Saccharomyces
            cerevisiae YLR399c BDF1 sporulation protein, hypothetical
            start
          Length = 661

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 1437 PDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELE 1496
            P Y+  +K P     V K ++   Y + ++   D  L+F N   +N E +I+      LE
Sbjct: 316  PTYFDFVKEPMDLGTVQKKLNNWEYQTSEEFEHDVRLVFKNCYAFNPEGTIVNMMGHRLE 375

Query: 1497 DAVIAKW 1503
            D   +KW
Sbjct: 376  DVFNSKW 382

>KLLA0D13552g 1167506..1170655 similar to sp|P40562 Saccharomyces
            cerevisiae YIR002c SJH1 protection of the genome from
            spontaneous and chemically induced damage singleton,
            start by similarity
          Length = 1049

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 6/89 (6%)

Query: 1075 FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDN- 1133
            +  L+ T  G  GL++   D +I FD+  +P +++Q   R  R G+K + RI+ L + N 
Sbjct: 629  YNVLVCTSIGEEGLDIGEVDLIICFDSTSSPIKNIQ---RMGRTGRKRDGRIVLLFSGNE 685

Query: 1134 --SVEEAILDKAHAKLDIDGKVIQAGKFD 1160
                E+A+ D  + +  I    ++  K D
Sbjct: 686  KFKFEQAMNDYENLQTAITHNALEYTKSD 714

>CAGL0J01980g 194209..197367 similar to sp|P40562 Saccharomyces
            cerevisiae YIR002c SJH1, hypothetical start
          Length = 1052

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1072 SDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1131
            S  +  L+ T  G  GL++   D +I +DT  +P +++Q   R  R G+K + RI+ + +
Sbjct: 560  SGLYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQ---RMGRTGRKRDGRIVLMFS 616

Query: 1132 DN 1133
             N
Sbjct: 617  SN 618

>YLR399C (BDF1) [3778] chr12 complement(919536..921596) Protein
            required for sporulation, contains two bromodomain motifs
            and interacts with histones H3 and H4 [2061 bp, 686 aa]
          Length = 686

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 35/80 (43%)

Query: 1429 VKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSII 1488
            V P     P Y+  +K P     + K ++   Y +++    D  L+F N   +N + +I+
Sbjct: 344  VDPVSMNLPTYFDYVKEPMDLGTIAKKLNDWQYQTMEDFERDVRLVFKNCYTFNPDGTIV 403

Query: 1489 FRDSLELEDAVIAKWKEMTN 1508
                  LE+   +KW +  N
Sbjct: 404  NMMGHRLEEVFNSKWADRPN 423

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 1421 RRLSDI--FL--VKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFA 1476
            +RL D   FL  V P K   P Y+  IK P     + + +++  Y+  +Q+ EDF+L+  
Sbjct: 165  KRLKDARPFLQPVDPVKLDIPFYFNYIKRPMDLSTIERKLNVGAYEVPEQITEDFNLMVN 224

Query: 1477 NARIYNTEDSII 1488
            N+  +N  ++ I
Sbjct: 225  NSIKFNGPNAGI 236

>Kwal_23.4179
          Length = 660

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%)

Query: 1437 PDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFANARIYNTEDSIIFRDSLELE 1496
            P Y+  +K P     V + ++   Y++  QV  D  L+F N   +N + +I+      LE
Sbjct: 307  PTYFDYVKQPMDLGTVSRKLNNWEYENADQVEADVRLVFKNCYAFNPDGTIVNMMGHRLE 366

Query: 1497 DAVIAKW 1503
            D   ++W
Sbjct: 367  DIFNSRW 373

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 1421 RRLSDI--FL--VKPSKRLYPDYYLLIKYPAAFENVMKHIDLNVYDSLKQVVEDFHLIFA 1476
            +RL D   FL  V P     P YY  IK P     + + + LN Y   ++V  DF L+  
Sbjct: 121  KRLKDARPFLQPVDPVALNVPLYYNYIKRPMDLGTIERKLALNAYAQPEEVSADFKLMVD 180

