Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08239g1729170382450.0
Sklu_2383.11720171853000.0
AFR566C1716170649750.0
YMR229C (RRP5)1729172548820.0
Scas_594.41722172148230.0
CAGL0M04829g1706170044600.0
Kwal_26.91891726134238630.0
Scas_713.42699921056e-04
YER013W (PRP22)1145721020.001
KLLA0F17996g6842321010.001
KLLA0B11638g1111731020.002
CAGL0D02376g69569990.003
Kwal_55.21029110572990.003
AGL184W68378950.009
CAGL0F02915g83579950.009
Scas_479.230271920.012
Scas_617.930271920.013
YJR007W (SUI2)30472910.015
Kwal_56.23875680149920.020
Scas_705.55907228920.021
Sklu_2440.18824238900.033
Kwal_33.1542230271880.035
Kwal_47.18684809225860.11
Scas_570.11858231850.12
AGR320W30271830.13
YLR117C (CLF1)68758810.33
AAR020W111273810.34
CAGL0B03795g30362780.54
YDR416W (SYF1)85976790.58
YBR112C (SSN6)966135780.85
Kwal_26.7204111754780.85
Kwal_23.3670802135751.7
KLLA0B09262g941135752.1
KLLA0D16148g26766732.2
YOR223W292102697.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08239g
         (1703 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces c...  3180   0.0  
Sklu_2383.1 YMR229C, Contig c2383 993-6155                           2046   0.0  
AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH] (1449324..1...  1920   0.0  
YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein r...  1885   0.0  
Scas_594.4                                                           1862   0.0  
CAGL0M04829g complement(524685..529805) similar to sp|Q05022 Sac...  1722   0.0  
Kwal_26.9189                                                         1492   0.0  
Scas_713.42                                                            45   6e-04
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    44   0.001
KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomy...    44   0.001
KLLA0B11638g complement(1020591..1023926) similar to sp|P24384 S...    44   0.002
CAGL0D02376g complement(244241..246328) similar to tr|Q12309 Sac...    43   0.003
Kwal_55.21029                                                          43   0.003
AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH] complement(...    41   0.009
CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces c...    41   0.009
Scas_479.2                                                             40   0.012
Scas_617.9                                                             40   0.013
YJR007W (SUI2) [2909] chr10 (450934..451848) Translation initiat...    40   0.015
Kwal_56.23875                                                          40   0.020
Scas_705.55                                                            40   0.021
Sklu_2440.18 YDR416W, Contig c2440 29476-31950                         39   0.033
Kwal_33.15422                                                          39   0.035
Kwal_47.18684                                                          38   0.11 
Scas_570.11                                                            37   0.12 
AGR320W [4631] [Homologous to ScYJR007W (SUI2) - SH] complement(...    37   0.13 
YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential...    36   0.33 
AAR020W [206] [Homologous to ScYER013W (PRP22) - SH] complement(...    36   0.34 
CAGL0B03795g 376266..377177 highly similar to sp|P20459 Saccharo...    35   0.54 
YDR416W (SYF1) [1241] chr4 (1298420..1300999) Pre-mRNA splicing ...    35   0.58 
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    35   0.85 
Kwal_26.7204                                                           35   0.85 
Kwal_23.3670                                                           33   1.7  
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    33   2.1  
KLLA0D16148g 1361758..1362561 highly similar to sp|P40545 Saccha...    33   2.2  
YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unkno...    31   7.1  

>KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces
            cerevisiae YMR229c RRP5 processing of pre-ribosomal RNA,
            start by similarity
          Length = 1729

 Score = 3180 bits (8245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1589/1703 (93%), Positives = 1589/1703 (93%)

Query: 1    MVAPQSKRKRDDESPLVRQDATEAPAKSALSKSEEISFPRGGSSALSPLEVKQVGNEVVA 60
            MVAPQSKRKRDDESPLVRQDATEAPAKSALSKSEEISFPRGGSSALSPLEVKQVGNEVVA
Sbjct: 1    MVAPQSKRKRDDESPLVRQDATEAPAKSALSKSEEISFPRGGSSALSPLEVKQVGNEVVA 60

Query: 61   DVLFGKDESATGAEGPTXXXXXXXXXXFDQIXXXXXXXXXXXXXLIEHFGMKQMTKGTIV 120
            DVLFGKDESATGAEGPT          FDQI             LIEHFGMKQMTKGTIV
Sbjct: 61   DVLFGKDESATGAEGPTKKKKKNAKNNFDQITTGDDEEKEDKTDLIEHFGMKQMTKGTIV 120

Query: 121  LGQIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENLXXXXXXXXXXXXXXXXXXXX 180
            LGQIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENL                    
Sbjct: 121  LGQIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENLDESMESDDEKNEDSEYDSSD 180

Query: 181  XXXXITTPKELPDLNKYFKIGQWLRCMVQNNSALESNKNKKLDLSIEPSVVNVFEDDDLA 240
                ITTPKELPDLNKYFKIGQWLRCMVQNNSALESNKNKKLDLSIEPSVVNVFEDDDLA
Sbjct: 181  DESDITTPKELPDLNKYFKIGQWLRCMVQNNSALESNKNKKLDLSIEPSVVNVFEDDDLA 240

Query: 241  KNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRSGRTVN 300
            KNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRSGRTVN
Sbjct: 241  KNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRSGRTVN 300

Query: 301  VNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLPHSNFFT 360
            VNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLPHSNFFT
Sbjct: 301  VNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLPHSNFFT 360

Query: 361  VEDLKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALESFPVGYI 420
            VEDLKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALESFPVGYI
Sbjct: 361  VEDLKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALESFPVGYI 420

Query: 421  FDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLYTLTSDP 480
            FDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLYTLTSDP
Sbjct: 421  FDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLYTLTSDP 480

Query: 481  ALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTRLVYPER 540
            ALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTRLVYPER
Sbjct: 481  ALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTRLVYPER 540

Query: 541  KFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQELKTIGTV 600
            KFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQELKTIGTV
Sbjct: 541  KFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQELKTIGTV 600

Query: 601  EIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFERNRIIAS 660
            EIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFERNRIIAS
Sbjct: 601  EIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFERNRIIAS 660

Query: 661  CKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGHLSDDRI 720
            CKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGHLSDDRI
Sbjct: 661  CKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGHLSDDRI 720

Query: 721  EQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDIKNKDKT 780
            EQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDIKNKDKT
Sbjct: 721  EQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDIKNKDKT 780

Query: 781  EPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYLLRTDEE 840
            EPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYLLRTDEE
Sbjct: 781  EPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYLLRTDEE 840

Query: 841  HERFLLTILKQKTDVKKINSSVINPVDKSIKDLSDFTIGKVTKATITSVKKNQLNVTLAD 900
            HERFLLTILKQKTDVKKINSSVINPVDKSIKDLSDFTIGKVTKATITSVKKNQLNVTLAD
Sbjct: 841  HERFLLTILKQKTDVKKINSSVINPVDKSIKDLSDFTIGKVTKATITSVKKNQLNVTLAD 900

Query: 901  NVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLPISHTTSKSH 960
            NVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLPISHTTSKSH
Sbjct: 901  NVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLPISHTTSKSH 960

Query: 961  LVELSAKPSSLTSPVSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVKAKLPIFEISD 1020
            LVELSAKPSSLTSPVSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVKAKLPIFEISD
Sbjct: 961  LVELSAKPSSLTSPVSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVKAKLPIFEISD 1020

Query: 1021 EGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKEGDVLPARVIS 1080
            EGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKEGDVLPARVIS
Sbjct: 1021 EGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKEGDVLPARVIS 1080

Query: 1081 VQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNVDIDNNKINLS 1140
            VQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNVDIDNNKINLS
Sbjct: 1081 VQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNVDIDNNKINLS 1140

Query: 1141 LRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVSKLTDAFIKDW 1200
            LRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVSKLTDAFIKDW
Sbjct: 1141 LRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVSKLTDAFIKDW 1200

Query: 1201 KKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDIFQGSVKNVTD 1260
            KKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDIFQGSVKNVTD
Sbjct: 1201 KKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDIFQGSVKNVTD 1260

Query: 1261 FGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPEKKQISLGLKA 1320
            FGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPEKKQISLGLKA
Sbjct: 1261 FGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPEKKQISLGLKA 1320

Query: 1321 SYFTNXXXXXXXXXXXXXXXXXGVDDLDIDMEDGQKXXXXXXXXXXXXXXXXXXXXXXXF 1380
            SYFTN                 GVDDLDIDMEDGQK                       F
Sbjct: 1321 SYFTNEKPETVEEGNEEEEELEGVDDLDIDMEDGQKESDASDKDEDKDEDQDEIMDDAQF 1380

Query: 1381 GHSDSEAEDTTRPKNSAPVSTDGLSLSTGFDWTASILDQAQXXXXXXXXXXXFIXXXXXX 1440
            GHSDSEAEDTTRPKNSAPVSTDGLSLSTGFDWTASILDQAQ           FI      
Sbjct: 1381 GHSDSEAEDTTRPKNSAPVSTDGLSLSTGFDWTASILDQAQDEEESSEEDEDFIKSRKQK 1440

Query: 1441 XXXXXXXXXXTVDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVE 1500
                      TVDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVE
Sbjct: 1441 KKKTQIVQDKTVDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVE 1500

Query: 1501 RALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQM 1560
            RALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQM
Sbjct: 1501 RALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQM 1560

Query: 1561 SEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIE 1620
            SEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIE
Sbjct: 1561 SEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIE 1620

Query: 1621 VVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVI 1680
            VVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVI
Sbjct: 1621 VVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVI 1680

Query: 1681 TKKITRKQAKFFFNKWLQFEEQK 1703
            TKKITRKQAKFFFNKWLQFEEQK
Sbjct: 1681 TKKITRKQAKFFFNKWLQFEEQK 1703

>Sklu_2383.1 YMR229C, Contig c2383 993-6155
          Length = 1720

 Score = 2046 bits (5300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1003/1718 (58%), Positives = 1273/1718 (74%), Gaps = 40/1718 (2%)

Query: 1    MVAPQSKRKRDDESPLVRQDATEAPAKSAL-SKSEEISFPRGGSSALSPLEVKQVGNEVV 59
            M    +KRKRDDESPL RQD T  P KS+L   SEE SFPRGG+S L+PLE+KQV NE  
Sbjct: 1    MAPSNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAA 60

Query: 60   ADVLFGKDESATGAEGP-TXXXXXXXXXXFDQIXXXXXXXXXXXXXLIEHFGMKQMTKGT 118
            +DVLF  D   + A  P                             ++EH   K +T G+
Sbjct: 61   SDVLF--DNGTSSAVKPEVERPKKKKKTSKSTTGTKNETDEEESTTIVEHISFKNLTPGS 118

Query: 119  IVLGQIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENLXXXXXXXXXXXXXXXXXX 178
             +LGQI +++KH+L ISL D L GYV+L +ISEQ T +LE L                  
Sbjct: 119  QLLGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMEKDQDSEDDDSDYD 178

Query: 179  XXXXXXIT---TPKELPDLNKYFKIGQWLRCMVQNNSALES-NKNKKLDLSIEPSVVNVF 234
                   +     KELPDL KYFK GQWLRC VQ+N+ALE+  K K+++L+IEPS  N  
Sbjct: 179  SSDEDEHSKNKKNKELPDLKKYFKPGQWLRCTVQSNTALEAKKKQKRIELTIEPSATNQL 238

