Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08217g1439141769960.0
YOR291W1472141243560.0
Kwal_26.92071469118843210.0
CAGL0M11308g1452142642890.0
AFR567W1449117641420.0
Scas_665.301439118941220.0
KLLA0E22352g12067538282e-91
CAGL0L01419g12147307831e-85
YEL031W (SPF1)12157377723e-84
AFR354C12107527707e-84
Scas_583.14*8755435322e-55
Kwal_14.14989398453578e-34
CAGL0A00517g11228363425e-32
AEL301W9578043327e-31
YGL167C (PMR1)9508593192e-29
Kwal_47.1754712408873168e-29
KLLA0A08910g12808513113e-28
KLLA0A03157g9388213103e-28
CAGL0J01870g9468753069e-28
YGL006W (PMC1)11738253032e-27
CAGL0I04312g9518612971e-26
Scas_707.48*7417862808e-25
Kwal_23.316011008482801e-24
Sklu_2193.111435402657e-23
ADL079C11667862641e-22
YIL048W (NEO1)11516552622e-22
Kwal_23.578911337292522e-21
KLLA0E14630g10828482495e-21
KLLA0F20658g10828332451e-20
KLLA0C08393g11485492406e-20
AGL097C10968402399e-20
Scas_704.3811617022326e-19
CAGL0L00715g11447062183e-17
KLLA0A04015g13434982149e-17
CAGL0K12034g10873142111e-16
Kwal_26.707013154862084e-16
ADR350W13113072041e-15
Scas_499.33461461908e-15
CAGL0G06270g13284581951e-14
Scas_297.18002781922e-14
AFL011W12423111914e-14
AGR120C15474171852e-13
YDR039C (ENA2)10913211808e-13
YDR038C (ENA5)10913211799e-13
YDR040C (ENA1)10913211781e-12
YDR093W (DNF2)16123281672e-11
KLLA0C17644g15763301673e-11
YAL026C (DRS2)13553031647e-11
Scas_576.815913211565e-10
YER166W (DNF1)15713221549e-10
Scas_89.12712121461e-09
YMR162C (DNF3)16562501512e-09
Scas_636.1615543241476e-09
YGL008C (PMA1)9182461466e-09
KLLA0E01650g15502491451e-08
CAGL0H04477g16262501441e-08
CAGL0L11814g15763301432e-08
Kwal_23.355615972511423e-08
KLLA0A09031g8993561413e-08
AFL191W15752061386e-08
CAGL0G08085g15783341342e-07
AGL085C9092521314e-07
Scas_669.316382511315e-07
Scas_569.0d4681271278e-07
Scas_688.19132751233e-06
YPL036W (PMA2)9472751234e-06
Scas_710.419042431225e-06
Kwal_47.175228992751181e-05
YBR295W (PCA1)12162421101e-04
CAGL0A00495g9024551101e-04
Kwal_55.21575989491000.002
CAGL0M08602g101250940.009
KLLA0F07447g97550940.010
Scas_615.994249900.028
ACR086C81049900.028
YDR270W (CCC2)1004108880.043
KLLA0D04092g1152306870.066
Scas_505.4102570850.096
AGL041C1233234761.1
CAGL0B01485g67478761.1
KLLA0D00858g54137704.8
YGR003W (CUL3)74482705.9
Scas_584.536748696.5
YBL106C (SRO77)1010149697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08217g
         (1417 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...  2699   0.0  
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...  1682   0.0  
Kwal_26.9207                                                         1669   0.0  
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...  1656   0.0  
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...  1600   0.0  
Scas_665.30                                                          1592   0.0  
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...   323   2e-91
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...   306   1e-85
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...   301   3e-84
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...   301   7e-84
Scas_583.14*                                                          209   2e-55
Kwal_14.1498                                                          142   8e-34
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   136   5e-32
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   132   7e-31
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   127   2e-29
Kwal_47.17547                                                         126   8e-29
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   124   3e-28
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   124   3e-28
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...   122   9e-28
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   121   2e-27
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   119   1e-26
Scas_707.48*                                                          112   8e-25
Kwal_23.3160                                                          112   1e-24
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         106   7e-23
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   106   1e-22
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   105   2e-22
Kwal_23.5789                                                          101   2e-21
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   100   5e-21
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    99   1e-20
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    97   6e-20
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    97   9e-20
Scas_704.38                                                            94   6e-19
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    89   3e-17
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    87   9e-17
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    86   1e-16
Kwal_26.7070                                                           85   4e-16
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    83   1e-15
Scas_499.3                                                             78   8e-15
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    80   1e-14
Scas_297.1                                                             79   2e-14
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    78   4e-14
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    76   2e-13
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    74   8e-13
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    74   9e-13
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    73   1e-12
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    69   2e-11
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    69   3e-11
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    68   7e-11
Scas_576.8                                                             65   5e-10
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    64   9e-10
Scas_89.1                                                              61   1e-09
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    63   2e-09
Scas_636.16                                                            61   6e-09
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    61   6e-09
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    60   1e-08
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    60   1e-08
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    60   2e-08
Kwal_23.3556                                                           59   3e-08
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    59   3e-08
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    58   6e-08
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    56   2e-07
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    55   4e-07
Scas_669.3                                                             55   5e-07
Scas_569.0d                                                            54   8e-07
Scas_688.1                                                             52   3e-06
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    52   4e-06
Scas_710.41                                                            52   5e-06
Kwal_47.17522                                                          50   1e-05
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    47   1e-04
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    47   1e-04
Kwal_55.21575                                                          43   0.002
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    41   0.009
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    41   0.010
Scas_615.9                                                             39   0.028
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    39   0.028
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    39   0.043
KLLA0D04092g complement(344666..348124) some similarities with s...    38   0.066
Scas_505.4                                                             37   0.096
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    34   1.1  
CAGL0B01485g 132868..134892 similar to tr|Q08282 Saccharomyces c...    34   1.1  
KLLA0D00858g complement(80327..81952) similar to sp|P38628 Sacch...    32   4.8  
YGR003W (CUL3) [1974] chr7 (500134..502368) Member of the cullin...    32   5.9  
Scas_584.5                                                             31   6.5  
YBL106C (SRO77) [97] chr2 complement(10847..13879) Protein that ...    31   7.4  

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 2699 bits (6996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1317/1417 (92%), Positives = 1317/1417 (92%)

Query: 1    MSSFDSRFTGIPHSANKSARPSFXXXXXXXXXXXXXXXAILEQNNTEPYSGAAVETVPSS 60
            MSSFDSRFTGIPHSANKSARPSF               AILEQNNTEPYSGAAVETVPSS
Sbjct: 1    MSSFDSRFTGIPHSANKSARPSFSSTRTGSSANTTTSSAILEQNNTEPYSGAAVETVPSS 60

Query: 61   IVSFYHPHSFQXXXXXXXXXXXTNLERRGRSSEHDPXXXXXXXXXXXXXXXGRGFQFFTE 120
            IVSFYHPHSFQ           TNLERRGRSSEHDP               GRGFQFFTE
Sbjct: 61   IVSFYHPHSFQSSGYGASAGSSTNLERRGRSSEHDPLLLSTTTSRRSSSSRGRGFQFFTE 120