Query: 1477 NARIYNTEDSIIFRDSLELE 1496
            N   +N E S I + +  +E
Sbjct: 181  NCVRFNGESSAIAQMARNIE 200

>CAGL0H03377g complement(313755..315377) highly similar to sp|P20447
            Saccharomyces cerevisiae YGL078c DBP3, hypothetical start
          Length = 540

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 41/98 (41%), Gaps = 9/98 (9%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            +VLIF    +    +E  L Y   K   + G      RT  LN F +  S+    LL+T 
Sbjct: 378  KVLIFALYKKEASRVERNLNYNGYKVAAIHGDLSQQQRTQALNEFKSGKSN---LLLATD 434

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
                GL++    TVI      N    L  +D  HRIG+
Sbjct: 435  VAARGLDIPNVKTVI------NLTFPLTVEDYVHRIGR 466

>AER301C [2803] [Homologous to ScYHR169W (DBP8) - SH]
            (1188485..1189792) [1308 bp, 435 aa]
          Length = 435

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 50/124 (40%), Gaps = 3/124 (2%)

Query: 1025 LIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAG 1084
            ++F   T   +I+   L  L+++   L       +RT  L  F A  +     L++T   
Sbjct: 262  IVFVNRTISAEILRRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAAR---VLIATDVA 318

Query: 1085 GLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAH 1144
              GL++     V+ +D   NP   +    R  R G+  E        D S  +AI ++  
Sbjct: 319  SRGLDIPAVQLVVNYDIPANPDTYIHRAGRTARAGRGGEALSFIAPKDVSRIQAIEERIG 378

Query: 1145 AKLD 1148
             K+D
Sbjct: 379  KKMD 382

>CAGL0L03846g join(complement(443151..444414),
            complement(441680..442050)) highly similar to sp|P24783
            Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
            helicase of DEAD box family
          Length = 544

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 9/98 (9%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            ++LIF    +  D +  +LR      L + G     +R  +LN F   NS     +++T 
Sbjct: 359  KILIFASTKRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSP---IMVATD 415

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
                G++++  + V+ +D   N       +D  HRIG+
Sbjct: 416  VAARGIDVKGINFVVNYDMPGN------IEDYVHRIGR 447

>YIR002C (MPH1) [2667] chr9 complement(357412..360393) Protein with a
            possible role in DNA mismatch repair, has similarity to
            ATP-dependent RNA helicases [2982 bp, 993 aa]
          Length = 993

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 1078 LLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDN---S 1134
            L+ T  G  GL++   D +I +DT  +P +++Q   R  R G+K + +I+ L + N    
Sbjct: 571  LVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQ---RMGRTGRKRDGKIVLLFSSNESYK 627

Query: 1135 VEEAILDKAHAKLDIDGKVIQAGKFD 1160
             E A+ D +  +  I  + I   K D
Sbjct: 628  FERAMEDYSTLQALISKQCIDYKKSD 653

>Scas_709.5
          Length = 1046

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 1075 FCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDN 1133
            +  L+ T  G  GL++   D +I +DT  +P +++Q   R  R G+K + +I+ L + N
Sbjct: 569  YNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQ---RMGRTGRKRDGKIVLLFSSN 624

>Kwal_56.24005
          Length = 533

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 1008 ELLERILPKFKATGH---RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALL 1064
            +LLE +L K+++      +VLIF    +    +E  L+Y       + G      RT  L
Sbjct: 354  KLLE-LLKKYQSGARQNDKVLIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQAL 412

Query: 1065 NTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
            N F +  S+    LL+T     GL++    TVI      N    L  +D  HRIG+
Sbjct: 413  NEFKSGASN---LLLATDVAARGLDIPNVKTVI------NLTFPLTVEDYVHRIGR 459