Query: 235  EDDDLAKNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKR 294
             D+DL++NC +QCS+KSIEDHGAILD+GI+ +TGFISKKD P    LLPG VFL  V KR
Sbjct: 239  ADEDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKR 298

Query: 295  SGRTVNVNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLP 354
            S RTVNVN D  SKN KV  ISSIDA++PGQS+DFL Q I+++G+ GK FGL++ FL   
Sbjct: 299  SDRTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGAS 358

Query: 355  HSNFFTVEDLKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALES 414
            H   F+ + +KH+Y+IG  + ARI+AT   K G+K+ +VST PHI+SL  K+ E +AL++
Sbjct: 359  HLRTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDA 418

Query: 415  FPVGYIFDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLY 474
            FPVGYI +SCTVKGRDSQ+FY+S++ +++GQ+H+S+ G+ +P G VKAR++GYN VD  Y
Sbjct: 419  FPVGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYY 478

Query: 475  TLTSDPALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTR 534
             L++DP +L++KYLR+ DIP GEV+S CEIVTVS KGI+L +F  QFKAFVPPLHISD +
Sbjct: 479  QLSTDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVK 538

Query: 535  LVYPERKFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQEL 594
            LVYPERKFKIGSKVKGRVLNVD+ GRVTVTLKKS+VN DE+ + LV     I+ +   + 
Sbjct: 539  LVYPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDE 598

Query: 595  KTIGTVEIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFER 654
            KT  TVE FK NGCV+SF  N+K F+PN EISEAFVK+PQ+HLRLGQ+V+VK+L HD E+
Sbjct: 599  KTSATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEK 658

Query: 655  NRIIASCKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGH 714
            NR+I +CK+S++++++QK AIE++V+G+SI+   V+ KTKDS ++E  D GLRGVIY GH
Sbjct: 659  NRVIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGH 718

Query: 715  LSDDRIEQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDI 774
            LSD RIEQNRA  KKL++ +E+ GLV+DKDIRT VFN+SCKKSLIKDA++G LPLS+ ++
Sbjct: 719  LSDSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEV 778

Query: 775  KNKDKTEPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYL 834
            K K  + PMHGYVKS SD+G+FVAF+G+FVGLVLPSYA E+RD+DI KK++INQS+T YL
Sbjct: 779  KAKGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYL 838

Query: 835  LRTDEEHERFLLTILKQKTDVKKI-NSSV--INPVDKSIKDLSDFTIGKVTKATITSVKK 891
            LRTD+E+ERFLLT+ + K   K+  N SV  +NP+D+S+K+LS++ +GKVTKA I +VKK
Sbjct: 839  LRTDDENERFLLTLKEPKVAEKRQDNGSVNAVNPIDESVKELSEYVVGKVTKAKIKAVKK 898

Query: 892  NQLNVTLADNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLP 951
            NQLNV LADN+HGR+ +SE+FD FE+IK+ KAPLS YKK D + V+VIG+HDIK+ +FLP
Sbjct: 899  NQLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLP 958

Query: 952  ISHTTSKSHLVELSAKPSSLTSP-VSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVK 1010
            ISH  SK+ ++EL+AKPS LT    S   +K+        GF+NN+S    WLT++P +K
Sbjct: 959  ISHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLK 1018

Query: 1011 AKLPIFEISDEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKE 1070
            AK+    +SD+G  F+  I E +P+G+A++V    IDTEH+ + V+ R H+I  I+++K 
Sbjct: 1019 AKISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKV 1078

Query: 1071 GDVLPARVISVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNV 1130
            GD LPAR+I + D+Y+LL LG D+ G+SF+T+ALDDYS+SLK  ++++K +IV ATV++V
Sbjct: 1079 GDKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVISV 1138

Query: 1131 DIDNNKINLSLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVS 1190
            D+ + K+ LSLRS+ PKDR I S  +L RGD+VRGF+K+++DKG+F+ LS+ +QAFVPVS
Sbjct: 1139 DLKDKKVKLSLRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVS 1198

Query: 1191 KLTDAFIKDWKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDI 1250
            KLTD+FIKDWKKF++  Q V GKVVNC+ + R+LLTL+ESEVNG LN+LK YS+I  G+I
Sbjct: 1199 KLTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEI 1258

Query: 1251 FQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPE 1310
            F+G + NVTDFGVFVKL+ T+NVTGLAH+S++AD+++D+L  LFGEGDKVKAIVLKTNPE
Sbjct: 1259 FEGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPE 1318

Query: 1311 KKQISLGLKASYFTNXXXXXXXXXXXXXXXXXGVDDLDIDMEDGQKXXXXXXXXXXXXXX 1370
            KKQ+SLGLKASYF                        D++MED  +              
Sbjct: 1319 KKQVSLGLKASYFKKEVEKNQEVE-------------DVEMEDVAENESEEDEIIAVDYE 1365

Query: 1371 XXXXXXXXXFGHSDSEAE---DTTRPKNSAPVSTDGLSLSTGFDWTASILDQAQXXXXXX 1427
                        S+ EAE   + T   +  PV+ DGLSLSTGFDWTASILDQAQ      
Sbjct: 1366 ----------NESELEAEPEKEATSQSSKVPVTNDGLSLSTGFDWTASILDQAQEDEESS 1415

Query: 1428 XXX--XXFIXXXXXXXXXXXXXXXXTVDINTRIPESVGDFERLIMGNPNSSVVWMNYMAF 1485
                                     T+DINTR PESV DFERLIMGNPNSSVVWMNYMAF
Sbjct: 1416 EDEDFANTKKSRNRKKGRTNAVEDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAF 1475

Query: 1486 HLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYM 1545
             LQLSEV+KAREI ERALKTI+FR+E EKLNIWIA LNLENTFGTEET++D F ++CQYM
Sbjct: 1476 QLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYM 1535

Query: 1546 DSFTMHMKLLSIYQMSEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEV 1605
            DSFTMH KL+SIYQ+SEK E+A EL++ TAKKFGS+KVSIWV+WGEFLI  N  DEAH V
Sbjct: 1536 DSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAV 1595

Query: 1606 LGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIK 1665
            LGN+LK+LP R+HIEVVRKFAQLEFSKGD EQGRSLFEGLLADAPKR+DLWNVYIDQE K
Sbjct: 1596 LGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETK 1655

Query: 1666 HGEKSKAEDLFERVITKKITRKQAKFFFNKWLQFEEQK 1703
             GEK K EDLFER+I+KKITRKQAKFFFNKWLQFEE K
Sbjct: 1656 AGEKKKVEDLFERIISKKITRKQAKFFFNKWLQFEESK 1693

>AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH]
            (1449324..1454474) [5151 bp, 1716 aa]
          Length = 1716

 Score = 1920 bits (4975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 942/1706 (55%), Positives = 1231/1706 (72%), Gaps = 35/1706 (2%)

Query: 6    SKRKRDDESPLVRQDATEAPAKSALSKSEEISFPRGGSSALSPLEVKQVGNEVVADVLFG 65
            +KRK ++E         +  +KS L+   +++FPRGG+SAL+PLE+KQV NE  +DVLFG
Sbjct: 7    NKRKLNNEQRPEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDVLFG 66

Query: 66   KDESATGAEGPTXXXXXXXXXXFDQIXXXXXXXXXXXXXLIEHFGMKQMTKGTIVLGQIQ 125
            +D+     E P            D +             ++EH   K +T GT++LGQ+ 
Sbjct: 67   RDDGKPAEERPRKKKKTSKASKEDAVAGKEDRTD-----IVEHLSFKGLTSGTVLLGQLC 121

Query: 126  SISKHELKISLVDGLHGYVSLTDISEQMTKILENLXXXXXXXXXXXXXXXXXXXXXXXXI 185
             +++ +L I+L DGL GYV LT+IS   T +LE L                         
Sbjct: 122  GVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLDQSMDSGSEDEDDDSDDEQRDKPHT 181

Query: 186  TTPKELPDLNKYFKIGQWLRCMVQNNSALESNK--NKKLDLSIEPSVVNVFEDDDLAKNC 243
             T  ELP+L+KYF +GQWLRC+V  NSAL+S K  N +++LSIEPS VN+FE +DLAK+ 
Sbjct: 182  IT--ELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEPSKVNLFETEDLAKHT 239

Query: 244  PLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRSGRTVNVNL 303
             +QC++KSIEDHGA+LD+G++++TGFIS KD+ +   ++PG VFLA +TKR  RT  VN 
Sbjct: 240  TVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGDRTATVNF 299

Query: 304  DLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLPHSNFFTVED 363
            +  +KN+KV +ISS+DA++PG +IDFL + ITNHG+IGKAFG++  FL    +  F+V D
Sbjct: 300  EFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQARVFSVTD 359

Query: 364  LKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALESFPVGYIFDS 423
            +KH Y+IG  +  RI+AT   K G+KV +VS  PHI+SL   L ETEA+ +FPVGY+FD+
Sbjct: 360  MKHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFPVGYVFDN 419

Query: 424  CTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLYTLTSDPALL 483
            C + GRDSQ+ YVS+++E++GQIH+SKAG+      VKAR+ GYN VD  Y LTSDP LL
Sbjct: 420  CKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQLTSDPKLL 479

Query: 484  DVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTRLVYPERKFK 543
               YLRS+DIP G +LS CEI  VSG GIEL +F+ QFKAFV PLHISD RLVYPERKFK
Sbjct: 480  AKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLVYPERKFK 539

Query: 544  IGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQELKTIGTVEIF 603
            IGSKVKGRVL+VD+ GRV VTLKKS+V+A++  + LV   + I  +  ++ KT+ TVE F
Sbjct: 540  IGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKTLATVESF 599

Query: 604  KPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFERNRIIASCKI 663
            KP+GCV++F  N+KAF+PNKEISEAFV++ Q+HLRLGQ+V+VK+L H  +++++I + K+
Sbjct: 600  KPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSKVIVTRKV 659

Query: 664  SAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGHLSDDRIEQN 723
            S+E S KQK+AI  LVVG+SI+D  V+EKTKDSV+VE  D GLRGVIY GHLSD ++EQN
Sbjct: 660  SSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLSDSKLEQN 719

Query: 724  RASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDIKNKDKTEPM 783
            RA  KKL+I S ++G+V+DKD++T VFNMSCKKSLIKDA    LPL+F DIK+KD   PM
Sbjct: 720  RALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKDKDPNTPM 779

Query: 784  HGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYLLRTDEEHER 843
            HGYVKS+SDRG+FVAF GKFVGLVLPSYA E+RD+DI KK+YINQSVTVYLLRTDEE+ER
Sbjct: 780  HGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLRTDEENER 839

Query: 844  FLLTILKQKTDVKKINS----SVINPVDKSIKDLSDFTIGKVTKATITSVKKNQLNVTLA 899
            FLLT+   +T  KK +S    + +NPVD S+K +S +++G VTKA + SVKK QLNV LA
Sbjct: 840  FLLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKTQLNVVLA 899

Query: 900  DNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLPISHTTSKS 959
            DN+HGR+  SE++D+FE+I+  K PL+ +K  D + V+VIGFHD K+ KFLPISH T  +
Sbjct: 900  DNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPISHRTGVN 959

Query: 960  HLVELSAKPSSLTSPVSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVKAKLPIFEIS 1019
             ++ELSAK S+L       +           GF+NN++    WLT++P +KAK+P FE+S
Sbjct: 960  TVLELSAKKSALKGAYQPIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKAKIPDFELS 1019

