Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08283g33533017390.0
AFR564W3343297721e-101
Sklu_2383.23383216801e-87
Scas_594.53433246629e-85
Kwal_26.91803413216429e-82
YMR228W (MTF1)3413216411e-81
CAGL0M11286g3383325862e-73
YPL213W (LEA1)23884810.031
Scas_481.1*32771700.89
YBR138C52486672.4
YKR101W (SIR1)678116645.7
CAGL0K04521g31772635.7
Sklu_2319.269789636.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08283g
         (330 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08283g complement(736483..737490) gi|3024184|sp|P87250|MTF...   674   0.0  
AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH] complement(...   301   e-101
Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement        266   1e-87
Scas_594.5                                                            259   9e-85
Kwal_26.9180                                                          251   9e-82
YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA p...   251   1e-81
CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces...   230   2e-73
YPL213W (LEA1) [5236] chr16 (150613..151329) Component of the U2...    36   0.031
Scas_481.1*                                                            32   0.89 
YBR138C (YBR138C) [324] chr2 complement(513718..515292) Protein ...    30   2.4  
YKR101W (SIR1) [3352] chr11 (640104..642140) Protein involved in...    29   5.7  
CAGL0K04521g complement(429864..430817) some similarities with s...    29   5.7  
Sklu_2319.2 YOL141W, Contig c2319 3182-5275 reverse complement         29   6.5  

>KLLA0B08283g complement(736483..737490)
           gi|3024184|sp|P87250|MTF1_KLULA Kluyveromyces lactis
           MITOCHONDRIAL REPLICATION PROTEIN MTF1 (MITOCHONDRIAL
           TRANSCRIPTION FACTOR MTTFB), start by similarity
          Length = 335

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/330 (100%), Positives = 330/330 (100%)

Query: 1   MTKSSFLKSVLPLANKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPL 60
           MTKSSFLKSVLPLANKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPL
Sbjct: 1   MTKSSFLKSVLPLANKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPL 60

Query: 61  IQSVILNERLKPKKHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRV 120
           IQSVILNERLKPKKHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRV
Sbjct: 61  IQSVILNERLKPKKHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRV 120

Query: 121 LTPSMQKRDHIHNEFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTA 180
           LTPSMQKRDHIHNEFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTA
Sbjct: 121 LTPSMQKRDHIHNEFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTA 180

Query: 181 RKLFAPFSNKDRNRLTLLSELATNTKLVATSENSVKKFLPDCIEKFDPVIIPSDNKSPDD 240
           RKLFAPFSNKDRNRLTLLSELATNTKLVATSENSVKKFLPDCIEKFDPVIIPSDNKSPDD
Sbjct: 181 RKLFAPFSNKDRNRLTLLSELATNTKLVATSENSVKKFLPDCIEKFDPVIIPSDNKSPDD 240

Query: 241 LSLVEINPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRLDPVLLKKK 300
           LSLVEINPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRLDPVLLKKK
Sbjct: 241 LSLVEINPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRLDPVLLKKK 300

Query: 301 PYELTYLEIDEIAKVFALWPFKPSLLVDFY 330
           PYELTYLEIDEIAKVFALWPFKPSLLVDFY
Sbjct: 301 PYELTYLEIDEIAKVFALWPFKPSLLVDFY 330

>AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH]
           complement(1446758..1447762) [1005 bp, 334 aa]
          Length = 334

 Score =  301 bits (772), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 141/329 (42%), Positives = 227/329 (68%), Gaps = 8/329 (2%)

Query: 2   TKSSFLKSVLPLANKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPLI 61
           +K SFL++ L     +  SYG     +P  I     +LNL+ +Y    +Q+L++Y G  +
Sbjct: 8   SKQSFLEACL----AVKFSYGRTLLHSPTAIELAYKRLNLQEHYDMSKVQVLELYPGTGL 63

Query: 62  QSVILNERLKPKKHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVL 121
            S I ++  KPK  VL+E +  + ++ +  L    ++  + ++PY WE+F+ + +E +++
Sbjct: 64  PSYIFHDIYKPKLQVLMESKPAYAKVIEQHLTLLDNIKLHKEDPYMWESFVSLIDEKKIM 123

Query: 122 TPSMQKRDHIHNEFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTAR 181
            P +Q RDHIH+ F++  NLT+K+GEQLY+QYLQCIAN+NWMQRFGLV+ML W+PQ TA 
Sbjct: 124 QPEVQTRDHIHDSFIVMGNLTDKRGEQLYMQYLQCIANKNWMQRFGLVRMLFWVPQTTAI 183

Query: 182 KLFAPFSNKDRNRLTLLSELATNTKLVATSENSVKKFLPDCIEKFDPVIIPSDNKSPDDL 241
           KL +P   K R+R ++++E  T+T+L+AT+ +++  F P  ++K DP+I+P +NK+  D 
Sbjct: 184 KLLSPCGFKSRSRCSVITEAVTDTRLIATTPDNLASFGPGVLDKHDPLILP-ENKT--DY 240

Query: 242 SLVEINPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRLDPVLLKKKP 301
           +L+E+ P +H++ L++WD+  Q+L++ KS P+E+++E+LGHGA D+   R+DP LLKKKP
Sbjct: 241 ALLEVLPLNHNMKLEYWDYCMQRLLVCKSTPLEDILEVLGHGASDFLKCRIDPELLKKKP 300

Query: 302 YELTYLEIDEIAKVFALWPFKPSLLVDFY 330
            +LT  E  +IA ++ALWPFKPS + DFY
Sbjct: 301 MQLTNQEFTKIASLYALWPFKPS-IYDFY 328

>Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement
          Length = 338

 Score =  266 bits (680), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 205/321 (63%), Gaps = 6/321 (1%)

Query: 14  ANKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPLIQSVILNERLKPK 73
           A KI   YG ++  N  V  QI +KL L+S YK + L++LD+Y GP   S I      PK
Sbjct: 11  ATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHSAIFRNIFNPK 70

Query: 74  KHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHN 133
           ++VL++ R  FV+  Q       SM  Y ++PY+W ++ +M  +++   P+ Q RD IHN
Sbjct: 71  QYVLMDSRPDFVKFIQDNFAG-TSMELYQRDPYEWSSYTDMIEKEKRFVPNRQSRDKIHN 129

Query: 134 EFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLFAPFSNKDRN 193
           +FL+ ANLT   GE L++Q+L CI N+NW+QRFG VKMLVW+P+ TA K+ A   +  R 
Sbjct: 130 QFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKVLARPGSLIRA 189

Query: 194 RLTLLSELATNTKLVATSENS-VKKFLPDCIEKFDPVIIPSDN---KSPDDLSLVEINPR 249
           + ++++E  T+TKLVATS++S ++KF    +E+ DP+I  + +    S   +SL+E+NP 
Sbjct: 190 KCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKPISLLEVNPI 249

Query: 250 DHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRL-DPVLLKKKPYELTYLE 308
           DH IDLD+WD+VT+ L+ILKS P+   I+ LGHG + +F  ++ D +L+ K P +LT  E
Sbjct: 250 DHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLLMDKCPKDLTNKE 309

Query: 309 IDEIAKVFALWPFKPSLLVDF 329
              +  +F  WPFKP + +DF
Sbjct: 310 FVYLTSIFNNWPFKPDIYMDF 330

>Scas_594.5
          Length = 343

 Score =  259 bits (662), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 127/324 (39%), Positives = 208/324 (64%), Gaps = 11/324 (3%)

Query: 15  NKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPLIQSVILNERLKPKK 74
           +KI   YGSQ+  NPKV ++I  KL+ + Y  S +L++LD+Y GP +QS +   + +PK+
Sbjct: 12  SKITQRYGSQYLINPKVFDKIFKKLDFKEY--SSTLKVLDMYPGPCVQSTMFYNKYQPKQ 69

Query: 75  HVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHNE 134
           +VL+E R +FV+L ++       +    ++PY WE+F+E+  ++++L P  Q   HIHN 
Sbjct: 70  YVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVPEKQPLTHIHNS 129

Query: 135 FLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLFAPFSNKDRNR 194
           FL+  N+TN+  E L +Q+  CI N+NW+QRFG V+ML+W+P  TA KL A   +K R++
Sbjct: 130 FLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKLMAEPKSKLRSK 189

Query: 195 LTLLSELATNTKLVATSE-NSVKKFLPDCIEKFDPVIIPSDN-------KSPDDLSLVEI 246
            +++ E  T+T+L+A S    +KKF    +++ +P++   D+        S   ++L+EI
Sbjct: 190 ASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGVSSATSIALLEI 249

Query: 247 NPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRL-DPVLLKKKPYELT 305
           NP++H +DL++WD+VT+ LMILK   + + +E LGHGA+D+F  ++ D   L K P E+T
Sbjct: 250 NPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDSTYLNKTPGEMT 309

Query: 306 YLEIDEIAKVFALWPFKPSLLVDF 329
             +   + K+FA WPFKP + +DF
Sbjct: 310 NDDFIYLTKIFANWPFKPDIYMDF 333

>Kwal_26.9180
          Length = 341

 Score =  251 bits (642), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 207/321 (64%), Gaps = 7/321 (2%)

Query: 16  KIHTSYGSQFEKNPKVINQILDKLNL-ESYYKSESLQILDIYAGPLIQSVILNERLKPKK 74
           KI   YG ++  N  V  +I  KL L ++Y     L++LD+Y GP   SV+LN  LKP +
Sbjct: 13  KIQHYYGFRYLLNKAVHEKIFSKLKLKDTYSDVNKLKVLDLYPGPAQHSVVLNNYLKPSQ 72

Query: 75  HVLLEDRLKFVELYQA-TLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHN 133
           HVL++ R  FV+  +A +L+ + ++  YN++PY W+++  M  ++++  P+ Q +D IH 
Sbjct: 73  HVLMDARPDFVKHIRALSLESNGNLQLYNRDPYDWQSYTNMIEKEKLFVPTKQPQDAIHK 132

Query: 134 EFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLFAPFSNKDRN 193
           EFL+ ANLT   GE L++Q+L CI N+NW+QRFG VKMLVW+ + TA KL A      R+
Sbjct: 133 EFLVMANLTGMIGEGLFMQWLACIGNKNWLQRFGRVKMLVWVQESTALKLLARPGEHLRS 192

Query: 194 RLTLLSELATNTKLVATSEN-SVKKFLPDCIEKFDPVIIPSDN---KSPDDLSLVEINPR 249
           + ++++E  T+TKLVAT ++ ++ KF    +   +P++ PS +    S   +SL+E+NP 
Sbjct: 193 KCSVVAEAFTDTKLVATMDSKNISKFSTSVLSTHEPIVFPSQDVWAPSGKPISLLEVNPL 252

Query: 250 DHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRL-DPVLLKKKPYELTYLE 308
           DH IDLD++D+ T+ L+ILKS P+ E ++ LGHG +++F   + D  LL++ P +LT  E
Sbjct: 253 DHIIDLDNFDYATKHLLILKSTPLSESLDSLGHGGKEYFRRVIRDKNLLQRCPKDLTCRE 312

Query: 309 IDEIAKVFALWPFKPSLLVDF 329
             EI  +F  WPFKP + +DF
Sbjct: 313 FIEITDLFDKWPFKPDIYMDF 333

>YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA
           polymerase specificity factor, distantly related to
           bacterial sigma factors [1026 bp, 341 aa]
          Length = 341

 Score =  251 bits (641), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 200/321 (62%), Gaps = 7/321 (2%)

Query: 15  NKIHTSYGSQFEKNPKVINQILDKLNLESYYKS-ESLQILDIYAGPLIQSVILNERLKPK 73
           +K+   YG ++  NP V N+I DKL+L   YK  E L++LD+Y G  IQS I   +  P+
Sbjct: 12  SKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPR 71

Query: 74  KHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHN 133
           ++ LLE R    +   A  +  P  +   ++PY W T+  + +E+R+  P +Q  DHI++
Sbjct: 72  QYSLLEKRSSLYKFLNAKFEGSPLQI-LKRDPYDWSTYSNLIDEERIFVPEVQSSDHIND 130