>YGL078C (DBP3) [1904] chr7 complement(360289..361860) ATP-dependent
            RNA helicase CA3, member of the DEAD-box family of RNA
            helicases [1572 bp, 523 aa]
          Length = 523

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 49/119 (41%), Gaps = 12/119 (10%)

Query: 1005 GKFELLERILPKFKA---TGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRT 1061
            GK   L  +L K+ +      +VLIF    +    +E  L+Y       + G      RT
Sbjct: 340  GKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRT 399

Query: 1062 ALLNTFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
              LN F +  S+    LL+T     GL++    TVI      N    L  +D  HRIG+
Sbjct: 400  QALNEFKSGKSN---LLLATDVAARGLDIPNVKTVI------NLTFPLTVEDYVHRIGR 449

>YPR179C (HDA3) [5593] chr16 complement(893791..895758) Protein of
            unknown function, has low similarity to uncharacterized
            C. albicans Orf6.8425p [1968 bp, 655 aa]
          Length = 655

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 78/177 (44%), Gaps = 23/177 (12%)

Query: 976  ICNHPFVFEEVEDQINP----ARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMT 1031
            +  HP++   + D   P     R+    +  ++GKF +L  ++   +       I  +  
Sbjct: 84   VATHPYL---LIDHYMPKSLITRDVPAHLAENSGKFSVLRDLINLVQEYETETAIVCRPG 140

Query: 1032 QVMDIMEDFLRYLDMKYLRLDGHT-----KSDDRTALLNTFNAPNSDYFCFLLSTRAGGL 1086
            + MD++E  L    +   R DGH+     K++D +  ++ F++   ++  + + ++A   
Sbjct: 141  RTMDLLEALLLGNKVHIKRYDGHSIKSKQKANDFSCTVHLFSSEGINFTKYPIKSKA--- 197

Query: 1087 GLNLQTADTVIIFDTDWNPHQ-DLQ--AQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
                   D +I  DT  +  Q D+Q   Q +  R G +    I+RL+  NS++   L
Sbjct: 198  -----RFDMLICLDTTVDTSQKDIQYLLQYKRERKGLERYAPIVRLVAINSIDHCRL 249

>CAGL0L06908g complement(777557..778876) highly similar to sp|Q07478
            Saccharomyces cerevisiae YDL084w SUB2, start by
            similarity
          Length = 439

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1022 HRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDY---FCFL 1078
            ++V+IF + T   + +   L   +   + + GH K ++R A    F     D+    C  
Sbjct: 300  NQVIIFVKSTSRANELTKLLNASNFPAITVHGHMKQEERIARYKAF----KDFEKRIC-- 353

Query: 1079 LSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEA 1138
            +ST   G G++++  +  I +D      Q L    RA R G K    +      N  +E 
Sbjct: 354  VSTDVFGRGIDIERINLAINYDLLNEADQYLHRVGRAGRFGTKG---LAISFVSNKEDEE 410

Query: 1139 ILDKAHAKLDI 1149
            +L K   + D+
Sbjct: 411  VLSKIQERFDV 421

>KLLA0C15499g complement(1345201..1346715) similar to sp|P20447
            Saccharomyces cerevisiae YGL078c DBP3 putative RNA
            helicase required for pre-rRNA processing, start by
            similarity
          Length = 504

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 40/98 (40%), Gaps = 9/98 (9%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            +VLIF    +    +E  L+Y       + G      RT  LN F A   +    LL+T 
Sbjct: 342  KVLIFALYKKEASRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKAGKCN---LLLATD 398

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
                GL++    TVI      N    L  +D  HRIG+
Sbjct: 399  VAARGLDIPNVKTVI------NLTFPLTVEDYVHRIGR 430