Query: 1020 DEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKEGDVLPARVI 1079
            D+G  F+  ++E +P+G A++V VK +D  H  + VSAR HAI+ I +IK  D LPAR++
Sbjct: 1020 DDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVADKLPARIV 1079

Query: 1080 SVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNVDIDNNKINL 1139
             V D+Y+LL LG  +TGV+F+TDAL+++SLSL+ VY+ K  +++ A+V+ VD++N KINL
Sbjct: 1080 KVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVDVENKKINL 1139

Query: 1140 SLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVSKLTDAFIKD 1199
            SLR+    DR I+S  +LK+GD+VRGF+KS+TDKG+F+ LS  LQAFVPVSKLTDA+IK+
Sbjct: 1140 SLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSKLTDAYIKE 1199

Query: 1200 WKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDIFQGSVKNVT 1259
            WKKF++  Q + GKVVNC++D R+LLT++ESEVNG+L +LKSY+D+  GDIF GSVKNVT
Sbjct: 1200 WKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIFDGSVKNVT 1259

Query: 1260 DFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPEKKQISLGLK 1319
            DFGVFVKL  T+NVTGLAHKSE++D+KID+L  LFGEGDKVKAI+LKTNPEK Q+SLGLK
Sbjct: 1260 DFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEKNQVSLGLK 1319

Query: 1320 ASYFTNXXXXXXXXXXXXXXXXXGVDDLDIDMEDGQKXXXXXXXXXXXXXXXXXXXXXXX 1379
            ASYF                     ++++ +  D  +                       
Sbjct: 1320 ASYFQKAHDDEDEAEPAESIEEANGEEINGEASDEDE-----------------AMEDIE 1362

Query: 1380 FGH--SDSEAEDTTRPKNSAPVSTDGLSLSTGFDWTASILDQAQXXXXXXXXXXXFIXXX 1437
            + H  +D+ + +T+   +   V T GLSLS GFDWT SILD  Q                
Sbjct: 1363 YEHTPADAPSHETSSKAHKEAVPT-GLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFK 1421

Query: 1438 XXXXXXXXXXXXXTVDI--NTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKA 1495
                           D   +T+ PESVGDFERLIMGNPNSSV+WMNYMAF LQLSEVEKA
Sbjct: 1422 KAKKNNKASRCNDRQDCRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKA 1481

Query: 1496 REIVERALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLL 1555
            RE+ ERALKTI+FREE EKLNIWIA LNLENTFGT+ET+EDVF +ACQYMD++T+HMKL+
Sbjct: 1482 RELAERALKTISFREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLI 1541

Query: 1556 SIYQMSEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPT 1615
            SIY MS K +KA EL+K  AKKFGSE VS+WV+WGEFL+ +   DEA  VL  +LKSLP 
Sbjct: 1542 SIYAMSSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPR 1601

Query: 1616 RNHIEVVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDL 1675
            R+HI+VVRKFAQLEF+KGDPEQGR+LFEGLLADAPKR+D+WNVY+DQEIK   +++A+ L
Sbjct: 1602 RSHIDVVRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADAL 1661

Query: 1676 FERVITKKITRKQAKFFFNKWLQFEE 1701
            FERV+  K++RKQAKFFFNKWLQ  E
Sbjct: 1662 FERVLVAKLSRKQAKFFFNKWLQLAE 1687

>YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein
            required for processing of pre-rRNA to 18S and 5.8S rRNA,
            component of U3 snoRNP (also called small subunit
            processome), which is required for 18S rRNA biogenesis
            [5190 bp, 1729 aa]
          Length = 1729

 Score = 1885 bits (4882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 943/1725 (54%), Positives = 1240/1725 (71%), Gaps = 49/1725 (2%)

Query: 1    MVAPQSKRKRDDESPLVRQDATEAPAKSALSK-SEEISFPRGGSSALSPLEVKQVGNEVV 59
            MVA  +KRKRD++ PL R+D+T+ P+ S+L + +EE+SFPRGG+SAL+PLE+KQV NE  
Sbjct: 1    MVA-STKRKRDEDFPLSREDSTKQPSTSSLVRNTEEVSFPRGGASALTPLELKQVANEAA 59

Query: 60   ADVLFGKD--ESATGAEGPTXXXXXXXXXXFDQIXXXXXXXXXXXXXLIEHFGMKQMTKG 117
            +DVLFG +  +++  A  P                            LIEH   K +  G
Sbjct: 60   SDVLFGNESVKASEPASRPLKKKKTTKKSTSKDSEASSANSDEARAGLIEHVNFKTLKNG 119

Query: 118  TIVLGQIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENLXXXXXXXXXXXXXXXXX 177
            + +LGQI +I+K +L I+  DG+ GYV+LT ISE+ T ILE+L                 
Sbjct: 120  SSLLGQISAITKQDLCITFTDGISGYVNLTHISEEFTSILEDLDEDMDSDTDAADEKKSK 179

Query: 178  XXXXX--------XXITTPKELPDLNKYFKIGQWLRCMVQNNSALE----SNKNKKLDLS 225
                           +    ELP+L +YF IGQWLRC V  N++LE     +K K+++L+
Sbjct: 180  VEDAEYESSDDEDEKLDKSNELPNLRRYFHIGQWLRCSVIKNTSLEPSTKKSKKKRIELT 239

Query: 226  IEPSVVNVFEDDDLAKNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGM 285
            IEPS VN++ D+DL K+  +QC++KSIEDHGA LD+G+   TGFI+KKD   F  LLPG 
Sbjct: 240  IEPSSVNIYADEDLVKSTSIQCAVKSIEDHGATLDVGLPGFTGFIAKKDFGNFEKLLPGA 299

Query: 286  VFLATVTKRSGRTVNVNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFG 345
            VFL  +TK+S R++ VN D + K  K+ +ISSIDAI+PGQ +D L ++IT +G+ GK FG
Sbjct: 300  VFLGNITKKSDRSIVVNTDFSDKKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFG 359

Query: 346  LITAFLPLPHSNFFTVEDLKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPK 405
            L++  + + H   F+ EDLKH + IG  +  RI+A    KSGDKV ++S  PHI+ L   
Sbjct: 360  LVSGVVNVSHLRTFSEEDLKHKFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLEDA 419

Query: 406  LQETEALESFPVGYIFDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARIL 465
            L+ TE L++FP+GY F+SC++KGRDS++ Y++++++++G++H S+ GE E +  + +R+L
Sbjct: 420  LRSTEGLDAFPIGYTFESCSIKGRDSEYLYLALDDDRLGKVHSSRVGEIENSENLSSRVL 479

Query: 466  GYNNVDKLYTLTSDPALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFV 525
            GY+ VD +Y L++DP  L +KYLR++DIP GE+L +CEI +VS  GIELKIFN QFKA V
Sbjct: 480  GYSPVDDIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASV 539

Query: 526  PPLHISDTRLVYPERKFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDD 585
            PPLHISDTRLVYPERKFKIGSKVKGRV++V+S G V VTLKKS+VN ++  + LV   ++
Sbjct: 540  PPLHISDTRLVYPERKFKIGSKVKGRVISVNSRGNVHVTLKKSLVNIEDNELPLVSTYEN 599

Query: 586  IQTVESQELKTIGTVEIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLV 645
             + ++ +  KT+ T+++FKPNGC+ISFF  +  F+PN EISE FVK+P+EHLRLGQ+V+V
Sbjct: 600  AKNIKEKNEKTLATIQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRPEEHLRLGQTVIV 659

Query: 646  KILNHDFERNRIIASCKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSG 705
            K+L+ D +R RIIA+CK+S E +++QK  IE++V G++II   VIEKTKDSVIVE  D G
Sbjct: 660  KLLDVDADRRRIIATCKVSNEQAAQQKDTIENIVPGRTIITVHVIEKTKDSVIVEIPDVG 719

Query: 706  LRGVIYTGHLSDDRIEQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDG 765
            LRGVIY GHLSD RIEQNRA  KKL+I +E+ GLV+DKD RT VFNMS K SLIKDA+  
Sbjct: 720  LRGVIYVGHLSDSRIEQNRAQLKKLRIGTELTGLVIDKDTRTRVFNMSLKSSLIKDAKKE 779

Query: 766  TLPLSFSDIKNKDKTEPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYY 825
            TLPL++ D+K+ +K  PMH Y+KS+SD+G+FVAFNGKF+GLVLPSYA ++RDIDI K +Y
Sbjct: 780  TLPLTYDDVKDLNKDVPMHAYIKSISDKGLFVAFNGKFIGLVLPSYAVDSRDIDISKAFY 839

Query: 826  INQSVTVYLLRTDEEHERFLLTIL--KQKTDVKKINSSVINPVDKSIKDLSDFTIGKVTK 883
            INQSVTVYLLRTD+++++FLL++   K K + KK+ S++ +PVD SIK   D +IG + K
Sbjct: 840  INQSVTVYLLRTDDKNQKFLLSLKAPKVKEEKKKVESNIEDPVDSSIKSWDDLSIGSIVK 899

Query: 884  ATITSVKKNQLNVTLADNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHD 943
            A I SVKKNQLNV LA N+HGR+ I+EVFD++E+I ++K PLS YKK+D + V++IG HD
Sbjct: 900  AKIKSVKKNQLNVILAANLHGRVDIAEVFDTYEEITDKKQPLSNYKKDDVIKVKIIGNHD 959

Query: 944  IKSRKFLPISHTTSKSHLVELSAKPSSLTS-PVSEKKLKDFTPEQTTFGFINNYSNDTAW 1002
            +KS KFLPI+H  SK+ ++ELS KPS L S  V  K L++    Q   GF+NN S +  W
Sbjct: 960  VKSHKFLPITHKISKASVLELSMKPSELKSKEVHTKSLEEINIGQELTGFVNNSSGNHLW 1019

Query: 1003 LTITPTVKAKLPIFEISDEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAI 1062
            LTI+P +KA++ + +++D   +FS  IE  +P+G+A++V V SID EH  +    +SH  
Sbjct: 1020 LTISPVLKARISLLDLADNDSNFSENIESVFPLGSALQVKVASIDREHGFVNAIGKSHVD 1079

Query: 1063 SSISEIKEGDVLPARVISVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNI 1122
             ++S IK GD LP RV+ + + YVLL LG  VTG+SFITDAL+D+SL+LK+ ++ K  N+
Sbjct: 1080 INMSTIKVGDELPGRVLKIAEKYVLLDLGNKVTGISFITDALNDFSLTLKEAFEDKINNV 1139

Query: 1123 VSATVLNVDIDNNKINLSLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSV 1182
            +  TVL+VD  N KI LSLR ++ K R+I S  +LK+G+IV G VK++ DKG+F+ LS  
Sbjct: 1140 IPTTVLSVDEQNKKIELSLRPATAKTRSIKSHEDLKQGEIVDGIVKNVNDKGIFVYLSRK 1199

Query: 1183 LQAFVPVSKLTDAFIKDWKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSY 1242
            ++AFVPVSKL+D+++K+WKKF++  Q V+GKVV CD D R+ LTLRESE+NG L VLK+Y
Sbjct: 1200 VEAFVPVSKLSDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEINGDLKVLKTY 1259

Query: 1243 SDINVGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKA 1302
            SDI  GD+F+G++K+VTDFGVFVKLD TVNVTGLAH +E+AD K ++L  LFG GD+VKA
Sbjct: 1260 SDIKAGDVFEGTIKSVTDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDRVKA 1319

