Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08305g73572325360.0
AFR563C5762909211e-115
Kwal_26.91765512818751e-109
YMR227C (TAF7)5902458411e-103
Scas_594.66553127983e-96
CAGL0M11264g5492447737e-94
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08305g
         (723 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08305g 737967..740174 some similarities with sp|Q05021 Sac...   981   0.0  
AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH] (1444641.....   359   e-115
Kwal_26.9176                                                          341   e-109
YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component...   328   e-103
Scas_594.6                                                            311   3e-96
CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021 S...   302   7e-94

>KLLA0B08305g 737967..740174 some similarities with sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67 TFIID subunit
           (TBP-associated factor), 67 kD singleton, hypothetical
           start
          Length = 735

 Score =  981 bits (2536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/723 (71%), Positives = 516/723 (71%)

Query: 1   MVDPIGVTHTTRGLSKDSKHSVLVQYPTMGPIIRINKPKEPESGGGTEXXXXXXXXXXXX 60
           MVDPIGVTHTTRGLSKDSKHSVLVQYPTMGPIIRINKPKEPESGGGTE            
Sbjct: 1   MVDPIGVTHTTRGLSKDSKHSVLVQYPTMGPIIRINKPKEPESGGGTEPKLKKIKLKTGG 60

Query: 61  XXXXXXXXXXXXXXXXXXXXRDNQEDKDISNNNNVGTSKGSSRPMKLKINLKKREDSHPQ 120
                               RDNQEDKDISNNNNVGTSKGSSRPMKLKINLKKREDSHPQ
Sbjct: 61  SSSSSNNSKPAPKLKIKLKKRDNQEDKDISNNNNVGTSKGSSRPMKLKINLKKREDSHPQ 120

Query: 121 LVPXXXXXXXXXXRKSTSVVKTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLP 180
           LVP          RKSTSVVKTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLP
Sbjct: 121 LVPHSQSHQQQQQRKSTSVVKTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLP 180

Query: 181 DLSAEFVKNSIESGDYSDVSIKWKGERHAVVKVNGVQYGAVLVNLPSIIEVNKSVDRKNL 240
           DLSAEFVKNSIESGDYSDVSIKWKGERHAVVKVNGVQYGAVLVNLPSIIEVNKSVDRKNL
Sbjct: 181 DLSAEFVKNSIESGDYSDVSIKWKGERHAVVKVNGVQYGAVLVNLPSIIEVNKSVDRKNL 240

Query: 241 LKTFDVSQMLICVRTVNKEEEVFSLQVSDTEDLTKKHFEEYQKEITEQRKQQLRGYNGGP 300
           LKTFDVSQMLICVRTVNKEEEVFSLQVSDTEDLTKKHFEEYQKEITEQRKQQLRGYNGGP
Sbjct: 241 LKTFDVSQMLICVRTVNKEEEVFSLQVSDTEDLTKKHFEEYQKEITEQRKQQLRGYNGGP 300

Query: 301 LTDAESKNIEQIINKRYDYKHGITPPLYNARNRRFRHRMGPTAFDYVERTVXXXXXXXXX 360
           LTDAESKNIEQIINKRYDYKHGITPPLYNARNRRFRHRMGPTAFDYVERTV         
Sbjct: 301 LTDAESKNIEQIINKRYDYKHGITPPLYNARNRRFRHRMGPTAFDYVERTVEKLLKLDAE 360

Query: 361 XXXFGYELVNEDAIQQQRSTSAADLAHYQKAGEHMDETSSVGYSQEIKPHHVTGXXXXXX 420
              FGYELVNEDAIQQQRSTSAADLAHYQKAGEHMDETSSVGYSQEIKPHHVTG      
Sbjct: 361 AEEFGYELVNEDAIQQQRSTSAADLAHYQKAGEHMDETSSVGYSQEIKPHHVTGAAEEDE 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXGSIPASMVNGPAGAAMSTDTGSVVRPGQLLEETGDDVE 480
                                 GSIPASMVNGPAGAAMSTDTGSVVRPGQLLEETGDDVE
Sbjct: 421 EEDHEEDLELELEQALQTETTDGSIPASMVNGPAGAAMSTDTGSVVRPGQLLEETGDDVE 480