Query: 121  EQVENAEGITSSVENADYDMDWDAIPTYEQERLHIQPRSSKTSLRQDGNDYAMRTFTPNR 180
            EQVENAEGITSSVENADYDMDWDAIPTYEQERLHIQPRSSKTSLRQDGNDYAMRTFTPNR
Sbjct: 121  EQVENAEGITSSVENADYDMDWDAIPTYEQERLHIQPRSSKTSLRQDGNDYAMRTFTPNR 180

Query: 181  KYSVRSRKSEXXXXXXXXXXXXXXXXXXXXXXIPAELEISTTHDVXXXXXXXXXXXXXXX 240
            KYSVRSRKSE                      IPAELEISTTHDV               
Sbjct: 181  KYSVRSRKSEDRLYSTSPRSSSSSSRYTLRDRIPAELEISTTHDVDDSELRSSASSESED 240

Query: 241  XXXXXXXXYNSRAEEDQEQNKKSYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVA 300
                    YNSRAEEDQEQNKKSYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVA
Sbjct: 241  EEAEANDDYNSRAEEDQEQNKKSYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVA 300

Query: 301  IAGYRTSRFRLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGE 360
            IAGYRTSRFRLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGE
Sbjct: 301  IAGYRTSRFRLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGE 360

Query: 361  LTVESVKRRWYNRPLSTVLMETNEDRIGTPESRHYHHHETEWNPNLPILISFQYRYFTLV 420
            LTVESVKRRWYNRPLSTVLMETNEDRIGTPESRHYHHHETEWNPNLPILISFQYRYFTLV
Sbjct: 361  LTVESVKRRWYNRPLSTVLMETNEDRIGTPESRHYHHHETEWNPNLPILISFQYRYFTLV 420

Query: 421  YSPIDDIFRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDE 480
            YSPIDDIFRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDE
Sbjct: 421  YSPIDDIFRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDE 480

Query: 481  ALHPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEV 540
            ALHPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEV
Sbjct: 481  ALHPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEV 540

Query: 541  RVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKY 600
            RVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKY
Sbjct: 541  RVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKY 600

Query: 601  AATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKG 660
            AATEATMAQLLQD              LFNGTKIIRVRNQPGQGMALALVIRTGFSTTKG
Sbjct: 601  AATEATMAQLLQDFKSSQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKG 660

Query: 661  SLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDII 720
            SLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDII
Sbjct: 661  SLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDII 720

Query: 721  TIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDV 780
            TIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDV
Sbjct: 721  TIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDV 780

Query: 781  LGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHI 840
            LGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHI
Sbjct: 781  LGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHI 840

Query: 841  DGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNL 900
            DGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNL
Sbjct: 841  DGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNL 900

Query: 901  IGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYT 960
            IGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYT
Sbjct: 901  IGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYT 960

Query: 961  HNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNA 1020
            HNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNA
Sbjct: 961  HNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNA 1020

Query: 1021 NIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDA 1080
            NIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDA
Sbjct: 1021 NIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDA 1080

Query: 1081 VTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVE 1140
            VTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVE
Sbjct: 1081 VTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVE 1140

Query: 1141 QLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDISCVLDVIKEGR 1200
            QLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDISCVLDVIKEGR
Sbjct: 1141 QLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDISCVLDVIKEGR 1200

Query: 1201 ASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPN 1260
            ASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPN
Sbjct: 1201 ASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPN 1260

Query: 1261 SKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSD 1320
            SKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSD
Sbjct: 1261 SKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSD 1320

Query: 1321 NTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLMYLNVQTWLGE 1380
            NTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLMYLNVQTWLGE
Sbjct: 1321 NTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLMYLNVQTWLGE 1380

Query: 1381 LLQLTNISDTFKWLILTTAAANYYASKYIPEKFKHLF 1417
            LLQLTNISDTFKWLILTTAAANYYASKYIPEKFKHLF
Sbjct: 1381 LLQLTNISDTFKWLILTTAAANYYASKYIPEKFKHLF 1417

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 1682 bits (4356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 830/1412 (58%), Positives = 1032/1412 (73%), Gaps = 44/1412 (3%)

Query: 40   ILEQNNTEPYSGAAVETVPSSIVSFYHPHSFQXXXXXXXXXXXTNLERRGRS-SEHDPXX 98
            +L+QNN+EPY+GA  E VPSSIVSF+HPHSFQ            NLE+RGR  +E +P  
Sbjct: 43   VLDQNNSEPYAGATFEAVPSSIVSFHHPHSFQ-SSNLPSPHSSGNLEQRGRRLTESEPLV 101

Query: 99   XXXXXXXXXXXXXGRGFQFFTEEQVENAEGITSSVENADYDMDWDAIPTYEQERLH---- 154
                            F+FFT+EQ+ NAEG  S++EN DYDM WDA P YEQ+R++    
Sbjct: 102  LSSAEQSRSSSRNPSHFRFFTQEQISNAEG-ASTLENTDYDMAWDATPAYEQDRIYGTGL 160

Query: 155  --------IQPRSSKTSLRQDGNDYAMRTFTPNRKYSVRSRKSEXX-XXXXXXXXXXXXX 205
                       R+S  S  +    ++ R  + +R        S+                
Sbjct: 161  SSRRSSIRSFSRASSLSNAKSYGSFSKRGRSGSRAPQRLGENSDTGFVYHSATHSSSSLS 220

Query: 206  XXXXXXXIPAELEISTTHDVXXXXXXXXXXXXXXXXXXXXXXXYNSRAEEDQEQNKKSYH 265
                   IP ELE S T ++                         S +  D   N+   H
Sbjct: 221  RYTTRERIPIELE-SQTDEILEDESSTHSLESSDSRRSASENNRGSFSGHDDVHNQ---H 276

Query: 266  SEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAIAGYRTSRFRLQCYYLLCIITLGLA 325
            SE+LKP YH +F+P   P LHYQRFYIAEEDLV+ IA Y+TS+F    Y L C +T GL 
Sbjct: 277  SEYLKPDYHEKFYPQYAPNLHYQRFYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLV 336

Query: 326  FLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGELTVESVKRRWYNRPLSTVL-METNE 384
            +L+ RW P ++VK+ G K PL KAEWVV+ENEFGE  ++ + R+WYNRPLSTVL  E   
Sbjct: 337  YLLTRWLPHLKVKLYGVKVPLAKAEWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYP 396

Query: 385  DRIGTPESRHY-HHHETEWNPNLPILISFQYRYFTLVYSPIDDIFRSNSNWADPDWLDLE 443
            +    P   +  HHH  E NPN+PILI+F+YRY   +YSP+DD+F++N+NW DPDW+DL 
Sbjct: 397  NPSYEPNDINLSHHHANEINPNVPILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLS 456

Query: 444  VVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALHPFYVFQIFSIILWLADDYYY 503
             V +GLT  +QEDR LAFGKN +NL+ KT +EILF+E LHPFYVFQ+FSIILW  D+YYY
Sbjct: 457  TVSNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYY 516

Query: 504  YAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDLFE 563
            YA CIFLISVLSI D++ E KK S  LA++SHF+C+VRV +D+FWT ++SS+LVPGD++E
Sbjct: 517  YAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYE 576

Query: 564  ISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXXXX 623
            +SDP++ +LPCD++L+S DCIVNESMLTGESVPVSK+ ATE TM QL  D          
Sbjct: 577  VSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFV 636