Query: 1303 IVLKTNPEKKQISLGLKASYFTNXXXXXXXXXXXXXXXXXGVDDLDIDMEDGQKXXXXXX 1362
            IVLKTNPEKKQISL LKAS+F+                    +D D  M D         
Sbjct: 1320 IVLKTNPEKKQISLSLKASHFSKEAELASTTTTTTTVDQLEKEDEDEVMADA-------- 1371

Query: 1363 XXXXXXXXXXXXXXXXXFGHSDSEA----EDTTRPKNSAPVSTDGLSLSTGFDWTASILD 1418
                             F  SDSE+    ++T         S+DGLSLS GFDWTASILD
Sbjct: 1372 ----------------GFNDSDSESDIGDQNTEVADRKPETSSDGLSLSAGFDWTASILD 1415

Query: 1419 QAQXXXXXXXXXXXFIXXXXXXXXXXXXXXXX--TVDINTRIPESVGDFERLIMGNPNSS 1476
            QAQ           F                   T+DINTR PESV DFERL++GNPNSS
Sbjct: 1416 QAQEEEESDQDQEDFTENKKHKHKRRKENVVQDKTIDINTRAPESVADFERLLIGNPNSS 1475

Query: 1477 VVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNLENTFGTEETVED 1536
            VVWMNYMAF LQLSE+EKARE+ ERALKTINFREE+EKLNIWIA LNLENTFGTEET+E+
Sbjct: 1476 VVWMNYMAFQLQLSEIEKARELAERALKTINFREEAEKLNIWIAMLNLENTFGTEETLEE 1535

Query: 1537 VFTKACQYMDSFTMHMKLLSIYQMSEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDN 1596
            VF++ACQYMDS+T+H KLL IY++SEK +KA ELFK TAKKFG EKVSIWV+WG+FLI +
Sbjct: 1536 VFSRACQYMDSYTIHTKLLGIYEISEKFDKAAELFKATAKKFGGEKVSIWVSWGDFLISH 1595

Query: 1597 NLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLW 1656
            N   EA  +LGN+LK+LP RNHIEVVRKFAQLEF+KGDPE+GRSLFEGL+ADAPKR+DLW
Sbjct: 1596 NEEQEARTILGNALKALPKRNHIEVVRKFAQLEFAKGDPERGRSLFEGLVADAPKRIDLW 1655

Query: 1657 NVYIDQEIKHGEKSKAEDLFERVITKKITRKQAKFFFNKWLQFEE 1701
            NVY+DQE+K  +K K EDLFER+ITKKITRKQAKFFFNKWLQFEE
Sbjct: 1656 NVYVDQEVKAKDKKKVEDLFERIITKKITRKQAKFFFNKWLQFEE 1700

>Scas_594.4
          Length = 1722

 Score = 1862 bits (4823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1721 (54%), Positives = 1218/1721 (70%), Gaps = 45/1721 (2%)

Query: 2    VAPQSKRKRDDESPLVRQDATEAPAKSALSK-SEEISFPRGGSSALSPLEVKQVGNEVVA 60
            + P +KRKRD+E PL R+DAT+ P  S+L + +EE+SFPRGGSSAL+PLE+KQV NE   
Sbjct: 1    MVPPTKRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAAN 60

Query: 61   DVLFGKDESATGAEGPTXXXXXXXXXXFDQIXXXXXXXXXXXXXL--IEHFGMKQMTKGT 118
            DVLFGK+ S   AE  T            +              L  ++H   K +  G+
Sbjct: 61   DVLFGKETSTDVAESTTRPKKKKKTGKKSKKDTEEKTEEEDEETLSVVQHVNFKTLKIGS 120

Query: 119  IVLGQIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENLXXXXXXXXXXXXXXXXXX 178
            +VLGQI  ISK ++ IS  DGL GYV+LT IS     ILE L                  
Sbjct: 121  LVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTILEELDDDMDDDDELEKKKTDEE 180

Query: 179  XXXXXXITTPKE-------LPDLNKYFKIGQWLRCMVQNNSAL----ESNKNKKLDLSIE 227
                      ++       LP L  YFK+GQWLRC V +N+AL    + NK KK++LSIE
Sbjct: 181  YDSSDDEEEKEKATKDSIGLPSLENYFKVGQWLRCSVISNTALLPKDKKNKKKKIELSIE 240

Query: 228  PSVVNVFEDDDLAKNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVF 287
            PSVVN   ++D+ ++  +QC++KSIEDHGA+LDIGI+  TGFISKKD PEF  LLPG VF
Sbjct: 241  PSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAVF 300

Query: 288  LATVTKRSGRTVNVNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLI 347
            L  VTK+S RTV +NLD + K  K+  ISS+DA+VPGQ +D L QTITN+G++GK FGL+
Sbjct: 301  LGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGLV 360

Query: 348  TAFLPLPHSNFFTVEDLKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQ 407
             +F+   H   F  E+LKH++++G  +  RI+A  I K  DK  ++ST PHI SL   L 
Sbjct: 361  PSFISTAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVLG 420

Query: 408  ETEALESFPVGYIFDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGY 467
            E E L +FP+G++ DSCTVKGRDS + Y+++++++VG++H S+ GE E    +KAR+LG+
Sbjct: 421  EVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLGF 480

Query: 468  NNVDKLYTLTSDPALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPP 527
            N++D LY L++DP +L +KYLRS DIP GEVL  CEI  VS KGIELKIFN QFKA VPP
Sbjct: 481  NSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVPP 540

Query: 528  LHISDTRLVYPERKFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQ 587
            +HISDTRLVYPERKFKIGSKVKGRVLN+++ G + VTLKK++VN +++ + L+      +
Sbjct: 541  MHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIAK 600

Query: 588  TVESQELKTIGTVEIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKI 647
             ++ +  KT+ TV  F+P+GC+++FF  + AF+PN EISE FV+KP+EHLRLGQ+++VK+
Sbjct: 601  EIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVKL 660

Query: 648  LNHDFERNRIIASCKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLR 707
            L  D E  R++ +CKIS + + K+K  IE L+ G+S++   V+EKTKDSVIVE  ++ LR
Sbjct: 661  LKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSLR 720

Query: 708  GVIYTGHLSDDRIEQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTL 767
            GVIY GHLSD RIEQNRA+ KK+ I SE++GLV+DKD RT VFN+S K+SLIKDA++   
Sbjct: 721  GVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEVS 780

Query: 768  PLSFSDIKNKDKTEPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYIN 827
            PL+++DIK+K KT P+HGY+KS+S++G+FVAFNGKFVGLVLPSYA E+RD+DI K +YIN
Sbjct: 781  PLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYIN 840

Query: 828  QSVTVYLLRTDEEHERFLLTILKQKT--DVKKINSS-VINPVDKSIKDLSDFTIGKVTKA 884
            QSVT YLLR+D+++ERFLLT+    T  D  K+  +  + P+D ++KDL DFT GKV K 
Sbjct: 841  QSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTGKVVKV 900

Query: 885  TITSVKKNQLNVTLADNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDI 944
             I  +KKNQLNV LADN+HGRI I+EVFDSF DIK    PL  +KK + +  ++IG HDI
Sbjct: 901  QIKGIKKNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHDI 960

Query: 945  KSRKFLPISHTTSKSHLVELSAKPSSLTSP-VSEKKLKDFTPEQTTFGFINNYSNDTAWL 1003
            KS +FLPISH   K  ++ELS KPS + S  +    + D        GF+NNY ++T WL
Sbjct: 961  KSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLWL 1020

Query: 1004 TITPTVKAKLPIFEISDEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAIS 1063
            T++PT+KAK+ +F+++++G   S  +E+ +P+G A+ V V SIDTEH  + V+ RSH   
Sbjct: 1021 TVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTEI 1080

Query: 1064 SISEIKEGDVLPARVISVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIV 1123
            S   +K GD +P+R+I + D+YVLL LG  + G++FITDALDD+S+ LK+ Y   + +IV
Sbjct: 1081 SFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDIV 1140

Query: 1124 SATVLNVDIDNNKINLSLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVL 1183
            SA ++++D +N K+NLSLR+ S K  +I S +++ +GD+V G VKSI+DKG+F+ LS  +
Sbjct: 1141 SAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRSI 1200

Query: 1184 QAFVPVSKLTDAFIKDWKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYS 1243
             AFVPVSKL+D ++KDWKKFF+  Q V+GKVVN + D R+LLTLRESEVNG L +LK+Y 
Sbjct: 1201 NAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNYD 1260

Query: 1244 DINVGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAI 1303
            DI V +I+ GSVKNVTDFGVFVKLD TVNVTGLAH SE+AD K ++L +LFG GD+VKA 
Sbjct: 1261 DIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKAY 1320

Query: 1304 VLKTNPEKKQISLGLKASYFTNXXXXXXXXXXXXXXXXXGVDDLDIDMEDGQKXXXXXXX 1363
            VLK NPEKKQ+SL LKAS F N                  V++ +    DG +       
Sbjct: 1321 VLKVNPEKKQLSLSLKASRFGNTNESK-------------VEEKETVDADGDEIMEAVDY 1367

Query: 1364 XXXXXXXXXXXXXXXXFGHSDSEAEDTTRPKNSAPVSTDGLSLSTGFDWTASILDQAQXX 1423
                               +++E E+     +   +STDGLSLSTGFDWTASILDQAQ  
Sbjct: 1368 NNAP-------------SDNENETEEILETVSKPKISTDGLSLSTGFDWTASILDQAQAE 1414

Query: 1424 XXXXXXXXXF-IXXXXXXXXXXXXXXXXTVDINTRIPESVGDFERLIMGNPNSSVVWMNY 1482
                                        T+DINTR PESV DFERLI+GNPNSSV+WMNY
Sbjct: 1415 ESSEEDEDFTETKRNRHKKRKQTIVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNY 1474

Query: 1483 MAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKAC 1542
            MAF LQLSE+EKARE+ ERALKTINFREESEK NIW+A LNLENTFG++ET+EDVF +AC
Sbjct: 1475 MAFQLQLSEIEKARELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVFKRAC 1534

Query: 1543 QYMDSFTMHMKLLSIYQMSEKIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEA 1602
            QYMDSFTMH +LLSIYQMS KI+KA ELFKITAKKFGSE VSIWV+WG+FL  +    EA
Sbjct: 1535 QYMDSFTMHNRLLSIYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEA 1594

Query: 1603 HEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQ 1662
              +L N+LK+LP R+HIEVVRKFAQLEF+KGDPE GRSLFEGL+ADAPKR+D+WNVY+DQ
Sbjct: 1595 RGILSNALKALPKRDHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQ 1654

Query: 1663 EIKHGEKSKAEDLFERVITKKITRKQAKFFFNKWLQFEEQK 1703
            EIK  EK K EDLFERV+++KITRKQAKFFFNKWL+FEE +
Sbjct: 1655 EIKANEKKKVEDLFERVVSRKITRKQAKFFFNKWLEFEESQ 1695

>CAGL0M04829g complement(524685..529805) similar to sp|Q05022
            Saccharomyces cerevisiae YMR229c RRP5, hypothetical start
          Length = 1706

 Score = 1722 bits (4460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 872/1700 (51%), Positives = 1166/1700 (68%), Gaps = 42/1700 (2%)

Query: 15   PLVRQDATEAPAKSALSKS-EEISFPRGGSSALSPLEVKQVGNEVVADVLFGKDESATGA 73
            PL ++D T  P KS L ++ EEISFPRGGSSAL+PLE+K V NE   DVLFG ++     
Sbjct: 8    PLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKRPLTE 67