Query: 481 QDNGXXXXXXXXXXXXXXXXXXXXXXXXXXNGADGLSGSVTTGTTKSRVSDNDGANXXXX 540
           QDNG                          NGADGLSGSVTTGTTKSRVSDNDGAN    
Sbjct: 481 QDNGDDEDEEEEDEEEEEEEEEDEEEEDEENGADGLSGSVTTGTTKSRVSDNDGANEEEQ 540

Query: 541 XXXXXXXXXXXXXXXXXXXXNKASRTTNPLLKTRFXXXXXXXXXXXXXXXXXXGEPVVVD 600
                               NKASRTTNPLLKTRF                  GEPVVVD
Sbjct: 541 HRELLLDELRELESTLELNRNKASRTTNPLLKTRFLESIKKLEKEVELKRKQLGEPVVVD 600

Query: 601 DAGNVQTAQDISENVPDTEAGAVSNKAAIRNXXXXXXXXXXXXXASIPNNATITNGVENI 660
           DAGNVQTAQDISENVPDTEAGAVSNKAAIRN             ASIPNNATITNGVENI
Sbjct: 601 DAGNVQTAQDISENVPDTEAGAVSNKAAIRNGSVSSGGSGVTGSASIPNNATITNGVENI 660

Query: 661 GTEGNLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARQGTEELD 720
           GTEGNLY                                            ARQGTEELD
Sbjct: 661 GTEGNLYEEEDELEEEEEEEEEEEEGEEEEEEEEEEQEEQRPDEEPQQGQEARQGTEELD 720

Query: 721 QDD 723
           QDD
Sbjct: 721 QDD 723

>AFR563C [3755] [Homologous to ScYMR227C (TAF67) - SH]
           (1444641..1446371) [1731 bp, 576 aa]
          Length = 576

 Score =  359 bits (921), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 184/290 (63%), Positives = 222/290 (76%), Gaps = 16/290 (5%)

Query: 104 PMKLKINLKKREDSHPQLVPXXXXXXXXXXRKSTSVVKTPKFRIKPVRVPGEGYDSEASD 163
           P+KLK+NLKK  D+ P  VP            ++++ K P+ R+KP R+PGEGYDSEASD
Sbjct: 72  PVKLKLNLKK--DTPPTSVP------------ASALTKAPRIRVKPPRIPGEGYDSEASD 117

Query: 164 VEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSDVSIKWKGERHAVVKVNGVQYGAVLV 223
           +EDDPL+EEGIILRVLPDL AEFVKNSIESGDYS++SIKWKGERHAVV +NG QYGAVLV
Sbjct: 118 IEDDPLMEEGIILRVLPDLQAEFVKNSIESGDYSNISIKWKGERHAVVSINGHQYGAVLV 177

Query: 224 NLPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNKEEEVFSLQVSDTEDLTKKHFEEYQK 283
           NLP++IEVNKSVDRKN+LK FDVSQML+CV  +++EE+VF LQ  DTEDL KKHFE Y+K
Sbjct: 178 NLPTVIEVNKSVDRKNMLKAFDVSQMLLCVALISREEDVFDLQPPDTEDLVKKHFENYEK 237

Query: 284 EITEQRKQQLRGYNGGPLTDAESKNIEQIINKRYDYKHGITPPLYNARNRRFRHRMGPTA 343
           EI + RK  ++G+ GG LTDAESK+++ I+ K YDYKHGIT PLYN RNRRFR RM  + 
Sbjct: 238 EICDARKIMIQGFQGGSLTDAESKHMDAILEKGYDYKHGITAPLYNVRNRRFRRRMTGSE 297

Query: 344 FDYVERTVXXXXXXXXXXXXFGYELVNEDAIQQQRSTSAADLAHY-QKAG 392
            DYV+RTV            F YELV+EDA+  Q+S S  DLAH+ QKA 
Sbjct: 298 IDYVDRTVEFLLKQDGEAEEFTYELVDEDAV-LQKSASTIDLAHFAQKAA 346

>Kwal_26.9176
          Length = 551

 Score =  341 bits (875), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 176/281 (62%), Positives = 209/281 (74%), Gaps = 16/281 (5%)