Query: 624  XXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKY 683
                L+NGT IIR R  PGQ  ALA+V+RTGFSTTKGSLVRSMVFPKP GFKFY DSFKY
Sbjct: 637  SKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKY 696

Query: 684  IGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRL 743
            IGFM+LIA+FGF +SC+QFI+LGL+ K MILRALDIITIVVPPALPATLTIGT+FAL RL
Sbjct: 697  IGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTIGTNFALSRL 756

Query: 744  KKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITD 803
            K+KGIFCISPTR+N+ GK+D+MCFDKTGTLTE+GLDVLG+  ++P G     +  +L++D
Sbjct: 757  KEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRG-QKFGELLSD 815

Query: 804  CDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEE 863
              +V  K +L+DC+S  +FK++NF +SLLTCHSL+ +DG LLGDPLD KMF+FT W++EE
Sbjct: 816  IRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEE 875

Query: 864  GYESWKF------KNAED----KTGISPAVVHPTSN---CNFIENDPDNLIGVIRSFEFL 910
             ++   F      ++ +D     + I PAVVHP SN     F +NDP N +GV+RSFEFL
Sbjct: 876  DFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFL 935

Query: 911  SELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACA 970
            SELRRMSVIVK   ++ YWSFTKGAPEVI++ICN +T+P DF E+L  YTHNG+R+IACA
Sbjct: 936  SELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACA 995

Query: 971  GKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGD 1030
            GKTLPK +WLYSQKVSREEVE NLEFLGFI+F+NKLK  T   LK LQ+ANIRT+MCTGD
Sbjct: 996  GKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGD 1055

Query: 1031 NVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPL---N 1087
            N+LTA+SVGR++GLI   RV++P +ND       ++ WRDV+E   +LD  TLKP+   N
Sbjct: 1056 NILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGN 1115

Query: 1088 DP-----EKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQL 1142
            +      E +YTLA++GD+FR+LFR++  +P++Y++ +L+  SIYARMSPDEKHEL+ QL
Sbjct: 1116 NSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQL 1175

Query: 1143 QKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDISCVLDVIKEGRAS 1202
            QKLDY VGFCGDGANDCGALKAA++GISLSEAEASVAAPFTS +F+ISCVLDVI+EGRA+
Sbjct: 1176 QKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRAA 1235

Query: 1203 LVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSK 1262
            LVTSF+CFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAI MSWSK   K
Sbjct: 1236 LVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEK 1295

Query: 1263 LVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSDNT 1322
            + KKRPSANLVSPKILVPL +++ L+ +FQ +PWI VQ  SWY+KP+VGGDDAVQSSDNT
Sbjct: 1296 IDKKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNT 1355

Query: 1323 VLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLMYLNVQTWLGELL 1382
            VLFFVSNFQYILTA+VLS GPPYREPM KN  FI+DI++S+  S  LM L+ +++LG++L
Sbjct: 1356 VLFFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGASLLLMTLDTESYLGKML 1415

Query: 1383 QLTNISDTFKWLILTTAAANYYASKYIPEKFK 1414
            QLT IS++F   I+     NYYA  YIP   K
Sbjct: 1416 QLTPISNSFTMFIIVWVILNYYAQLYIPPSIK 1447

>Kwal_26.9207
          Length = 1469

 Score = 1669 bits (4321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 790/1188 (66%), Positives = 958/1188 (80%), Gaps = 25/1188 (2%)

Query: 250  NSRAEEDQEQNKK--SYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAIAGYRTS 307
            NS  ++  E  KK  SYH+E+LKPQYH RFFP N+P+L +QRFYIAEEDLVV IAG+RTS
Sbjct: 265  NSSQDQASETKKKTSSYHAEYLKPQYHDRFFPQNIPHLQFQRFYIAEEDLVVGIAGFRTS 324

Query: 308  RFRLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGELTVESVK 367
            +F   CYYL+ +ITLGL +L+ RW P  +V++ G+KT L KAEWVVVENEFGEL++  V 
Sbjct: 325  KFGKICYYLMSVITLGLFYLLLRWVPRYKVRLCGKKTHLAKAEWVVVENEFGELSIIEVS 384

Query: 368  RRWYNRPLSTVLMETNEDRIG-----TPESRHYHHHETEWNPNLPILISFQYRYFTLVYS 422
            RRWYNRPLST+L   + D+I       P     HHHE++ NPN+PI+ISF YRYF L+YS
Sbjct: 385  RRWYNRPLSTLL---SMDKIADITEDIPNHHQRHHHESKENPNIPIMISFSYRYFNLIYS 441

Query: 423  PIDDIFRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEAL 482
            PI+D+F+ NSNW D DWL L  +Q GL +S+ EDR LAFG+N++NLKQKT  EILFDE L
Sbjct: 442  PIEDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLEILFDEVL 501

Query: 483  HPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRV 542
            HPFYVFQIFSI+LWLAD+YYYYA CIF+IS+LSIIDT++ETKK S++LA++SH +CEVRV
Sbjct: 502  HPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRV 561

Query: 543  YKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAA 602
            Y+D FW QV+SS+LVPGD++EISDPSL   PCD++L+SGDCIVNESMLTGESVPVSK  A
Sbjct: 562  YRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVSKIPA 621

Query: 603  TEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSL 662
            ++ T+ QLL+D              LFNGTKIIRVR    Q  ALA+V+RTGFSTTKGSL
Sbjct: 622  SDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSL 681

Query: 663  VRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITI 722
            +RSM+FPKP GFKFYEDSFKYIGFMTLIA+ GFSISCI FIRLGL YKVMILRALDIITI
Sbjct: 682  LRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITI 741

Query: 723  VVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLG 782
            VVPPALPATL+IG SFA+ RLKKKGIFCI+PTRVNV GK+D+MCFDKTGTLTE+GLDVLG
Sbjct: 742  VVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLG 801

Query: 783  IHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDG 842
            +H A+P+G     +   LIT+   +  K++L+DC S  +FK++NFLVSLLTCHSL+ +DG
Sbjct: 802  VHVAEPQGHQN-FRFGALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDG 860

Query: 843  ELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDK----------TGISPAVVHPTSNC-- 890
            ELLGDPLD KMF+FT W+Y E ++ +KF +  ++           GI+PAVVHP +    
Sbjct: 861  ELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTE 920

Query: 891  -NFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIP 949
              F ENDP NL+GVIRSFEF+SELRRMSVIVK + EN +W FTKGAPEVI++ICN +T+P
Sbjct: 921  NKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLP 980

Query: 950  KDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSR 1009
             ++ ++L  YTHNG+R+IACAGKTLPK +W ++QKVSREEVE N+EFLGF+VFENKLK  
Sbjct: 981  ANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPS 1040

Query: 1010 TKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWR 1069
            T   L  LQ+A IR++MCTGDNVLTA+SVGR+SGLI+   VF+P +NDN++ +  L+ WR
Sbjct: 1041 TTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWR 1100

Query: 1070 DVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYAR 1129
            DVD+   +LD VTL+P+N     YT+A+TGD+FR+LF+N+E+LP+ YI+ VL+K SIYAR
Sbjct: 1101 DVDDCDLILDGVTLEPMNG-SSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYAR 1159