Query: 134 EFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLFAPFSNKDRN 193
           +FL  AN+T +  E L +Q+L CI N+NW+ RFG VKML+W+P  TARKL A      R+
Sbjct: 131 KFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRS 190

Query: 194 RLTLLSELATNTKLVATSE-NSVKKFLPDCIEKFDPVIIPSDNKSPDD---LSLVEINPR 249
           + +++ E  T+TKL+A S+ N +K F   CIE++DP++  +    P     ++LVE++P 
Sbjct: 191 KCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPI 250

Query: 250 DHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRL-DPVLLKKKPYELTYLE 308
           D   D+D+WD+VT+ LMILK  P+  +++ LGHG + +F SR+ D  LLKK P +LT  E
Sbjct: 251 DFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDE 310

Query: 309 IDEIAKVFALWPFKPSLLVDF 329
              + K+F  WPFKP +L+DF
Sbjct: 311 FIYLTKLFMEWPFKPDILMDF 331

>CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces
           cerevisiae YMR228w MTF1 RNA polymerase specific factor,
           start by similarity
          Length = 338

 Score =  230 bits (586), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 204/332 (61%), Gaps = 13/332 (3%)

Query: 7   LKSVLPLANKIH--TSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPLIQSV 64
           +K  +P  +++H  + YG ++  +P    ++ +KL L S   + ++++LD+Y GP I S 
Sbjct: 1   MKVAVPTISQLHIKSYYGFRYLLDPDWHQKVFEKLGLSS---NPNMKVLDLYPGPGIHSA 57

Query: 65  ILNERLKPKKHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPS 124
           +L  +++P+++ ++E R  F+   +    D P M    K+PYKWE++ E+ +++++  P 
Sbjct: 58  VLYNKVQPQQYTMMECRRDFLSNLRNIYTDGP-MELVKKDPYKWESYTELIDQEKLFVPK 116

Query: 125 MQKRDHIHNEFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLF 184
               + ++ +F I ANLT KK E L +Q++ C+ N+NW+ RFG   ML+W+P  TA KL 
Sbjct: 117 KADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLL 176

Query: 185 APFSNKDRNRLTLLSELATNTKLVATS-ENSVKKFLPDCIEKFDPVIIP--SDNKSPD-D 240
           A   +  R++ +L+ E  T+TKLVA S E  +K F   C++K +P++IP  +D    D  
Sbjct: 177 ADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDFP 236

Query: 241 LSLVEINPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRLDP---VLL 297
           ++LVE  P+ H IDLD+W+FVT+ LM+L   P+ + I+ LGHGARD+F + +D     LL
Sbjct: 237 IALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHIHLL 296

Query: 298 KKKPYELTYLEIDEIAKVFALWPFKPSLLVDF 329
           KK P + T  +   +  +F LWPFKP + +DF
Sbjct: 297 KKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDF 328

>YPL213W (LEA1) [5236] chr16 (150613..151329) Component of the U2
           snRNP complex similar to human U2A' protein, involved in
           the initial steps of pre-mRNA splicing [717 bp, 238 aa]
          Length = 238

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%)

Query: 94  DHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHNEFLIAANLTNKKGEQLYVQY 153
           D  SM +  K+  K    L++TN D ++ P + +RD IH   L   N+    G  L +  
Sbjct: 39  DSESMPSSLKHLTKPTHILDLTNNDLIMIPDLSRRDDIHTLLLGRNNIVEVDGRLLPMNV 98

Query: 154 LQCIANQNWMQRFGLVKMLVWIPQ 177
                + N ++RF  ++ L   P+
Sbjct: 99  QNLTLSNNSIRRFEDLQRLRRAPR 122

>Scas_481.1*
          Length = 327

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 38/71 (53%), Gaps = 8/71 (11%)