Query: 105 MKLKINLKKREDSHPQLVPXXXXXXXXXXRKSTSVVKTPKFRIKPVRVPGEGYDSEASDV 164
           +KLKINL  +E S                  +++  K P+FRIKPVRVPGEGYDSEASD+
Sbjct: 62  IKLKINLGSKETS---------------SSTASAPPKAPRFRIKPVRVPGEGYDSEASDI 106

Query: 165 EDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSDVSIKWKGERHAVVKVNGVQYGAVLVN 224
           EDDPLIEEG+ILRVLPD+  EFVKN IESGD+S +S+KWKGERHAVVK+NG QYGAVLVN
Sbjct: 107 EDDPLIEEGVILRVLPDVQTEFVKNCIESGDFSGLSLKWKGERHAVVKINGYQYGAVLVN 166

Query: 225 LPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNKEEEVFSLQVSDTEDLTKKHFEEYQKE 284
           LP+ IEVNKS+DRKNLLKTFDVSQML+CVRT++ EEEVFSL   D+EDL  KH++EY+ E
Sbjct: 167 LPTTIEVNKSIDRKNLLKTFDVSQMLLCVRTIDHEEEVFSLVPPDSEDLVTKHYDEYKNE 226

Query: 285 ITEQRKQQLRGYNGGPLTDAESKNIEQIINKRYDYKHGITPPLYNARNRRFRHRMGPTAF 344
           I E +K   RG+NGGPLTDAE+ NI+ I+ K YDYKHG+TPPLYN RNRRFR R+     
Sbjct: 227 IIECKKTLYRGFNGGPLTDAEANNIDNIVKKGYDYKHGLTPPLYNVRNRRFRRRLTTQEV 286

Query: 345 DYVERTVXXXXXXXXXXXXFGYELVNEDAIQQQRSTSAADL 385
           DYVE+TV              Y+LV+ED I  QRS SA +L
Sbjct: 287 DYVEKTVEHLLEQDAEAEGVSYDLVDED-ILAQRSASADEL 326

>YMR227C (TAF7) [4183] chr13 complement(722612..724384) Component of
           the TAF(II) complex (TBP-associated factor), required
           for activated transcription by RNA polymerase II [1773
           bp, 590 aa]
          Length = 590

 Score =  328 bits (841), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 189/245 (77%), Gaps = 2/245 (0%)

Query: 139 VVKTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSD 198
           + K PK R+KP+R+PGE YDSEASD+EDDPLIE G+ILR+LPD+  EFVKNS+ESGDYS 
Sbjct: 81  IHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRILPDIQLEFVKNSLESGDYSG 140

Query: 199 VSIKWKGERHAVVKVNGVQYGAVLVNLPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNK 258
           +SIKWK ERHAVV +N V YGA+LV+LP++IEVNKSVDRKNLLKTFDVSQML+C+R + +
Sbjct: 141 ISIKWKNERHAVVTINDVMYGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLLCIRPIQE 200

Query: 259 EEEVFSLQVSDTEDLTKKHFEEYQKEITEQRKQQLRGYNGGPLTDAESKNIEQIINKRYD 318
           EEEV++L+  DTEDL  KHFE  + EI E ++  L+GYNG PL+D E+K++++I  K YD
Sbjct: 201 EEEVYALEAPDTEDLVVKHFEGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIALKGYD 260

Query: 319 YKHGITPPLYNARNRRFRHRMGPTAFDYVERTVXXXXXXXXXXXXFGYELVNEDAIQ--Q 376
           YKHGI+PPLYN RNRRFR +M P   DYVE+ V              Y+LV++  +Q  Q
Sbjct: 261 YKHGISPPLYNVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSELQARQ 320

Query: 377 QRSTS 381
           +R +S
Sbjct: 321 ERVSS 325

>Scas_594.6
          Length = 655

 Score =  311 bits (798), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 212/312 (67%), Gaps = 8/312 (2%)

Query: 106 KLKINLKKREDSHPQL-VPXXXXXXXXXXRKSTS-------VVKTPKFRIKPVRVPGEGY 157
           KLKI+LKKR+ + P +  P          RK ++       V K P+ R+KP+R+PGEGY
Sbjct: 70  KLKISLKKRKVTDPLMDKPVGGPLKLKLHRKPSASPIVEKKVHKAPRLRLKPIRIPGEGY 129