Query: 1130 MSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDI 1189
            MSPDEKHELV QLQ LDY VGFCGDGANDCGALKAA++G+SLSEAEASVAAPFTS+VF+I
Sbjct: 1160 MSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVFEI 1219

Query: 1190 SCVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVP 1249
            SC+LDVIKEGRASL TSFSCFQYMSLYSAIQF+T+T+LYSRG NLGDFQFLYIDL LIVP
Sbjct: 1220 SCILDVIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVP 1279

Query: 1250 IAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPV 1309
            IAI MSWSKP  KLVKKRPSANLVSPKIL PL  NI +IL+FQ  PW+ VQ   WY  PV
Sbjct: 1280 IAIFMSWSKPYHKLVKKRPSANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAPV 1339

Query: 1310 VGGDDAVQSSDNTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGL 1369
            VGGDDAVQSSDNTVLFF SNFQY+LTA+VLS GPPYREPM KN+GFI D+ +S++++  L
Sbjct: 1340 VGGDDAVQSSDNTVLFFFSNFQYVLTAIVLSVGPPYREPMSKNLGFITDVVISIILNVVL 1399

Query: 1370 MYLNVQTWLGELLQLTNISDTFKWLILTTAAANYYASKYIPEKFKHLF 1417
            M + V + LG++ QLT+IS  FK  +L  A  NY+A  YIP + K LF
Sbjct: 1400 MMVPVDSTLGKVFQLTDISSGFKGYLLIWAVLNYFAQLYIPCRCKGLF 1447

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 87/166 (52%), Gaps = 1/166 (0%)

Query: 1   MSSFDSRFTGIPHSANKSARPSFXXXXXXXXXXXXXXXAILEQNNTEPYSGAAVETVPSS 60
           MS+ D    G  +  N   RPSF                +++ N+TE Y+GA  ETVPSS
Sbjct: 1   MSNSDLSHRGSTNGRNSRMRPSFSSARTGSSSNTLTSATVVDNNSTEAYAGATFETVPSS 60

Query: 61  IVSFYHPHSFQXXXXXXXXXXXTNLERRGRSSEHDPXXXXXXXXXXXXX-XXGRGFQFFT 119
           IVSF+HPHSF             + E   RS E +                    F++F+
Sbjct: 61  IVSFHHPHSFHTNGNSMLESASNSNELHSRSHEAESLLSSRHSYSRSQGPSRTPNFRYFS 120

Query: 120 EEQVENAEGITSSVENADYDMDWDAIPTYEQERLHIQPRSSKTSLR 165
           EE++E AEG++S++E+ADYD++WD  PTYEQERLH    S ++S+R
Sbjct: 121 EEEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGRSSIR 166

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 1656 bits (4289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 813/1426 (57%), Positives = 1018/1426 (71%), Gaps = 27/1426 (1%)

Query: 14   SANKSARPSFXXXXXXXXXXXXXXXAILEQNNTEPYSGAAVETVPSSIVSFYHPHSFQXX 73
            S  +  R SF                I++ NN+E Y+GAA E VPSSIVSF+ PHSFQ  
Sbjct: 10   SHAQRTRASFSSARSNATSATLTSSVIIDHNNSESYAGAAFEAVPSSIVSFHRPHSFQSS 69

Query: 74   XXXXXXXXXTNLERRGRSSEHDPXXXXXXXXXXXXXXXGRGFQFFTEEQVENAEGITSSV 133
                       LER    + H+                 R F+FFT+EQV  AEGI +++
Sbjct: 70   HMMGSSLNSNMLERT-TGAIHETEPLYQGNDHSRSSSNNRNFRFFTDEQVSQAEGI-ATL 127

Query: 134  ENADYDMDWDAIPTYEQE-RLHIQPRSSKTSLRQDGNDYAMRT-----FTPNRKYSVRSR 187
            EN DYD+DWDA P YEQE R      S ++S+R      ++ T          + + +SR
Sbjct: 128  ENTDYDIDWDAAPAYEQENRAGSYMGSRRSSIRDISRRSSLSTSPYGSIDHRGRSASKSR 187

Query: 188  KSEXXXXXXXXXXXXXXXXXXXXXXIPAELEISTTHDVXXXXXXXXXXXXXXXXXXXXXX 247
                                     IP E+E    + +                      
Sbjct: 188  PRYDQVYQTSTHSSSSLSRYSVRERIPVEVEDQDDNSLDVHSSDQSLASSHSNTSNYGGN 247

Query: 248  XYNSRAEEDQEQNKKSYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAIAGYRTS 307
              +    +D  Q K   H EFLKPQYH +F+P      H QR YI+EED+V+ IAGY+TS
Sbjct: 248  EGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEFKADRHIQRAYISEEDMVIVIAGYKTS 307

Query: 308  RFRLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGELTVESVK 367
            +F    Y LLCI TLG  FL+ +W P  +V+++G K PL KAEW+V+ENE GE T+E   
Sbjct: 308  KFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIVGRKAPLAKAEWLVLENEHGEFTIEEPT 367

Query: 368  RRWYNRPLSTVLMETNEDRIGTPESRH---YHHHETEWNPNLPILISFQYRYFTLVYSPI 424
            R WYNR LST+LM   + +  T E  H    HHH +E NPNLPILISFQYRY   VYSP+
Sbjct: 368  REWYNRTLSTILML--DSKTETEEFEHGFQRHHHTSEENPNLPILISFQYRYIKFVYSPL 425

Query: 425  DDIFRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALHP 484
            DDIF++N+NW D DW+DLE    GL+S IQEDR LAF KN +NLK KT ++ILFDE LHP
Sbjct: 426  DDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDRVLAFDKNQINLKMKTTSQILFDEVLHP 485

Query: 485  FYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYK 544
            FY+FQ+ SIILW  D+YYYYAGCIFLIS+LSI+DT+IETKK S  LA++SHFNCEVRV +
Sbjct: 486  FYIFQVLSIILWSLDEYYYYAGCIFLISLLSILDTLIETKKISRTLAEMSHFNCEVRVLR 545

Query: 545  DRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAATE 604
            + FW+ ++SS+LVPGD++EISDP+L +LPCD++L+SGDCIVNESMLTGESVPVSKY A+E
Sbjct: 546  EGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASE 605

Query: 605  ATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVR 664
             T+ QL  D              LFNGT +IR +   G  +ALA+ +RTGFSTTKGSL+R
Sbjct: 606  ETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIR 665

Query: 665  SMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVV 724
            SMVFPKP GFKFY DSFKYIGFM +IA FGFSISCI FI+LGL+ + MILRALDIITIVV
Sbjct: 666  SMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRTMILRALDIITIVV 725

Query: 725  PPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIH 784
            PPALPATLTIGTSFAL RLK+KGIFCI+PTRVN+GGK+D+MCFDKTGTLTE+GLDVLG+ 
Sbjct: 726  PPALPATLTIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVR 785

Query: 785  FAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGEL 844
             +    +      SDLI+D  ++  K +L DC++ +++K +NFL+SLLTCHSL+ +DGEL
Sbjct: 786  VS-CAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVVDGEL 844