Query: 164 QRFGLVKMLVWIPQ---QTARKLFAPFSNKDRNRLTLLSELATNTKLVATSENSVKKFLP 220
           +R  +V++L+W  +   QT R++ +  S KD      ++      + +  S++  + F+ 
Sbjct: 49  RRKEVVQILLWKKRMELQTKRRISSSLSAKDH-----INSFVFEFRELWRSQDDKRAFIR 103

Query: 221 DCIEKFDPVII 231
            C+E +DP++I
Sbjct: 104 KCMENYDPILI 114

>YBR138C (YBR138C) [324] chr2 complement(513718..515292) Protein
           involved in meiotic segregation [1575 bp, 524 aa]
          Length = 524

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 38/86 (44%), Gaps = 19/86 (22%)

Query: 175 IPQQTARKLFAPFSNKDRNRLTLLSELATNTKLVATSENSVKKFLPDCIEKFDPVI---- 230
           I ++T R  F P      N LTL+  +  NT+      N+   F+ + IE  D  I    
Sbjct: 268 INKETNRNSFEP------NSLTLIPHILRNTEENRDESNNPLDFIKEEIEISDISIPNSI 321

Query: 231 ---------IPSDNKSPDDLSLVEIN 247
                    IPS NKS DDL L E+N
Sbjct: 322 ENMVVNLVNIPSSNKSYDDLYLSELN 347

>YKR101W (SIR1) [3352] chr11 (640104..642140) Protein involved in
           establishment of silencing at HMR and HML, not required
           for establishment of telomere silencing [2037 bp, 678
           aa]
          Length = 678

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 60/116 (51%), Gaps = 13/116 (11%)

Query: 17  IHTSYGSQFEKN----PKVINQILDKLNLESYYKSESLQILDIYAGPLIQSVILNERLKP 72
           +HT + SQ EKN     KV +++LD++   S +    + +L + AG     + L E L  
Sbjct: 356 VHTQFNSQKEKNNIRVNKVSSEVLDQI---SKFPVSRVTLLLMSAGQDKNYIELVEELAR 412

Query: 73  K-KHVLLEDRLKFVELYQATLKDHPSM-VNYNKNPYK----WETFLEMTNEDRVLT 122
           + + + +E   + +E  + T + +P M  +++K  Y+    ++  LE+  ED ++T
Sbjct: 413 RLEKICIEKTTQSLEEIRDTFQANPEMQASFDKEYYQSIEEYKITLELIKEDLLIT 468

>CAGL0K04521g complement(429864..430817) some similarities with
           sp|P53239 Saccharomyces cerevisiae YGR062c Cytochrome c
           oxidase, hypothetical start
          Length = 317

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 9/72 (12%)

Query: 175 IPQQTARKLFAPFSNKDRNRLTLLSELATNTKLVATSENSVKKFLPDCIEKFDPVIIPSD 234
           + QQ  RKL AP S+  + RL + S+ A   +L + S+ ++ K +           + ++
Sbjct: 83  VKQQELRKLVAPISSIVKMRLAVTSKSAKEKRLESGSDITIAKPVGG---------LSAE 133

Query: 235 NKSPDDLSLVEI 246
           N +P+ ++L+ +
Sbjct: 134 NLTPEQITLLAV 145

>Sklu_2319.2 YOL141W, Contig c2319 3182-5275 reverse complement
          Length = 697

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 10/89 (11%)

Query: 226 FDPVIIPSDNKSPDDLSLVEINPRDHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGAR 285
           +DP  +P     P++L     N R   +D+D+ D ++ K+ I+K    +E+  I+G    
Sbjct: 119 YDP--LPFQLLDPNNLQNTRYNGRLSFVDIDYADLISTKINIIKQ--TDELKNIVGQE-- 172

Query: 286 DWFISRLDPVLLKKKPYELTYLEIDEIAK 314
               +  D VL +   Y  T   ++E  K
Sbjct: 173 ----THTDKVLFQTPKYVATSCNLNESEK 197

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,479,855
Number of extensions: 516319
Number of successful extensions: 1750
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1768
Number of HSP's successfully gapped: 24
Length of query: 330
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 228
Effective length of database: 13,065,073
Effective search space: 2978836644
Effective search space used: 2978836644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)