Query: 74   EGPTXXXXXXXXXXFDQIXXXXXXXXXXXXXLIEHFGMKQMTKGTIVLGQIQSISKHELK 133
            +                              +IEH     + +GTI+LGQI SI+K++L+
Sbjct: 68   DDAGKPKKKKKRSSKKDTETVTDDTTEQRSAIIEHLNFNNVKEGTILLGQIDSITKNDLR 127

Query: 134  ISLVDGLHGYVSLTDISEQMTKILENLXXXXXXXXXXXXXXXXXXXXXXXXITTPKELPD 193
            I+  DGL G+V LT ISEQ+T +LE++                         +  K LP+
Sbjct: 128  ITFTDGLSGFVDLTHISEQLTSLLEDIDEDMDSDSKEDDAEYESSDDE----SEQKSLPN 183

Query: 194  LNKYFKIGQWLRCMVQNNSALE---SNKNKKLDLSIEPSVVNVFEDDDLAKNCPLQCSLK 250
            L  YFK+GQWLRC V  N+AL+   + + K+++L+IEPSVVN F+ +D+ KN  +QCS++
Sbjct: 184  LRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQCSVE 243

Query: 251  SIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRSGRTVNVNLDLASKNT 310
            SIEDHGA LD+G+ +LTGFI+KKD   F  L PG VF++ +TK++ R++ V+ D + K  
Sbjct: 244  SIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSVKKN 303

Query: 311  KVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLPHSNFFTVEDLKHHYSI 370
            K+  ISSID+++PGQ +D L + IT+ G++GK FG I+AF+  PH   F+ ED+KH +S+
Sbjct: 304  KMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHKFSL 363

Query: 371  GDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALESFPVGYIFDSCTVKGRD 430
            G  +  RILA+ I KSGD+V ++ST PH+ISL+  L   E+LE+FP+G+I D   VKGRD
Sbjct: 364  GSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVKGRD 423

Query: 431  SQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLYTLTSDPALLDVKYLRS 490
            S + Y++I+++ +G++H S  GE      +K+R++GY+  D ++ LT+DP  L +KY+RS
Sbjct: 424  SSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKYIRS 483

Query: 491  SDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTRLVYPERKFKIGSKVKG 550
             DIP GEV + CEI+  S  G+ELK+   QF AFVPPLHISD RL+YPERKFKI SK K 
Sbjct: 484  KDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASKTKC 543

Query: 551  RVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQELKTIGTVEIFKPNGCVI 610
            R+LNVD+ G +  T+KKS+VN +E    ++   +  ++++++  KT+GTV+ F  +GCVI
Sbjct: 544  RILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHGCVI 603

Query: 611  SFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFERNRIIASCKISAESSSK 670
             FF  +  F+P  E+SE FVK+ ++HLRLGQ+V VK+L  D ER RII +CK+S E + +
Sbjct: 604  MFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEEAQQ 663

Query: 671  QKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGHLSDDRIEQNRASQKKL 730
            QKS IESL +G+SII+ +V+EKTKDSVIVE  D G+RGVIY GH+SD+RIEQ RA  KK+
Sbjct: 664  QKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEIKKI 723

Query: 731  KINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDIKNKDKTEPMHGYVKSV 790
            +I S++ GLV+DKD RT +FN+S KKSL+KDA++  LP +F++I    KT+P+HGYVKS+
Sbjct: 724  RIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYVKSI 783

Query: 791  SDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYLLRTDEEHERFLLTILK 850
            S  GVFVAF GKFVGLVLPSYA E+R +DI K +Y NQSVT YLLRTD+++ERFLLT+  
Sbjct: 784  SSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLTLKA 843

Query: 851  QKTDVKKINSSVINPVDKSIKDLSDFTIGKVTKATITSVKKNQLNVTLADNVHGRISISE 910
             K +      S  N +D SIK + D  +GK+  A I  VKKNQLN+ LADNVHGR+ ISE
Sbjct: 844  PKVEKAAETISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHGRVDISE 903

Query: 911  VFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLPISHTTSKSHLVELSAKPSS 970
            VFD++ DIK++K PLS YK ND + V++IG HD+KS K LPI+H   K  + EL+ KPS 
Sbjct: 904  VFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFELTMKPSQ 963

Query: 971  LTSP-VSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVKAKLPIFEISDEGHDFSLPI 1029
            L S  V E  ++D T       F+NNY N T WLT+TPT+KAKL IF++S+E       +
Sbjct: 964  LKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETLMNIKNV 1023

Query: 1030 EEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKEGDVLPARVISVQDTYVLLS 1089
            E+ +P+G+ ++V V   D     L V+ R+  I+SI ++K G     +++ V   Y+L+ 
Sbjct: 1024 EDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTPKYLLIE 1083

Query: 1090 LGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNVDIDNNKINLSLRSSSPKDR 1149
            L   +TG+S   +AL+D++  L  V+  K+   V A + +V  D  K+ L L       +
Sbjct: 1084 LENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAEDESTVQ 1143

Query: 1150 TIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVSKLTDAFIKDWKKFFRRGQS 1209
             I S S+LK G++V G VK++TDKG+F+ L   ++AFVPVSKL+D+++K+WKKF++  Q 
Sbjct: 1144 KITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKPMQP 1203

Query: 1210 VVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDIFQGSVKNVTDFGVFVKLDG 1269
            VVGK+V+C+ DDR+LLTLRE+EVNG L VLK+YSDI  GDIF G+V+NVTDFGVFVKLD 
Sbjct: 1204 VVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVKLDN 1263

Query: 1270 TVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPEKKQISLGLKASYFTNXXXX 1329
            T NVTGLAH +E+AD   +++Q++FG GD+VKA VLK+NPEKKQ+SL LKAS+F N    
Sbjct: 1264 TANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHF-NTNET 1322

Query: 1330 XXXXXXXXXXXXXGVDDLDIDMEDGQKXXXXXXXXXXXXXXXXXXXXXXXFGHSDSEA-- 1387
                           +D D  M+D                            +S+SEA  
Sbjct: 1323 ITEKAESQPQPRKIDEDQDELMDD------------------------EVVYNSESEASD 1358

Query: 1388 -EDTTRPKNSAPVSTD-GLSLSTGFDWTASILDQAQXXXXXXXXXXXFIXXXXXXXXXXX 1445
             E+    K++  +S D GLSLS GFDWT SILDQA            F+           
Sbjct: 1359 DEEAHSSKSTTVISNDGGLSLSAGFDWTTSILDQANASSDSESDEEDFMESKRSKNKKKK 1418

Query: 1446 X---XXXXTVDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERA 1502
                    T+DINTR PESV DFERLI+GNPNSSV+WMNYMAF LQLSE++KARE+ ERA
Sbjct: 1419 SKNLVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERA 1478

Query: 1503 LKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQMSE 1562
            LKTIN+REE+EKLNIWIA LNLENTFG+EET+EDVFT++CQYMDSFTMH KL+ IYQ+SE
Sbjct: 1479 LKTINYREEAEKLNIWIAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSE 1538

Query: 1563 KIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVV 1622
            K +KA ELFKIT KKFGSEK SIWV+W  F++  N  D+   +L ++LKSLP RNHIEVV
Sbjct: 1539 KFDKASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVV 1598

Query: 1623 RKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGE-KSKAEDLFERVIT 1681
            RKFAQLEFS+G+PE+GRSLFEGLLADAPKR+D+WNVY+DQEIK  + KS+ E+LFERVI 
Sbjct: 1599 RKFAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIK 1658

Query: 1682 KKITRKQAKFFFNKWLQFEE 1701
             KITRKQAKFFFNKWLQFEE
Sbjct: 1659 MKITRKQAKFFFNKWLQFEE 1678

>Kwal_26.9189
          Length = 1726

 Score = 1492 bits (3863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/1342 (54%), Positives = 971/1342 (72%), Gaps = 34/1342 (2%)

Query: 7    KRKRDDESPLVRQDATEAPAKSALSKSEEISFPRGGSSALSPLEVKQVGNEVVADVLFGK 66
            KRKR +ESPL RQD T+ P+ S L  ++E SFPRGG+SAL+PLE+KQV NE   DVLFG 
Sbjct: 6    KRKRVEESPLTRQDQTQQPSSSLLQNADEGSFPRGGASALTPLELKQVANEAAGDVLFGA 65

Query: 67   DESA----TGAEGPTXXXXXXXXXXFDQIXXXXXXXXXXXXXLIEHFGMKQMTKGTIVLG 122
            + +A    + ++ P                            +I+H   + +  GT++LG
Sbjct: 66   ESAAPAPVSDSQRPKKKKKTHQKSA---TKAADEDSEDSSVTVIDHLNFRNLPVGTLLLG 122

Query: 123  QIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENLXXXXXX--------XXXXXXXX 174
            QI  ++KH+L +SL D L G+V+L  ISE  TK+LE+L                      
Sbjct: 123  QISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGSEAEYDSD 182

Query: 175  XXXXXXXXXXITTPKELPDLNKYFKIGQWLRCMVQNNSALESN--KNKKLDLSIEPSVVN 232
                       T  KELPDL ++F  GQWLRC VQ+NSAL+ +  K+K+++LSIEPS+ N
Sbjct: 183  EESSKASRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEPSITN 242

Query: 233  VFEDDDLAKNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVT 292
               ++DL +NC +QC++KSIEDHGAILD+GIE +TGFISKKD     +LLPG VFLA V 
Sbjct: 243  QLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLANVA 302

Query: 293  KRSGRTVNVNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLP 352
            K+SGRT  VN D  +K +KV  ISSIDAI+PGQ++DFL Q  T++GVIGK FGL+  FL 
Sbjct: 303  KKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDGFLN 362

Query: 353  LPHSNFFTVEDLKHH--YSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETE 410
            +   + F     K+   YS+G     RILAT + K+G+K  VVS  PHI+S   +  E  
Sbjct: 363  VSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEALERP 422

Query: 411  ALESFPVGYIFDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNV 470
            AL +FPVGYIF+ C + GRDSQ+FY+ INN+ VGQ+H+SK G  EP+G V+AR+LGYNN+
Sbjct: 423  ALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGYNNL 482

Query: 471  DKLYTLTSDPALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHI 530
            D  Y L++DP  L VKYLR+SDIP G ++ +CEI  VS KGI+L I   QFKA VPPLHI
Sbjct: 483  DGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPPLHI 542

Query: 531  SDTRLVYPERKFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVE 590
            SD RLVYPERKFKIGSKVK  +++ ++ G + V+LKKS+VN D E V L     DI  + 
Sbjct: 543  SDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDIDRIA 602

Query: 591  SQELKTIGTVEIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNH 650
            +  LK   TV+IFK NGCV+SF   ++ F+PN EISEAFVK+PQ+HLRLGQ+V+VK+L H
Sbjct: 603  TDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKVLQH 662

Query: 651  DFERNRIIASCKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVI 710
            + ++NR+I +CK+S+E++S+QK AIE+++VG+SII   V+EKTKDS++VE    GLRGV+
Sbjct: 663  NAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQVGVGLRGVV 722

Query: 711  YTGHLSDDRIEQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLS 770
            Y GHLSD RIEQNRA  KK+KI +E  GLV+DKD RT VFN+SCKKSLIKDAE   LP++
Sbjct: 723  YVGHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLLPVN 782

Query: 771  FSDIKNKDKTEPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSV 830
            + D+K +     M+GYVKSVS++GVFVAFNG+FVGLVLPSYA ++RD+D+  K+Y NQSV
Sbjct: 783  YQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSNQSV 842