>Kwal_56.22974
          Length = 155

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 1020 TGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLL 1079
            T ++ +IF    +V+D +   L   +     + G  K +DR  ++N F +  S     L+
Sbjct: 20   TINQCVIFCNTKKVVDWLSSKLSQANFAVASMHGDMKQEDRDRVMNDFRSGTSR---VLI 76

Query: 1080 STRAGGLGLNLQTADTVIIFD 1100
            ST     G+++Q    VI +D
Sbjct: 77   STDVWARGIDVQQVSLVINYD 97

>Scas_623.5
          Length = 446

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1022 HRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDY---FCFL 1078
            ++V+IF + T   + +   L   +   + + GH K ++R A    F     D+    C  
Sbjct: 307  NQVIIFVKSTNRANELTKLLNDSNFPAITVHGHMKQEERIARYKAF----KDFEKRIC-- 360

Query: 1079 LSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEA 1138
            +ST   G G++++  +  I +D      Q L    RA R G K    +      +  EE 
Sbjct: 361  VSTDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKG---LAISFVSSKEEEE 417

Query: 1139 ILDKAHAKLDI 1149
            +L K   + D+
Sbjct: 418  VLAKIQERFDV 428

>CAGL0G09867g complement(942215..944149) similar to sp|Q06623
            Saccharomyces cerevisiae YPR179c PLO1, start by
            similarity
          Length = 644

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 73/174 (41%), Gaps = 17/174 (9%)

Query: 976  ICNHPFVFEEVEDQINP----ARETNDTIWRSAGKFELLERILPKFKATGHRVLIFFQMT 1031
            +  HPF+     D + P     R+    +  ++GKF+++  ++   +       I  +  
Sbjct: 84   VATHPFLLI---DHMMPKSLGTRDIPGHLAENSGKFQVIRDLINLIQEYETNTAIVCRPG 140

Query: 1032 QVMDIMEDFLRYLDMKYLRLDGHT-----KSDDRTALLNTFNAPNSDYFCFLLSTRAGGL 1086
            + MD++E  L    +   R DG +     KS + +   + F +   D   F L T  G  
Sbjct: 141  RTMDLVEALLYGHKVNIRRYDGQSIKQNKKSRNHSCTCHIFPSAGWDKSKFPLKT--GNQ 198

Query: 1087 GLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAIL 1140
               L   D  I  DT     + +   +R  R  +K +  I++LIT NSVE  +L
Sbjct: 199  FDMLLAVD--ISVDTTTEEMKSILRHERDQRTLEK-QAPIVKLITINSVEHGML 249

>Scas_568.11
          Length = 739

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 1024 VLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRA 1083
             ++ F   +++D+  +     DMK   + G    + R    N FN+  +D    L+++ A
Sbjct: 405  CIVAFSKKKILDLKLEIEAKTDMKVAVIYGSLPPETRVQQANLFNSGEAD---ILVASDA 461

Query: 1084 GGLGLNLQTADTVIIFDTD 1102
             G+GLNL      IIF TD
Sbjct: 462  IGMGLNLSIDR--IIFSTD 478

>CAGL0M02717g 309656..310444 some similarities with tr|Q18401
           Saccharomyces cerevisiae YPL130w SPO19, hypothetical
           start
          Length = 262

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 854 LLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLK 913
           L +FV+ + F +  S DE          G D I    ++  LVIR   +   P L+  L 
Sbjct: 12  LASFVVAEQFRAFLSTDEI---------GSDSIQRGTDDNPLVIRIDKQSYSPELIDTLT 62

Query: 914 KDVE---KDLPDKVEKVLKCKMSALQHKLYQQMLKHR 947
           K       DLPD  E +   K+S + +++ Q   KH+
Sbjct: 63  KSTNIIFADLPDVPEFIKADKISDVDYQVVQNTWKHK 99

>AFL080W [3113] [Homologous to ScYGL078C (DBP3) - SH]
            complement(288205..289812) [1608 bp, 535 aa]
          Length = 535