Query: 845  LGDPLDLKMFEFTKWAYEEGYESWKF----------KNAEDKTGISPAVVHPTSN---CN 891
            LGDPLD KMF+FT W+YEE +++ +F          +N  +   I PA+VHP  +     
Sbjct: 845  LGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNK 904

Query: 892  FIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKD 951
            F++NDP+N++G+IRSFEFLSELRRMSVIVK   EN YW++TKGAPEVI DICNPAT+P D
Sbjct: 905  FVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSD 964

Query: 952  FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTK 1011
            + ++L+ YTH+G+R+IACAGKTLPK++WLYSQKV REEVE N+EFLGFI+F+NKLK  T 
Sbjct: 965  YDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATS 1024

Query: 1012 AALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDV 1071
              L +L+ ANIRTVMCTGDNVLTA+SVG++  LI+ +RV++P +  +    + ++ W ++
Sbjct: 1025 PTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEI 1084

Query: 1072 DEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMS 1131
                 +LD  TL+P++D    YTLAITG++FRI+F N +   ++Y++ +L+KGSI+ARMS
Sbjct: 1085 SNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMS 1144

Query: 1132 PDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDISC 1191
            PDEKHELVEQLQK+DY VGFCGDGANDCGALKAA++GISLSEAEASVAAPFTS +FDI+C
Sbjct: 1145 PDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFDITC 1204

Query: 1192 VLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIA 1251
            VLDVIKEGRASLVTSF+CFQYMSLYSAIQFI+ITILYSRGSNLGDFQFLYIDLLLI+PIA
Sbjct: 1205 VLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLIIPIA 1264

Query: 1252 ISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVVG 1311
            ++MSWSKP  +L KKRPSANLVSPKILVPL L+I  + +FQ LPWI +Q   WY+KP+VG
Sbjct: 1265 VTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFLPWIWIQGRPWYIKPIVG 1324

Query: 1312 GDDAVQSSDNTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLMY 1371
            GDDAVQSSDNTVLF++SNFQYILT+VVLS GPPYREP+  N+ ++ DI+LS+LVSF +M 
Sbjct: 1325 GDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQYVRDIALSVLVSFVIML 1384

Query: 1372 LNVQTWLGELLQLTNISDTFKWLILTTAAANYYASKYIPEKFKHLF 1417
            +N  + LG LLQLT+I      LI      NYY   ++P K K  F
Sbjct: 1385 VNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPPKVKQYF 1430

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 1600 bits (4142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/1176 (64%), Positives = 937/1176 (79%), Gaps = 18/1176 (1%)

Query: 253  AEEDQEQNKKSYHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAIAGYRTSRFRLQ 312
            +E      KK+YH+E+LKP+YH RF+P NVP+LH QRFYIAEED+VV IAGYRTS ++  
Sbjct: 259  SEPQYVSGKKAYHAEYLKPRYHDRFYPRNVPHLHMQRFYIAEEDMVVGIAGYRTSAWKTY 318

Query: 313  CYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGELTVESVKRRWYN 372
             Y + C +TLG+ +++ +W P  +VK  G KT LGKAEWVVVEN++ EL++ +VKR WYN
Sbjct: 319  IYNIFCCLTLGMLYILCKWIPRYKVKFCGSKTFLGKAEWVVVENQYSELSIINVKRIWYN 378

Query: 373  RPLSTVLMETNEDRIGTPESRHYHHHETEWNPNLPILISFQYRYFTLVYSPIDDIFRSNS 432
            RPLSTVL      + G   SRHYHH E+E NPN+PILISF+YRY TL+YSP+ DIF++N+
Sbjct: 379  RPLSTVL----PLKRGLLNSRHYHH-ESEENPNIPILISFEYRYLTLIYSPLTDIFQTNT 433

Query: 433  NWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALHPFYVFQIFS 492
            NWADPDW DL +V  GL ++I EDR +AFGKNS+NL+QKT ++ILFDEALHPFY+FQIFS
Sbjct: 434  NWADPDWTDLSLVSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFS 493

Query: 493  IILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVN 552
            IILW+ D YYYYA CIF+ISVLS+IDT++ETK++SE+L+++S F C+VRVY+D FW+QV 
Sbjct: 494  IILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVP 553

Query: 553  SSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQ 612
            SSDLVPGD++E++DPSL +LPCD++LISGDC+VNESMLTGESVPVSK AAT  TM QLL 
Sbjct: 554  SSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLD 613

Query: 613  DXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPV 672
            D              LFNGTK+IRVR   GQ +AL +V RTGFSTTKGSLVRSMVFPKP 
Sbjct: 614  DFMDTQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPT 673

Query: 673  GFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATL 732
            GFKFYEDSFKYIG++++IA+FGF++S IQF+RLGL+ + MILRALDIIT+VVPPALPA+L
Sbjct: 674  GFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASL 733

Query: 733  TIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSS 792
            +IGT FAL RLKKKGIFCISPTRVNVGGK+D+MCFDKTGTLTE+GLDVLG+H  +P    
Sbjct: 734  SIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQE 793

Query: 793  TILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLK 852
              +++S L+TD  ++LQ  +LSDC S  + KAKNFLVSLLTCHSL+ +DGELLGDP D K
Sbjct: 794  --MKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFK 851

Query: 853  MFEFTKWAYEEGYESWKFKN----------AEDKTGISPAVVHPTSNCNFIENDPDNLIG 902
            M +FTKW+ EE   + K  +            + +  +PA+VHP+    FIE +P N+IG
Sbjct: 852  MVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIG 911

Query: 903  VIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHN 962
            ++RSFEFLS LRRMSVIVK F EN + SFTKGAPEVI ++C+  T+P D+  LLHHYTHN
Sbjct: 912  IVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHN 971

Query: 963  GFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANI 1022
            G+R+IACAGK L + SWLYSQKVSREE+E NLEFLGFI+FENKLK  TK  L+ L  A+I
Sbjct: 972  GYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADI 1031

Query: 1023 RTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLND-NLEESRHLLSWRDVDEEGSVLDAV 1081
            RT+MCTGDNVLTA+SVGR++GL+ S RVF+  +ND +  +   +++W++V      LD+V
Sbjct: 1032 RTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSV 1091

Query: 1082 TLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQ 1141
            TL+PL+     YTLA+TG++FR+LF+ D+   ++ I+ +L+K SIYARMSPDEKHELVE+
Sbjct: 1092 TLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVER 1151

Query: 1142 LQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDISCVLDVIKEGRA 1201
            LQ + Y VGFCGDGANDCGALKAA+IGISLSEAEASVAAPFTS +F+ISCVLDV+KEGRA
Sbjct: 1152 LQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGRA 1211

Query: 1202 SLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNS 1261
            +LVTSF+CFQYMSLYSA QF+TI ILYSRGSNLGDFQFLYIDL LIVP+A+ MSWSKP  
Sbjct: 1212 ALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYE 1271

Query: 1262 KLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSDN 1321
             L KKRP+ANLVSPKIL+PL ++I ++ +FQL+PW+AVQ+  WY +PVVG D+ V SSDN
Sbjct: 1272 VLAKKRPTANLVSPKILIPLLVHIVILFVFQLVPWLAVQHMKWYRQPVVGDDEHVASSDN 1331