Query: 831  TVYLLRTDEEHERFLLTILKQKTD-----VKKINSSVINPVDKSIKDLSDFTIGKVTKAT 885
            TVYLLRTD+ +ERFLLT+ + K +     + ++  +V NPVD SIKDLSDF++GK+TKA 
Sbjct: 843  TVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAV-NPVDSSIKDLSDFSVGKITKAM 901

Query: 886  ITSVKKNQLNVTLADNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIK 945
            + +VK+NQLNV L+DN+HGRI ISEVFD  EDI + K+PL+ +KK D L V+VIG+HD+K
Sbjct: 902  VKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHDVK 961

Query: 946  SRKFLPISHTTSKSHLVELSAKPSSLTS----PVSEKKLKDFTPEQTTFGFINNYSNDTA 1001
            + KFLP+SH +SK+ L+EL+AKPS L       +   K+ D     +  GF+NN S D  
Sbjct: 962  THKFLPVSHRSSKNVLLELTAKPSRLNGAGGVAIDNVKVGD-----SIVGFVNNISKDIL 1016

Query: 1002 WLTITPTVKAKLPIFEISDEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHA 1061
            WLT++P +KAK+  F+++DE    +  IE+ +P+G+A+R TV  ID + ++L VS RSH+
Sbjct: 1017 WLTVSPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHS 1076

Query: 1062 ISSISEIKEGDVLPARVISVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKN 1121
            +S I +I  GD LPAR+++V D+Y+LL +GKDV GV+F+TDALDDY+ SLKDVY ++K N
Sbjct: 1077 VSDIKDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNN 1136

Query: 1122 IVSATVLNVDIDNNKINLSLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSS 1181
            I SA V++VD  N K+NLSLRS   +D  + +  +LKRG IVRG VK  TDKG+F+ LSS
Sbjct: 1137 IFSAKVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSS 1196

Query: 1182 VLQAFVPVSKLTDAFIKDWKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKS 1241
             LQAFVPVSKLTD++IK+WKKF+R  QSVVGK+VNCD+D  +L TL+ESEVNG LN+LK+
Sbjct: 1197 SLQAFVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKN 1256

Query: 1242 YSDINVGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVK 1301
            Y+DI VG+IF+GSVKNVTDFG+FVKLD T+NVTGLAHKSEVADA +++L  +FG GDKVK
Sbjct: 1257 YADIKVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVK 1316

Query: 1302 AIVLKTNPEKKQISLGLKASYF 1323
            A+VLK N EKKQ+SLGLKASYF
Sbjct: 1317 AVVLKVNAEKKQLSLGLKASYF 1338

 Score =  456 bits (1174), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 211/319 (66%), Positives = 247/319 (77%), Gaps = 3/319 (0%)

Query: 1386 EAEDTTRPKN---SAPVSTDGLSLSTGFDWTASILDQAQXXXXXXXXXXXFIXXXXXXXX 1442
            E ED    +N      +STDGLSLS GFDWT SILDQAQ                     
Sbjct: 1384 EMEDIAEDENHNGGKALSTDGLSLSAGFDWTTSILDQAQDEDSSDEEDFTETKKSKKKKR 1443

Query: 1443 XXXXXXXXTVDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERA 1502
                    T+DINTR PESVGDFER+IMGNPNSSVVWMN+MAF LQL E++KAR++ ERA
Sbjct: 1444 SVGGVEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDKARDVAERA 1503

Query: 1503 LKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQMSE 1562
            LKTI+FREE+EK+NIWI  LNLENTFG E ++ +VF++ACQYMDS+ +H KL++IYQMS 
Sbjct: 1504 LKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKLINIYQMSH 1563

Query: 1563 KIEKAKELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVV 1622
             I+KA  LFK TAKKFGSEKV IWV+WGEFLID    DEAH+VL ++LKSLP R+HIEVV
Sbjct: 1564 NIDKAAALFKATAKKFGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLPRRHHIEVV 1623

Query: 1623 RKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVITK 1682
            RKFAQLEF+KGD EQGRSLFEGLLAD PKR+DLWNVY+DQEIK G+K K EDLFER++ +
Sbjct: 1624 RKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVEDLFERIVNR 1683

Query: 1683 KITRKQAKFFFNKWLQFEE 1701
            K+TRKQAKFFF KWL+FEE
Sbjct: 1684 KLTRKQAKFFFGKWLEFEE 1702

>Scas_713.42
          Length = 699

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 1585 IWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFEG 1644
            IW+ + EF I  N I  A ++LG SL   P     +V R++ ++E S  + ++ R L+E 
Sbjct: 412  IWIMYSEFEIRQNDIGTARKILGRSLGLCP---KPKVFRRYIEIEISLREFDRVRRLYEK 468

Query: 1645 LLADAPKRVDLWNVYIDQEIKHGEKSKAEDLF 1676
             L   P  +  W  Y + E    ++ +A  +F
Sbjct: 469  FLEFDPSNLKTWIAYAELEQNLDDEERARSIF 500

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 99/229 (43%), Gaps = 21/229 (9%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            FER ++ N +   +W+ Y+   L+L  +  AR +++RA+ T+      +KL  W   L +
Sbjct: 94   FERALLVNNSYIPLWIRYIDAELKLKCINHARNLLDRAITTL---PRVDKL--WYKYLFV 148

Query: 1525 ENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQMSEKIEKAKELF-KITAKKFGSEKV 1583
            E +    + V  +F K C            +            +E++ K  A      KV
Sbjct: 149  EESLQNWDVVRSLFRKWCSLEPGINAWKSYVDFETRQNNWNNVREVYSKYVA---IHPKV 205

Query: 1584 SIWVAWGEFLIDN-------NLIDEAHEVLGNSLKSLP--TRNHIEVVRKFAQLEFSKGD 1634
            + W++W +F + +        +     +VL    K+ P    + IE    FA  E S+ +
Sbjct: 206  ATWLSWVKFEMVHGDVSTIRTVFSLGSDVLNEYEKTDPGFKEDCIEFAIAFANWEASQME 265

Query: 1635 PEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVITKK 1683
             ++ R++++ L+   P    L +  ID E + G+ S  E   E V+ K+
Sbjct: 266  YDRSRAIYKILIDKWPNDGKLQSGMIDFEKQFGDVSTME---ESVVYKR 311

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 7/102 (6%)

Query: 1599 IDEAHEVLGNSLKSLPT---RNHIEVVR--KFAQLEFSKGDPEQGRSLFEGLLADAPKRV 1653
            ++E  E  G       T   RN ++V +  ++A  E  + D  + RS+FE  L      +
Sbjct: 46   LEELKEYQGKKRTEFETYLRRNRLDVGQWMRYALFEVEQHDIRRARSVFERALLVNNSYI 105

Query: 1654 DLWNVYIDQEIKHGEKSKAEDLFERVITK--KITRKQAKFFF 1693
             LW  YID E+K    + A +L +R IT   ++ +   K+ F
Sbjct: 106  PLWIRYIDAELKLKCINHARNLLDRAITTLPRVDKLWYKYLF 147

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing factor
            of DEAH box family, required for release of mature mRNA
            from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 1250 IFQGSVKNVTDFGVFVKLDGTV--NVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKT 1307
            +++G V+N+T FG FV++ GT   N  GL H SE++D +  +  ++  +G  +   V+K 
Sbjct: 180  VYEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIKI 239

Query: 1308 NPEKKQISLGLK 1319
                K ISL +K
Sbjct: 240  QNNGK-ISLSMK 250

>KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomyces
            cerevisiae YLR117c CLF1, start by similarity
          Length = 684

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 93/232 (40%), Gaps = 30/232 (12%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            +ER ++ +     +W+ Y+   ++   +  AR +++RA   +      +KL  W   L L
Sbjct: 86   YERALLVDHGFIPLWIQYIDSEIKWKNINHARNLLDRATNAL---PRVDKL--WFKYLLL 140

Query: 1525 ENTFGTEETVEDVFTKACQY------MDSFT-MHMKLLSIYQMSEKIEKAKELFKITAKK 1577
            E + G +  V  ++T+ C +       DSF     + L+     E +      F +    
Sbjct: 141  EESLGNQGIVRGIYTRWCSFEPGPDAWDSFIEFETRCLNF----ENVRNIYSKFVLV--- 193

Query: 1578 FGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSL------PTRNHIEVVRKFAQLEFS 1631
                ++  W+ W  F   +  I     V   +L +L      P  +   V+  FA  E S
Sbjct: 194  --HPQIDTWLKWVRFEQTHGDISSVRTVFSFALDTLTSFSGTPLVDIERVIGSFASWEAS 251

Query: 1632 KGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVITKK 1683
            +G+ E+ R+L+   +   P    L    I  E K G     ED+   VI K+
Sbjct: 252  QGEYERSRTLYRLAVERWPISEALKEQQIQFEKKFGSSKNMEDI---VIAKR 300

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 1616 RNHIEVVR--KFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAE 1673
            RN +++ +  ++AQ EF + D  + RS++E  L      + LW  YID EIK    + A 
Sbjct: 58   RNRLDLRQWMRYAQFEFDQKDIRRARSIYERALLVDHGFIPLWIQYIDSEIKWKNINHAR 117

Query: 1674 DLFERVITKKITRKQAKFFFNKWLQFEE 1701
            +L +R  T  + R    +F  K+L  EE
Sbjct: 118  NLLDRA-TNALPRVDKLWF--KYLLLEE 142

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 5/105 (4%)

Query: 1573 ITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSK 1632
            I  KKF   K  +W+ + EF I  N + +A ++LG SL   P     +V + +  LE   
Sbjct: 390  IPHKKFTFGK--LWIMYAEFEIRQNNLLKARKILGVSLGKSPK---PKVFKYYINLEIRL 444

Query: 1633 GDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFE 1677
             + ++ R L+E  +   P  V  W  Y + E   G++ ++  +++
Sbjct: 445  KEFDRVRKLYEKYIDFNPSSVQSWLDYAELEENLGDEDRSRGIYD 489

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 1477 VVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNLENTFGTE 1531
            +V   Y+AF    +E EKARE+ E+ L    +      +NIWI     E+T  TE
Sbjct: 505  IVIQRYIAFETDAAEYEKARELYEKYLILSRY-----DVNIWINQALFESTIPTE 554

>KLLA0B11638g complement(1020591..1023926) similar to sp|P24384
            Saccharomyces cerevisiae YER013w PRP22 pre-mRNA splicing
            factor, start by similarity
          Length = 1111

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 1250 IFQGSVKNVTDFGVFVKLDG--TVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKT 1307
            ++ G V+NVT FG FV++ G    NV GL H SE++ + +D  +++      V   V+K 
Sbjct: 181  VYPGKVQNVTKFGCFVRIFGVRNTNVDGLVHVSELSSSHVDKPEDVVHRNQDVFVKVIKI 240

Query: 1308 NPEKKQISLGLKA 1320
                K ISL +K 
Sbjct: 241  QNNGK-ISLAMKG 252

>CAGL0D02376g complement(244241..246328) similar to tr|Q12309
            Saccharomyces cerevisiae YLR117c CLF1, start by
            similarity
          Length = 695

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 1616 RNHIEVVR--KFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAE 1673
            RN ++V +  ++A  E  + D  + RS+FE  L      V LW  YI+ E+K G  + A 
Sbjct: 56   RNRLDVKQWMRYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYIESELKLGYINHAR 115