Query: 158 DSEASDVEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSDVSIKWKGERHAVVKVNGVQ 217
           DSEASD+EDDPLIE GIILRVLPD+  EFVKNSIESGDYS +++KW G RHAVV +NG  
Sbjct: 130 DSEASDIEDDPLIESGIILRVLPDIQVEFVKNSIESGDYSGLTVKWLGHRHAVVNINGNM 189

Query: 218 YGAVLVNLPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNKEEEVFSLQVSDTEDLTKKH 277
           YGA+LV+LP++IEVNKSVDRKNLLKTFDVSQMLIC++T+ KE+EVF+L+  ++EDL  KH
Sbjct: 190 YGAILVDLPTVIEVNKSVDRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAPNSEDLVTKH 249

Query: 278 FEEYQKEITEQRKQQLRGYNGGPLTDAESKNIEQIINKRYDYKHGITPPLYNARNRRFRH 337
           + + ++EI   +K  ++  N   L++ E + +++I  K YDYKHG++PPLYN RNRRFR 
Sbjct: 250 YSDIEEEILGNKKVLMKEQNTDLLSELEKQYLDEIATKGYDYKHGLSPPLYNVRNRRFRR 309

Query: 338 RMGPTAFDYVERTVXXXXXXXXXXXXFGYELVNEDAIQQQRSTSAADLAHYQKAGEHMDE 397
           +MGP+ F+Y E  V              YELV+E  +  + +++      Y K  +  + 
Sbjct: 310 KMGPSEFEYAEEVVETLLRQDEKAENVTYELVDESEMLGRSNSTPIISEDYFKDADVQEP 369

Query: 398 TSSVGYSQEIKP 409
           ++++  +  I P
Sbjct: 370 SAAIESTVPILP 381

>CAGL0M11264g complement(1106912..1108561) similar to sp|Q05021
           Saccharomyces cerevisiae YMR227c TAF67, start by
           similarity
          Length = 549

 Score =  302 bits (773), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 183/244 (75%), Gaps = 1/244 (0%)

Query: 141 KTPKFRIKPVRVPGEGYDSEASDVEDDPLIEEGIILRVLPDLSAEFVKNSIESGDYSDVS 200
           +TP+ R+KP+R+PGEGYDSEASD+EDDPLIE GIILRVLPD+  +F+KNSIESGDY+ +S
Sbjct: 72  RTPRLRLKPIRIPGEGYDSEASDLEDDPLIESGIILRVLPDVQVDFIKNSIESGDYTGIS 131

Query: 201 IKWKGERHAVVKVNGVQYGAVLVNLPSIIEVNKSVDRKNLLKTFDVSQMLICVRTVNKEE 260
           IKWKGERHA++K+N V YGA+LV+LP+IIEVNKSVDRKNL KTFDV+QML+CV+ +  E+
Sbjct: 132 IKWKGERHAILKLNNVTYGAILVDLPTIIEVNKSVDRKNLFKTFDVTQMLVCVKPITSED 191

Query: 261 EVFSLQVSDTEDLTKKHFEEYQKEITEQRKQQLRGYNGGPL-TDAESKNIEQIINKRYDY 319
           E+F+L+  +TEDL  KH+EEY  EI + + +  +  N   L ++ E+KN+E++  K+Y Y
Sbjct: 192 ELFTLEAPETEDLISKHYEEYLDEINDHKVKLFKNANHVNLHSETEAKNLEKLALKKYHY 251

Query: 320 KHGITPPLYNARNRRFRHRMGPTAFDYVERTVXXXXXXXXXXXXFGYELVNEDAIQQQRS 379
           KHG+TPPLYN RNRRFR +M    F+Y E+ V              ++L+    + ++ S
Sbjct: 252 KHGLTPPLYNVRNRRFRRQMHADEFEYAEKIVDMLLKADAQAEDVKFDLIAPSDVPEKGS 311

Query: 380 TSAA 383
            SAA
Sbjct: 312 VSAA 315

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.129    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,250,015
Number of extensions: 598095
Number of successful extensions: 1723
Number of sequences better than 10.0: 10
Number of HSP's gapped: 1752
Number of HSP's successfully gapped: 11
Length of query: 723
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 614
Effective length of database: 12,822,747
Effective search space: 7873166658
Effective search space used: 7873166658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)