Query: 1322 TVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLMYLNVQTWLGEL 1381
            T+LFFVSNFQYIL AVVLS GPPYREPM KN+GFI D+ +S++ S  +M+L+  + LG L
Sbjct: 1332 TILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVLVSLVASCRIMFLSPDSTLGRL 1391

Query: 1382 LQLTNISDTFKWLILTTAAANYYASKYIPEKFKHLF 1417
             QLT  S  F  LI+     NYYA  YIP  FK LF
Sbjct: 1392 FQLTEASHPFCLLIIGWVFLNYYAQLYIPPAFKTLF 1427

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 93/184 (50%), Gaps = 3/184 (1%)

Query: 3   SFDSRFTGIPHSANKSARPSFXXXXXXXXXXXXXXXAILEQNNTEPYSGAAVETVPSSIV 62
           SFDSR  G   S N   R SF                ILEQ N+E Y+GA+ E VPSSIV
Sbjct: 2   SFDSRNAGSFSSNNARFRASFSSTKTTSSSNTMTSSTILEQRNSEAYAGASFEAVPSSIV 61

Query: 63  SFYHPHSFQXXXXXXXXXXXTNLERRGRSSEHDPXXXXXXXXXXXXXXXGRGFQFFTEEQ 122
           SF+HPHS++            +    G  S                      F+FF+E+Q
Sbjct: 62  SFHHPHSYRSGAFGSVDMLERSRRNTGSESVLLSPVRSRTSEISRTPSRATHFRFFSEQQ 121

Query: 123 VENAEGITSSVENADYDMDWDAIPTYEQERLHIQPRSSKTSLRQDGNDYAMRTFTPNRKY 182
           +ENAEG  S++E  DYD DWDA P YEQERLH+ PRSS++SLR   N    R  +  R  
Sbjct: 122 LENAEGAASTLEYTDYDTDWDATPAYEQERLHMNPRSSRSSLR---NGSVGRGPSSTRAQ 178

Query: 183 SVRS 186
           S++S
Sbjct: 179 SIQS 182

>Scas_665.30
          Length = 1439

 Score = 1592 bits (4122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 769/1189 (64%), Positives = 934/1189 (78%), Gaps = 29/1189 (2%)

Query: 250  NSRAEEDQEQNKKS------YHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAIAG 303
            N   E+    +KK+      Y +E+LKPQYH +F+P+NV  L+YQRFYI EEDLVV IAG
Sbjct: 26   NLSTEDTHSHHKKTTTSGGGYQTEYLKPQYHEKFYPSNVADLYYQRFYITEEDLVVGIAG 85

Query: 304  YRTSRFRLQCYYLLCIITLGLAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGELTV 363
            Y TS+F+   Y  +CI++ GL +L+ RW P+ +VK+IG K PLGKAEWVV+ENEFGE ++
Sbjct: 86   YSTSKFKNAIYNFICIVSFGLLYLLLRWLPSYKVKLIGTKVPLGKAEWVVLENEFGEFSI 145

Query: 364  ESVKRRWYNRPLSTVL-METNEDRIGTPESRHYHHHE------TEWNPNLPILISFQYRY 416
            E +KR WYNRP+ST+L ++     I       Y H        TE NPN+PILI+FQYRY
Sbjct: 146  EPIKREWYNRPISTILPLDDPFQEIDGINDESYQHRHHHYHHVTEKNPNIPILITFQYRY 205

Query: 417  FTLVYSPIDDIFRSNSNWADPDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEI 476
             T +YSP++DIF++N+NW DPDW+DL     GL+S +QEDR LAF  N +NL+ KTV E+
Sbjct: 206  ITFIYSPVEDIFKTNNNWTDPDWVDLSSTLRGLSSGVQEDRILAFDSNQINLRVKTVAEL 265

Query: 477  LFDEALHPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHF 536
            LF+E LHPFYVFQIFSIILW  D+YYYYAGCIFLIS+LSI+DT++ET++  + LAD+SHF
Sbjct: 266  LFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHF 325

Query: 537  NCEVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVP 596
             CEVRV++D FWT VNS+DLVPGD++EISDPSL V PCD++L+SGDCIVNESMLTGESVP
Sbjct: 326  ACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVP 385

Query: 597  VSKYAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFS 656
            VSK+ A   TM QLL D              LFNGT IIR R   GQ  ALA+V+RTGFS
Sbjct: 386  VSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFS 445

Query: 657  TTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRA 716
            TTKGSLVRSMVFPKP GFKFYEDSFKYIG M LIA+FGFSISCIQFI++GL+ + MILRA
Sbjct: 446  TTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRA 505

Query: 717  LDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEE 776
            LDIITIVVPPALPATLTIGT FAL RLKKKGIFCISPTRVN+GGK+D++CFDKTGTLTE 
Sbjct: 506  LDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTEN 565

Query: 777  GLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHS 836
            GLDVLG+    P   ++  Q +DL+ D  ++  K +L+DC+S  +++AKNF +SLLTCHS
Sbjct: 566  GLDVLGVQLCVPSSHNS-FQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHS 624

Query: 837  LKHIDGELLGDPLDLKMFEFTKWAYEEG---------YESWKFKNA-EDKTGISPAVVHP 886
            L+ +D EL+GDPLD KMF+FTKW+YEE          YE  +  NA  +   I PAVVHP
Sbjct: 625  LRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHP 684

Query: 887  TS---NCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADIC 943
             S      FI+NDP N +G+IRSFEFLSELRRMSVIVK   E+ YW+FTKGAPEVI  IC
Sbjct: 685  NSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQIC 744

Query: 944  NPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFE 1003
            N AT+P +F E+L++YTH G+R+IACAG+ LP+++WLYSQKVSREEVE N+EFLGFI+FE
Sbjct: 745  NKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFE 804

Query: 1004 NKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESR 1063
            NKLK  T   L+ LQ A+IRTVMCTGDNVLTA+SVGR   LI S++V++P L +     +
Sbjct: 805  NKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQ 864

Query: 1064 HLLSWRDVDEEGSVLDAVTLKPLNDPEK-SYTLAITGDIFRILFRND-EILPDDYISTVL 1121
              + WRDVD     LD+ TL P+N+    SYTLAITGDIFRI+F ++   + +DYI+TVL
Sbjct: 865  TSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVL 924

Query: 1122 MKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAP 1181
            +KG+IYARMSPDEKHEL+EQLQ+L+Y VGFCGDGANDCGALKAA++GISLSEAEASVAAP
Sbjct: 925  LKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAP 984

Query: 1182 FTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLY 1241
            FTS VFDISCVLDVIKEGRA LVTSFSCFQYMSLYSAIQFITIT+LYSRGSNLGDFQFLY
Sbjct: 985  FTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLY 1044

Query: 1242 IDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQY 1301
            IDLLLIVPIAI MSWSKP  K+VKKRPSANLVSPKIL+PL  +I ++L+FQ++PWI VQ 
Sbjct: 1045 IDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQG 1104

Query: 1302 TSWYMKPVVGGDDAVQSSDNTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISL 1361
              WYMKP+VGGDD V+SSDNT+LFF+SNFQYILTAV+LS GPPYREPM +NIGFI+D+ +
Sbjct: 1105 EEWYMKPIVGGDDVVESSDNTILFFISNFQYILTAVILSVGPPYREPMSRNIGFIVDVII 1164