Query: 1674 DLFERVITK 1682
            ++ ER ITK
Sbjct: 116  NILERAITK 124

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 1585 IWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFEG 1644
            IW+ + EF I  + +++A  +LG SL   P R   +  + +  LE    + ++ R L+E 
Sbjct: 402  IWILYAEFEIRQDNLEKARSILGRSLGLCPKR---KTFKYYIDLETKLREFDRVRILYEN 458

Query: 1645 LLADAPKRVDLWNVYIDQEIKHGEKSKA 1672
             L   P  +D W  Y++ E   G++ + 
Sbjct: 459  FLKFDPLNLDTWRAYVEFEDSLGDEVRV 486

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 94/256 (36%), Gaps = 54/256 (21%)

Query: 1464 DFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKT--------INFREESEKL 1515
            +FE  +  N      WM Y  F ++  ++ +AR I ERAL+         I + E   KL
Sbjct: 49   EFEGYLKRNRLDVKQWMRYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYIESELKL 108

Query: 1516 ---------------------NIWIASLNLENTFGTEETVEDVFTKAC------QYMDSF 1548
                                  +W   L +E +    + V ++F K C         DSF
Sbjct: 109  GYINHARNILERAITKLPRVDKLWYKYLIVEESLAHFDIVRNLFQKWCSLEPAAHVWDSF 168

Query: 1549 TMHMKLLSIYQMSEKIEKAKELFKITAKK-FGSEKVSIWVAWGEFLIDNNLIDEAHEVLG 1607
            T             + E+ +++  I +K      + S W  W  F +          V  
Sbjct: 169  T---------DFEVRQERYEDVRNIYSKYVLIHPQFSTWRKWINFEVRYGSTKTVRSVYS 219

Query: 1608 NSLKSL----PTRNH-----IEVVRKFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNV 1658
             +L +L     +RN      I ++ +F++ E  + +  + +SL E  +   PK   L N 
Sbjct: 220  LALDALIAYSESRNELVDDCINLIVEFSKWEALQKEYIRSKSLLEIAIQKWPKSNTLNNA 279

Query: 1659 YIDQEIKHGEKSKAED 1674
             +  E +HG     E+
Sbjct: 280  LLQFEREHGTAETLEN 295

>Kwal_55.21029
          Length = 1105

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 1250 IFQGSVKNVTDFGVFVKLDGTVN--VTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKT 1307
            I+ GSVK +T FG F+++ GT +    GL H SE+A+ ++++   L     +V   V++ 
Sbjct: 179  IYSGSVKKITTFGCFIRIQGTKDPRCDGLLHISEMANRRLEDPSELVSLNQQVYVKVIRI 238

Query: 1308 NPEKKQISLGLK 1319
                K ISL +K
Sbjct: 239  QNNGK-ISLRMK 249

>AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH]
            complement(350805..352856) [2052 bp, 683 aa]
          Length = 683

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            FER +   P   VVW+ Y+   L+  +V  AR ++ RA   +   +      +W   + +
Sbjct: 83   FERALAVAPGDVVVWLRYVDCELRARDVNHARNLLVRATALLPRVD-----KLWYKYVLM 137

Query: 1525 ENTFGTEETVEDVFTKAC 1542
            E + G  E V  V+TK C
Sbjct: 138  EESLGQVELVRGVYTKWC 155

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 1616 RNHIEVVR--KFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAE 1673
            RN ++V +  ++A  E+ + D  + RS+FE  LA AP  V +W  Y+D E++  + + A 
Sbjct: 55   RNRLDVRQWLRYAAFEYEQRDMRRARSVFERALAVAPGDVVVWLRYVDCELRARDVNHAR 114

Query: 1674 DLFERV 1679
            +L  R 
Sbjct: 115  NLLVRA 120

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 5/117 (4%)

Query: 1586 WVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFEGL 1645
            W+ + EF I    +D+A ++LG SL   P     ++ + +  LE    + ++ R L E L
Sbjct: 398  WIMYAEFEIRQEKLDKARKILGMSLGMCPK---PKLFQYYIDLEIKLKEFDRVRRLHEKL 454

Query: 1646 LADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVITKKITRKQAK--FFFNKWLQFE 1700
            L   P  +  W  Y + E   G++ +A  ++E  +T      QA+      +++QFE
Sbjct: 455  LEFQPDVLSNWIEYAELEENLGDEDRARGIYEIGLTADGGLSQARQLQLMQRYIQFE 511

>CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces
            cerevisiae YDR416w SYF1 synthetic lethal with CDC40,
            hypothetical start
          Length = 835

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 1600 DEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFE--GLLADAPKRVDLWN 1657
            D   ++L   ++ LP    I  V KF +LE S  D  + R L +    L    K  +LW 
Sbjct: 710  DSLRQLLSECIQELPNSKAITYVLKFTKLEMSLSDYTRARELLQYGAQLLPPIKNEELWG 769

Query: 1658 VYIDQEIKHGEKSKAEDLF 1676
            ++   E++HG+KS  +++ 
Sbjct: 770  LWEQFELEHGDKSYYKEML 788

>Scas_479.2
          Length = 302

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%)

Query: 1247 VGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLK 1306
            V DI   +V+ + + G +VKL    N+ G+   SE++  +I ++Q L   G    A+VL+
Sbjct: 16   VDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLR 75

Query: 1307 TNPEKKQISLG 1317
             + EK  I L 
Sbjct: 76   VDKEKGYIDLS 86

>Scas_617.9
          Length = 302

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%)

Query: 1247 VGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLK 1306
            V DI   +V+ + + G +VKL    N+ G+   SE++  +I ++Q L   G    A+VL+
Sbjct: 16   VDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLR 75

Query: 1307 TNPEKKQISLG 1317
             + EK  I L 
Sbjct: 76   VDKEKGYIDLS 86

>YJR007W (SUI2) [2909] chr10 (450934..451848) Translation initiation
            factor eIF2alpha subunit [915 bp, 304 aa]
          Length = 304

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%)

Query: 1246 NVGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVL 1305
             + DI   +V+ + + G +VKL    N+ G+   SE++  +I ++Q L   G    A+VL
Sbjct: 15   EIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVL 74

Query: 1306 KTNPEKKQISLG 1317
            + + EK  I L 
Sbjct: 75   RVDKEKGYIDLS 86

>Kwal_56.23875
          Length = 680

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 7/149 (4%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            FER +  N     +W+ Y+   L+   +  AR +++RA    N     EKL  W+  + +
Sbjct: 82   FERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRA---CNLLPRVEKL--WLKYVIV 136

Query: 1525 ENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQMSEKIEKAKELFKITAKKFGSEKVS 1584
            E + G    V  +F++ C    S   +   +       + EKA++++        +  V 
Sbjct: 137  EESLGNVSLVRSLFSRWCSLSPSKNAYDAYVGFETRCGEFEKARKVYSGYVSVHPA--VD 194

Query: 1585 IWVAWGEFLIDNNLIDEAHEVLGNSLKSL 1613
             W+ W  F   +  +D   +V    L +L
Sbjct: 195  TWLKWVAFEKRHGSLDTTRQVFSLGLDTL 223

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 1624 KFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERV 1679
            ++A+ E  + D  + RS+FE  L    + V LW  YID E+K    + A +L +R 
Sbjct: 64   RYAKFEIGQHDMRRARSIFERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRA 119

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 1586 WVAWGEFLIDNNLIDE------AHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGR 1639
            W+A+ E  ++ NL DE       H  +  +L  LP  + I ++++    E   G+ E  R
Sbjct: 465  WIAYAE--LEENLGDEDRARGIYHIAISENL-GLPNESKIGIIKRLISFETDLGEYENAR 521

Query: 1640 SLFEGLLADAPKRVDLW 1656
            +++  LLA +     +W
Sbjct: 522  AVYRTLLALSNNSAKIW 538

>Scas_705.55
          Length = 907

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 92/228 (40%), Gaps = 15/228 (6%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            +ER +  NP  S VW      +L L ++++A    ++AL  ++         +W     L
Sbjct: 113  YERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLS---NPNVPKLWHGIGIL 169

Query: 1525 ENTFGTEETVEDVFTKAC----QYMDSFTMHMKLLSIYQMSEKIEKAKELFKITAKKFGS 1580
             + +G+ +  E+ F K      Q+  +  ++ +L  IY+   K  +A E F+    +  +
Sbjct: 170  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPA 229

Query: 1581 --EKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQL----EFSKGD 1634
              ++  IW   G  L   N    A E   + L  L   NH +V+++   L      S  D
Sbjct: 230  PLQEWDIWFQLGSVLESMNEWQGAREAYEHVL--LQNENHAKVLQQLGCLYGMNNVSFYD 287

Query: 1635 PEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVITK 1682
            P++  +     L   P     W       +   + + A D F++ + +
Sbjct: 288  PQKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNR 335

>Sklu_2440.18 YDR416W, Contig c2440 29476-31950
          Length = 824

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 103/238 (43%), Gaps = 18/238 (7%)

Query: 1451 TVDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFRE 1510
            T D    IP +   +E+ I     + ++++NY  F  +    E++ +I ERA+ T     
Sbjct: 535  TCDNKDAIPSTRAAYEQAISLKIATPLIFINYAHFLQEQKLWEESFKIYERAIDTFPSDT 594

Query: 1511 ESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQMSEK----IEK 1566
              E  NI++A   L+N   ++E + D+F +A +            ++Y   E+     ++
Sbjct: 595  SFEIWNIYLAE-GLKNGL-SKERMRDLFEQAMKLAQDGLDCKPFYTLYSDFEEKNGLTKR 652

Query: 1567 AKELFKITAKKFG--SEKVSIW----VAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIE 1620
            + ++     K+      K ++W        + L D N    + E+    ++ LP    ++
Sbjct: 653  SVDILHRGCKETSHLDSKCTLWELCIYKCKKLLGDVN----SRELYEECIQDLPNSKSVK 708

Query: 1621 VVRKFAQLEFSKGDPEQGRSL--FEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLF 1676
                FA  E S GD E+ R++  F   L        LW+ + + E+++G K   +++ 
Sbjct: 709  FSLDFAVTEASHGDFERARAILNFGAQLLHPSTNQALWDYWNEFELRYGNKDTYKEML 766

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 66/158 (41%), Gaps = 23/158 (14%)

Query: 1469 IMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNLENTF 1528
            +  +P    VW N + +H++L  +E+  E     +  +  R+       WIA   L   F
Sbjct: 343  LQKSPEKQTVWENDLKYHMRL--LEQLLETHPLQVNDLKLRQNINDAKTWIARAEL---F 397

Query: 1529 GTEETVEDVFTKACQYM------------DSFTMHMKLLSIYQMSEKIEKAKELFKITAK 1576
             +     +VF +A   +            D++  + KL   Y   +  + A+E+F    +
Sbjct: 398  PSAPEKANVFAQALSKINPTKVDTPGILGDTWCRYAKL---YINKQDYDTAREIFDRATR 454

Query: 1577 KFGSEKVS---IWVAWGEFLIDNNLIDEAHEVLGNSLK 1611
               S  +    +W+ W E  +D + +++A  V+  +LK
Sbjct: 455  VPYSHLIDLEDVWICWAEMELDIDGLEKAALVIKTALK 492

>Kwal_33.15422
          Length = 302

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%)

Query: 1247 VGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLK 1306
            V D+   +V+ + + G +VKL    N+ G+   SE++  +I ++Q L   G     +VL+
Sbjct: 16   VDDVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIQKLIRVGRNEVVVVLR 75

Query: 1307 TNPEKKQISLG 1317
             + EK  I L 
Sbjct: 76   VDKEKGYIDLS 86

>Kwal_47.18684
          Length = 809

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 93/225 (41%), Gaps = 38/225 (16%)

Query: 1457 RIPESVGDFERLIMGNPNSSV--VWMNYMAFHLQLSE-VEKAREIVERALKTINFREESE 1513
            R  ES   +ER I   P      VW  Y+ + L+    +E  R++ E+AL+ ++  E  +
Sbjct: 568  RWEESFRVYERAIATFPAEVQFEVWSLYLQYSLERDRPIETLRDLFEQALRLVD--EGID 625

Query: 1514 KLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQMSEKIEKAKELFKI 1573
                +I   +LE++ G ++   D+  + C    +       L+++Q    IE++KE    
Sbjct: 626  CPTFFILYSDLEHSQGLDKRAIDILARGCVKCKNVPAQ---LTLWQTC--IERSKEYL-- 678

Query: 1574 TAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKG 1633
                 G E                    +  +    +++LP    I  V  FA+ E S  
Sbjct: 679  -----GPES-------------------SRSLYEQCIQTLPNSKAIVFVIDFAKTEESLH 714

Query: 1634 DPEQGRSL--FEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLF 1676
            +  + R+   +   L    +   LW  + + E++HG+KS  +++ 
Sbjct: 715  ENGRARAALKYGAHLLPPGRNTQLWEFWNEFELRHGDKSSYKEML 759

>Scas_570.11
          Length = 858

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 101/231 (43%), Gaps = 28/231 (12%)

Query: 1480 MNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFT 1539
            +NY  F    + + ++ +I ERA+       + E  NI++A +    +  ++E + ++F 
Sbjct: 600  INYSHFLQHHNMIMESYQIYERAIPLFTAETQYELWNIYLAEVVNPLSPLSKEHIRELFE 659

Query: 1540 KACQYMDSFTMHMKLLSIYQMSEKIEKAKELFKIT-------AKKFGS------EKVSIW 1586
             A + +  F +  K  SI+ +    E+ + L K +       A+  G        ++ +W
Sbjct: 660  HAIRTLLPFGIDCK--SIFILYSDFEEKQGLLKRSVDILWKGAQTNGQGTIHLKSRLGLW 717

Query: 1587 VAWGEFLIDNNL-IDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFE-- 1643
                 F   ++L +  + ++  + ++ +P       +  FA  E S G+  + R + E  
Sbjct: 718  NL-CLFKAQSHLGLSVSRQIYEDCIQQVPNSKSAPYIIGFADAETSGGEITRSREILEYG 776

Query: 1644 GLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFE---------RVITKKIT 1685
              L    K   LWN +   E+KHG+K   +D+ +         RV T+++T
Sbjct: 777  ARLIPPAKNTSLWNYWETFELKHGDKETYKDMLKLKRKLDVEMRVDTEQVT 827

>AGR320W [4631] [Homologous to ScYJR007W (SUI2) - SH]
            complement(1330185..1331093) [909 bp, 302 aa]
          Length = 302

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%)

Query: 1247 VGDIFQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLK 1306
            V D+   +V+ + + G +VKL    N+ G+   SE++  +I ++  L   G     +VL+
Sbjct: 16   VDDVVMVNVQQIAEMGAYVKLLEYDNIEGMVLLSELSRRRIRSIHKLIRVGKNEVVVVLR 75

Query: 1307 TNPEKKQISLG 1317
             + EK  I L 
Sbjct: 76   VDKEKGYIDLS 86

>YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential
            pre-mRNA splicing factor that plays a role in the
            initiation of DNA replication, has tetratricopeptide
            (TPR) repeats and has similarity to Drosophila crooked
            neck (crn) protein, component of Prp19p-associated
            complex [2064 bp, 687 aa]
          Length = 687

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%)

Query: 1624 KFAQLEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVIT 1681
            ++AQ E  + D  + RS+FE  L      + LW  YID E+K    + A +L  R I+
Sbjct: 70   RYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAIS 127

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            FER ++ + +   +W+ Y+   L++  +  AR ++ RA+ T+      +KL  W   L +
Sbjct: 88   FERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTL---PRVDKL--WYKYLIV 142

Query: 1525 ENTFGTEETVEDVFTKAC 1542
            E +    E V  ++TK C
Sbjct: 143  EESLNNVEIVRSLYTKWC 160

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/92 (19%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 1585 IWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSLFEG 1644
            IW+ + +FLI ++ + +A ++LG ++   P     +  + + +LE    + ++ R ++E 
Sbjct: 406  IWLMYAKFLIRHDDVPKARKILGKAIGLCPK---AKTFKGYIELEVKLKEFDRVRKIYEK 462

Query: 1645 LLADAPKRVDLWNVYIDQEIKHGEKSKAEDLF 1676
             +   P  + +W+ Y + E   G+  +   ++
Sbjct: 463  FIEFQPSDLQIWSQYGELEENLGDWDRVRGIY 494

>AAR020W [206] [Homologous to ScYER013W (PRP22) - SH]
            complement(376250..379588) [3339 bp, 1112 aa]
          Length = 1112

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 1248 GDIFQGSVKNVTDFGVFVKLDGT-VNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLK 1306
            G I++  ++N+  FG F ++ GT  +  GL H S+++ +++ +  ++   GD V   + K
Sbjct: 183  GKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQLSHSRVGSPNDVVSVGDHVYVKITK 242

Query: 1307 TNPEKKQISLGLK 1319
                 K +SL ++
Sbjct: 243  VQDNGK-LSLSMR 254

>CAGL0B03795g 376266..377177 highly similar to sp|P20459 Saccharomyces
            cerevisiae YJR007w SUI2, translation initiation factor
            eIF2, start by similarity
          Length = 303

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%)

Query: 1256 KNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPEKKQIS 1315
            + + + G +VKL    N+ G+   SE++  +I ++Q L   G    A+VL+ + EK  I 
Sbjct: 25   QQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYID 84

Query: 1316 LG 1317
            L 
Sbjct: 85   LS 86

>YDR416W (SYF1) [1241] chr4 (1298420..1300999) Pre-mRNA splicing
            factor with similarity to Drosophila crn protein, has
            tetratricopeptide (TPR) repeats, component of
            Prp19p-associated complex (Syf1p, Clf1p, Prp19p, Cef1p,
            Isy1p, Snt309p, Ntc20p, Syf2p) [2580 bp, 859 aa]
          Length = 859

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 1603 HEVLGNSLKSLPTRNHIEVVRKFAQLEFSKGDPEQGRSL--FEGLLADAPKRVDLWNVYI 1660
             E+    ++ LP    +E V KF+  E S G+  + R +  +   L    +  +LW+ + 
Sbjct: 726  RELYQECIQILPNSKAVEFVIKFSDFESSIGETIRAREILAYGAKLLPPSRNTELWDSFE 785

Query: 1661 DQEIKHGEKSKAEDLF 1676
              E+KHG+K   +D+ 
Sbjct: 786  IFELKHGDKETYKDML 801

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
            repressor of RNA polymerase II transcription that is
            brought to target promoters by sequence-specific
            DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex undergoes
            Hog1p-dependent conversion to a transcriptional activator
            [2901 bp, 966 aa]
          Length = 966

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 59/135 (43%), Gaps = 9/135 (6%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            +ER ++ NP  S VW      +L L ++++A    ++AL  ++         +W     L
Sbjct: 103  YERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLS---NPNVPKLWHGIGIL 159

Query: 1525 ENTFGTEETVEDVFTKACQYMDSF----TMHMKLLSIYQMSEKIEKAKELFKITAKKFGS 1580
             + +G+ +  E+ F K  +    F     ++ +L  IY+   K  +A E F+    +  +
Sbjct: 160  YDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPA 219

Query: 1581 --EKVSIWVAWGEFL 1593
              ++  IW   G  L
Sbjct: 220  PLQEWDIWFQLGSVL 234

>Kwal_26.7204
          Length = 1117

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 259 LDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKRSGRTVNVNLDLASKNTKV 312
           L+I ++NL  F+S++ + EF+ L    + + TV     R+VNVNL  + KN K 
Sbjct: 193 LNIQLDNLCQFLSQERVEEFARLKSDKLLMETV-----RSVNVNLLESFKNLKT 241

>Kwal_23.3670
          Length = 802

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 58/135 (42%), Gaps = 9/135 (6%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            ++R +  NP    +W      +L L ++++A    ++AL  ++         +W     L
Sbjct: 123  YQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLS---NPNVPKLWHGIGIL 179

Query: 1525 ENTFGTEETVEDVFTKAC----QYMDSFTMHMKLLSIYQMSEKIEKAKELFK--ITAKKF 1578
             + +G+ +  E+ F K      Q+  +  ++ +L  IY+   K  +A E F+  +T    
Sbjct: 180  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILTQPPA 239

Query: 1579 GSEKVSIWVAWGEFL 1593
              ++  +W   G  L
Sbjct: 240  PLQEWDVWFQLGSVL 254

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
            Saccharomyces cerevisiae YBR112c CYC8 general repressor
            of transcription singleton, hypothetical start
          Length = 941

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/135 (20%), Positives = 57/135 (42%), Gaps = 9/135 (6%)

Query: 1465 FERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTINFREESEKLNIWIASLNL 1524
            ++R +  NP    +W      +L L E++ A    ++AL  ++         +W     L
Sbjct: 165  YQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLS---NPNIPKLWHGIGIL 221

Query: 1525 ENTFGTEETVEDVFTKAC----QYMDSFTMHMKLLSIYQMSEKIEKAKELFKITAKKFGS 1580
             + +G+ +  E+ F K      Q+  +  ++ +L  IY+   K  +A E F+    +  +
Sbjct: 222  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILPQPPA 281

Query: 1581 --EKVSIWVAWGEFL 1593
              ++  +W   G  L
Sbjct: 282  PLQEWDVWFQLGSVL 296

>KLLA0D16148g 1361758..1362561 highly similar to sp|P40545
            Saccharomyces cerevisiae YIL020c HIS6 5 Pro-FAR isomerase
            singleton, start by similarity
          Length = 267

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 1487 LQLSEV-EKAREIVERALKTINFREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYM 1545
            ++L+E+  K R +V+ + K +   ++  K   W+ ++N   T    E  E  F   CQY 
Sbjct: 121  VKLAEICGKDRLVVDLSCKRVTKPDQEPK---WVVAMNKWQTLTDLELNERTFADLCQYT 177

Query: 1546 DSFTMH 1551
            D F +H
Sbjct: 178  DEFLVH 183

>YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.1950p [879 bp, 292 aa]
          Length = 292

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 851 QKTDVKKI-NSSVINPVDKSIKDLSDF--TIGKVTKATITSVKKNQLNVTLADNVHGRIS 907
           QK  +K I N S++N   K  ++L+ +  T      AT TSV   Q N  +   + G   
Sbjct: 68  QKRRLKFIRNGSILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYI-HCIIGTEE 126

Query: 908 ISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKF 949
           +++   + ED+K+   P      NDS++ + IGF  ++S  F
Sbjct: 127 LTQAELANEDLKDDATP-----SNDSMTTQAIGFDRLRSVGF 163

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 50,876,197
Number of extensions: 2180984
Number of successful extensions: 7802
Number of sequences better than 10.0: 69
Number of HSP's gapped: 7868
Number of HSP's successfully gapped: 107
Length of query: 1703
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1587
Effective length of database: 12,580,421
Effective search space: 19965128127
Effective search space used: 19965128127
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)