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 41/98 (41%), Gaps = 9/98 (9%)

Query: 1023 RVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTR 1082
            +VLIF    +    +E  L+Y       + G      RT  L+ F A  ++    LL+T 
Sbjct: 373  KVLIFALYKKEASRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKAGTAN---LLLATD 429

Query: 1083 AGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
                GL++    TVI      N    L  +D  HRIG+
Sbjct: 430  VAARGLDIPNVKTVI------NLTFPLTVEDYVHRIGR 461

>Scas_700.23
          Length = 640

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 9/97 (9%)

Query: 1024 VLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRA 1083
             LIF +  ++ D + DFL   + K   + G     +R   L+ F A  +     L++T  
Sbjct: 429  TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTA---TILVATAV 485

Query: 1084 GGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
               GL++     VI FD   +        D  HRIG+
Sbjct: 486  AARGLDIPNVTHVINFDLPGD------IDDYVHRIGR 516

>YDL084W (SUB2) [784] chr4 (305237..306577) Essential pre-mRNA
            splicing factor, required for nuclear export of mRNA and
            for expression of lacZ fusions in yeast, involved in
            silencing at telomeres and ribosomal DNA, member of the
            DexD/H box family of RNA-dependent ATPases [1341 bp, 446
            aa]
          Length = 446

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 1022 HRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDY---FCFL 1078
            ++V+IF + T   + +   L   +   + + GH K ++R A    F     D+    C  
Sbjct: 307  NQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAF----KDFEKRIC-- 360

Query: 1079 LSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEA 1138
            +ST   G G++++  +  I +D      Q L    RA R G K    +      +  +E 
Sbjct: 361  VSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKG---LAISFVSSKEDEE 417

Query: 1139 ILDKAHAKLDI 1149
            +L K   + D+
Sbjct: 418  VLAKIQERFDV 428

>KLLA0E22033g 1959770..1961083 highly similar to sp|Q07478
            Saccharomyces cerevisiae YDL084w SUB2 probably involved
            in pre-mRNA splicing, start by similarity
          Length = 437

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 1022 HRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLST 1081
            ++V+IF + T   + +   L   +   + + GH K ++R A    F        C  +ST
Sbjct: 298  NQVIIFVKSTVRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKEFEK-RIC--VST 354

Query: 1082 RAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILD 1141
               G G++++  +  I +D      Q L    RA R G K     + +I+    +E +L 
Sbjct: 355  DVFGRGIDIERINLAINYDMPNEADQYLHRVGRAGRFGTKGLA--ISMISSED-DEQVLA 411

Query: 1142 KAHAKLDI 1149
            K   + D+
Sbjct: 412  KIQERFDV 419

>Scas_661.12
          Length = 399

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 5/117 (4%)

Query: 1006 KFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLN 1065
            KF+ L  I      T  + +IF    + +D +   L   +   + + G  K ++R  ++N
Sbjct: 252  KFDTLCDIYDSLTIT--QCVIFCNTKKKVDWLSAKLTQSNFAVVSMHGDMKQEERDKVMN 309

Query: 1066 TFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKN 1122
             F   +S     L+ST     G+++Q    VI +D   N    +    R+ R G+K 
Sbjct: 310  DFRTGHSR---VLISTDVWARGIDVQQVSLVINYDLPENMENYIHRIGRSGRFGRKG 363

>CAGL0M02035g 245848..250293 similar to sp|P14284 Saccharomyces
            cerevisiae YPL167c REV3, hypothetical start
          Length = 1481

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 99/234 (42%), Gaps = 34/234 (14%)

Query: 783  FDVVLTTFEYIIKERPLLSKIKWVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGT 842
            + V  T F  I    P LS+   V  II E + ++N Q       N  Y S +  +L  T
Sbjct: 150  YHVGWTPFYKISLLNPSLSE--QVCNIIREQNVLQNGQ-------NEVYESQFPYLLKFT 200