Query: 1362 SMLVSFGLMYLNVQTWLGELLQLTNISDTFKWLILTTAAANYYASKYIP 1410
            S+++S  LM+++  ++LG+  QLT IS  FK  IL     NY+   Y+P
Sbjct: 1165 SIVLSIWLMFIDSSSFLGKKFQLTEISFKFKLFILIWVVINYFVQLYVP 1213

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query: 43   QNNTEPYSGAAVETVPSSIVSFYHPHSFQXXXXXXXXXXXTNLERRGRSSEH-DPXXXXX 101
            Q NTE YSG   ETVPSSIVSF+HP SFQ           + L RRGR +E         
Sbjct: 1299 QPNTETYSGVTFETVPSSIVSFHHPRSFQSSNIFGTSVGSSTLGRRGRDTEPLITSHSPS 1358

Query: 102  XXXXXXXXXXGRGFQFFTEEQVENAEGITSSVENADYDMDWDAIPTYEQERLHIQPRSSK 161
                         F FFTE+Q+ NAEG TS++EN DY+  WDA P+YEQERL+    S++
Sbjct: 1359 PIRRSRSSSRNPQFHFFTEDQINNAEG-TSTLENTDYNTPWDATPSYEQERLY--GTSNR 1415

Query: 162  TSLR 165
            TS R
Sbjct: 1416 TSRR 1419

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score =  323 bits (828), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 234/753 (31%), Positives = 371/753 (49%), Gaps = 114/753 (15%)

Query: 448  GLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALHPFYVFQIFSIILWLADDYYYYAGC 507
            GL   +   + L +G+NS ++   T  E+  + A+ PF++FQ+F + LWL DD +YY+  
Sbjct: 164  GLNGDLTHHKRL-YGENSFDIPIPTFLELFKEHAVAPFFIFQLFCVALWLFDDLWYYS-- 220

Query: 508  IFLISVLSIIDTVIETKKNSEKLADISHFNC------EVRVYKDRFWTQVNSSDLVPGDL 561
              L ++  I+   +E     ++L  +  F         + V++D  W ++ +  L P DL
Sbjct: 221  --LFNLFMIV--AMEATSVFQRLTTLKEFRTMGIKPYAINVFRDGKWVEMQTDKLFPMDL 276

Query: 562  FEISDPSL-VVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXX 620
              I+  +    +PCD +LI G CIVNE+ML+GES P+ K +         LQ        
Sbjct: 277  VSITRTAEDSAIPCDLLLIDGSCIVNEAMLSGESTPLLKESIKLRPANDQLQ------LD 330

Query: 621  XXXXXXXLFNGTKIIRVRN--------QPGQGMALALVIRTGFSTTKGSLVRSMVFPKP- 671
                   L  GTK ++V           P  G ALA+V +TGF T++GSLVR M+F    
Sbjct: 331  GVDKNAVLHGGTKALQVTAPENRTGVITPPDGGALAVVTKTGFETSQGSLVRVMIFSAER 390

Query: 672  --VGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALP 729
              VG K   ++  +I F+ + A+        +  R+G     +IL  + IIT VVPP LP
Sbjct: 391  VDVGNK---EALYFILFLLIFAIVASWYVWKEGTRMGRIQSKLILDCILIITSVVPPELP 447

Query: 730  ATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAKPE 789
              LT+  + +L  L K  ++C  P R+   G++D+ CFDKTGTLT E L          E
Sbjct: 448  MELTMAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAEDLVF--------E 499

Query: 790  GSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHID-GELLGDP 848
            G + +   SD+           TL   N A    ++  L ++   H+L  +D GE++GDP
Sbjct: 500  GLAGLHDGSDI----------RTLKSANDA----SQEVLSAIGAAHALVKLDDGEIVGDP 545

Query: 849  LDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFE 908
            ++    + + W  +       FK+   + G                   DN I ++R F+
Sbjct: 546  MEKATLKASSWTVD-------FKDVVKRAG------------------ADN-IRILRRFQ 579

Query: 909  FLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIA 968
            F S L+R + I    + N +++  KGAPE I +  N  ++P D+ ++   +T +G R++A
Sbjct: 580  FSSSLKRSASIAS--QSNRFFAAVKGAPETIRERLN--SVPSDYDDIYKSFTRSGSRVLA 635

Query: 969  CAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCT 1028
             A K LPK S      + R+E+E  L F  F+VF   LK      +K L  ++ R++M T
Sbjct: 636  LAYKDLPKMSNSQIDNIDRDEIETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMIT 695

Query: 1029 GDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLND 1088
            GDN LTAV V ++ G++  E +    L++ ++ S H L  RDV+E         +KP N 
Sbjct: 696  GDNPLTAVHVAKEVGIVDRETL---ILDEPIDGSSHALVMRDVNE-------TIVKPFN- 744

Query: 1089 PE----------KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHEL 1138
            P+          + Y LA+TG   ++L  + +      +  V+    IYAR+SP +K  +
Sbjct: 745  PDADTFDEKEIFQKYDLAVTGHALKLLQGHKQ------LRDVIRHTWIYARVSPSQKEFI 798

Query: 1139 VEQLQKLDYNVGFCGDGANDCGALKAANIGISL 1171
            +  L+ + Y    CGDG ND GALK A++GI+L
Sbjct: 799  LITLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 831

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 105/423 (24%), Positives = 181/423 (42%), Gaps = 34/423 (8%)

Query: 1008 SRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLS 1067
            S+ +  L  L++   +T+MC GD          D G +    V I  LN   +  + L  
Sbjct: 793  SQKEFILITLKDMGYQTLMC-GDGT-------NDVGALKQAHVGIALLNGTEDSLKKLQE 844

Query: 1068 WRDVDEEGSVLDAVTL--KPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGS 1125
             R +D   ++ +   L     N P     +AI       L+      P+ Y+  +  KG 
Sbjct: 845  QRKIDNVKTMYEKQCLFMDRWNQPHPPVPIAIAH-----LYPPGSNNPN-YLKAMEQKG- 897

Query: 1126 IYARMSPDEKHELVEQLQK--LDYNVGFCGDGANDCGALKAANIG-------ISLSEAEA 1176
                ++P+ +   +E   K  +          A D   + + ++G        SL   +A
Sbjct: 898  --VEITPEMRKLAMEVSSKPAVVKKTEPSKKSATDLADMISGSLGEMEDEDAPSLKLGDA 955

Query: 1177 SVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGD 1236
            S AAPFTS + +++ V ++I++GR +L+ +   ++ ++L   I   +++++Y  G   GD
Sbjct: 956  SCAAPFTSKLANVNAVTNIIRQGRCALINTIQMYKILALNCLISAYSLSVIYLAGVKFGD 1015

Query: 1237 FQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPW 1296
             Q     LLL V   +S+S  KP  KL K+RP   + +  I+  + L    + I  L+  
Sbjct: 1016 GQATVSGLLLSVCF-LSISRGKPLEKLSKERPQPGIFNIYIMGSI-LGQFAVHILTLVYI 1073

Query: 1297 IAVQYTSWYMKPVVGGD-DAVQSSDNTVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGF 1355
                Y     +P V  + + V S  NT +F V   Q + T VV  QG P+RE +  N G 
Sbjct: 1074 TTEIYKIEPREPQVDLEKEFVPSLLNTGIFMVQLAQQVSTFVVNYQGEPFRENIKNNKGM 1133