Query: 843  PLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHK 902
               N     W  +NF   K++      +E  N         D+I +++E  +L+ R   K
Sbjct: 201  ADFNLFACSW--INF--KKVYFRAPVLNEMLN--------MDEIMMTKELRVLLDRFHSK 248

Query: 903  --VLRPFLLRRLKKDV-EKD-LPDKVEKVLKCKMSALQHKLYQQMLKHRRLFIFDDSSNQ 958
              VL+  +  R+   + E D +P  ++ + + K+  + H L +   K   +   DD    
Sbjct: 249  DTVLKKTMFPRIGNGLLEIDVIPQFIKNIDQIKIRNIHHDLSE---KKESVNYLDDGP-- 303

Query: 959  KFSSSRGFNNQIMQLRKICNHPFVFEEVEDQINPARETNDTIWRSAGKFELLER 1012
              SS++     +   RK+    +  EE +   + +R  ND IW S+ +FE+  R
Sbjct: 304  YVSSTKNMLKDVEIQRKL----YSLEEYKKAADISRNENDMIWNSSHQFEMFLR 353

>YPL119C (DBP1) [5326] chr16 complement(324410..326263) ATP-dependent
            RNA helicase of the DEAD box family, multicopy suppressor
            of spp81/ded1 mutations [1854 bp, 617 aa]
          Length = 617

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 9/97 (9%)

Query: 1024 VLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRA 1083
             LIF +  ++ D + DFL   + K   + G     +R   L+ F A  +D    L++T  
Sbjct: 414  TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVAD---ILVATAV 470

Query: 1084 GGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQ 1120
               GL++     VI +D       D+   D  HRIG+
Sbjct: 471  AARGLDIPNVTHVINYDLP----SDI--DDYVHRIGR 501

>ADR260C [2001] [Homologous to ScYDL084W (SUB2) - SH]
            (1152259..1153575) [1317 bp, 438 aa]
          Length = 438

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 1022 HRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLST 1081
            ++V+IF + T   + +   L   +   + + GH + ++R A    F        C  +ST
Sbjct: 299  NQVIIFVKSTLRANELTKLLNASNFPAITVHGHMRQEERIARYKAFKEFEK-RIC--VST 355

Query: 1082 RAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILD 1141
               G G++++  +  I +D      Q L    RA R G K     + L++    EE +L 
Sbjct: 356  DVFGRGIDIERINLAINYDMPSEADQYLHRVGRAGRFGTKGLA--ISLVSSKDDEE-VLA 412

Query: 1142 KAHAKLDI 1149
            K   + D+
Sbjct: 413  KIQERFDV 420

>CAGL0M06567g complement(679126..680325) highly similar to sp|Q12099
            Saccharomyces cerevisiae YDR021w FAL1 involved in
            maturation of 18S rRNA, start by similarity
          Length = 399

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 5/117 (4%)

Query: 1006 KFELLERILPKFKATGHRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLN 1065
            KF+ L  I      T  + +IF    + +D +   L+  +   + + G  K D+R  ++N
Sbjct: 252  KFDTLCDIYDSLTIT--QCVIFCNSKKKVDWLAHKLKQSNFAVISMHGDMKQDERDRVMN 309

Query: 1066 TFNAPNSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKN 1122
             F    S     L+ST     G+++Q    VI +D        +    R+ R G+K 
Sbjct: 310  EFRTGQSR---VLISTDVWARGIDVQQVSLVINYDLPEITENYVHRIGRSGRFGRKG 363

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 43,545,519
Number of extensions: 1837442
Number of successful extensions: 7970
Number of sequences better than 10.0: 241
Number of HSP's gapped: 7764
Number of HSP's successfully gapped: 360
Length of query: 1510
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1395
Effective length of database: 12,615,039
Effective search space: 17597979405
Effective search space used: 17597979405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)