Query: 1356 ILDI-SLSMLVSFGLMYLNVQTWLGELLQLTNISDTFKWLILTTAAANYYASKYIPEKFK 1414
               I  +S+L   G      +  L   ++   + D FK  +  T   +++ S      FK
Sbjct: 1134 YYGIVGVSVLALCGSTEFIPE--LNAAMKFVPMDDIFKMKLTGTLLLDFFGSWAFELFFK 1191

Query: 1415 HLF 1417
            + F
Sbjct: 1192 YFF 1194

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score =  306 bits (783), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 211/730 (28%), Positives = 357/730 (48%), Gaps = 92/730 (12%)

Query: 461  FGKNSVNLKQKTVTEILFDEALHPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTV 520
            +G N  ++   T  E+  + A+ P +VFQ+F + LWL D+Y+Y +    L ++  I+   
Sbjct: 175  YGNNEFDIPIPTFLELFKEHAVAPLFVFQVFCVALWLLDEYWYLS----LFNLFMILS-- 228

Query: 521  IETKKNSEKLADISHFNC------EVRVYKDRFWTQVNSSDLVPGDLFEISDPSL-VVLP 573
            +E     ++L  +  F         + V +D  W ++ +++L+P D+  +   +    LP
Sbjct: 229  MEAASVFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALP 288

Query: 574  CDAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTK 633
            CD +L+ G CIVNE+ML+GES P+ K +       + LQ               L  GTK
Sbjct: 289  CDLILVDGTCIVNEAMLSGESTPLLKESIRLRPGNEELQ------IEGTDKISVLHGGTK 342

Query: 634  IIRVRN--------QPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIG 685
            +++V           P  G A+A+V +TGF T++GSLVR M++         +++  +I 
Sbjct: 343  VLQVTTPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKEALYFIL 402

Query: 686  FMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKK 745
            F+ + A+       ++  ++G     +IL  + IIT VVPP LP  LT+  + +L  L K
Sbjct: 403  FLLIFAVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVNSSLSALSK 462

Query: 746  KGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCD 805
              ++C  P R+   G++D+ CFDKTGTLT E L   G              L+ L +D  
Sbjct: 463  FYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEG--------------LAGLSSDPK 508

Query: 806  EVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHI-DGELLGDPLDLKMFEFTKWAYEEG 864
            ++   ++ +DC ++               H+L  + DGE++GDP++    +  KW  E+G
Sbjct: 509  DIRHLYSATDCPNSTSLVVG-------AAHALVRLEDGEIVGDPMEKATLKALKWTVEKG 561

Query: 865  YESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFK 924
             + +  KN +                          + ++R F+F S L+R S +     
Sbjct: 562  DKVFNEKNGQ--------------------------VTILRRFQFSSALKRSSSVAT--H 593

Query: 925  ENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK 984
            +   +S  KGAPE I +     TIP ++ E+   +T +G R++A A K L K S    + 
Sbjct: 594  DGKLYSAVKGAPETIRE--RLFTIPANYDEIYKSFTRSGSRVLALASKKLEKMSQSQIED 651

Query: 985  VSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGL 1044
              RE  E +LEF GF++F   LK      ++ L  +  R VM TGDN LTAV V ++ G+
Sbjct: 652  ADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGI 711

Query: 1045 ISSERVFIPFLNDNLEESRHLLSWRDVDEEGS---VLDAVTLKPLNDPEKSYTLAITGDI 1101
            +  E + +  +++  ++    L +R+V+E  S   V+   + +     +K Y LA+TG  
Sbjct: 712  VKGETLIVDMVDNGNDDK---LVFRNVEETLSFEFVVSKDSFEKYGIFDK-YDLAVTGHA 767

Query: 1102 FRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGA 1161
               L  + +      +  ++    IYAR+SP +K  ++  L+ + Y    CGDG ND GA
Sbjct: 768  LEALKGHHQ------LQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTLMCGDGTNDVGA 821

Query: 1162 LKAANIGISL 1171
            LK A++G++L
Sbjct: 822  LKQAHVGVAL 831

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 106/427 (24%), Positives = 180/427 (42%), Gaps = 53/427 (12%)

Query: 1014 LKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLE------ESRHLLS 1067
            L  L++   +T+MC GD          D G +    V +  LN   E      E R L S
Sbjct: 799  LNNLKDMGYQTLMC-GDGT-------NDVGALKQAHVGVALLNGTEEGLKKVAEQRRLDS 850

Query: 1068 WRDV-DEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDD--YISTVLMKG 1124
             +++ D++ + L      P   PE    L   G             P +  Y++ +  KG
Sbjct: 851  MKEIYDKQTAFLARWGKPPAPVPENIAHLYPPG-------------PSNPHYLTALEKKG 897

Query: 1125 SIYARMSPDEKHELVEQLQKLDYNVGFCGD--GANDCGALKAANIGISLSEAE------- 1175
            ++   ++P+ +  + E   K         +   AND  ++  +    S  + E       
Sbjct: 898  TV---ITPEIRKMVTEANNKPVEIAAPSTEKPAANDLASMILSGASESQEDGETPTLKLG 954

Query: 1176 -ASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNL 1234
             AS AAPFTS + ++S V ++I++GR +LV +   ++ ++L   I   +++I+Y  G   
Sbjct: 955  DASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKF 1014

Query: 1235 GDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLL 1294
            GD Q     LLL V   +S+S  KP  KL K RP A + +  I+  + L+  ++ I  L+
Sbjct: 1015 GDGQATTSGLLLSVCF-LSISRGKPLQKLSKARPQAGIFNVYIMGSI-LSQFVVHIGTLI 1072

Query: 1295 PWIAVQYTSWYMKPVVGGDDAVQSS-DNTVLFFVSNFQYILTAVVLSQGPPYREPMIKNI 1353
                  Y     +P V  +     S  NT +F +   Q + T  V  QG P+RE +  N 
Sbjct: 1073 YLTNEIYRLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRSNK 1132

Query: 1354 GFILDISLSMLVSFGLMYLNVQTWLGEL---LQLTNISDTFKWLILTTAAANYYASKYIP 1410
            G    +   +L   GL   +   ++ EL   ++   + D FK  +  T   +++      
Sbjct: 1133 G----MYYGLLGVTGLALASATEFIPELNEAMKFVPMEDDFKMKLTITLFVDFFGCWGAE 1188

Query: 1411 EKFKHLF 1417
              FK  F
Sbjct: 1189 HFFKFFF 1195

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score =  301 bits (772), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 218/737 (29%), Positives = 361/737 (48%), Gaps = 106/737 (14%)

Query: 461  FGKNSVNLKQKTVTEILFDEALHPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTV 520
            +G+NS ++   T  E+  + A+ P +VFQ+F + LWL D+++YY+    L ++  II   
Sbjct: 177  YGENSFDIPIPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYS----LFNLFMIIS-- 230

Query: 521  IETKKNSEKLADISHFNC------EVRVYKDRFWTQVNSSDLVPGDLFEISDPSL-VVLP 573
            +E     ++L  +  F         + V++++ W  + +++L+P DL  I+  +    +P
Sbjct: 231  MEAAAVFQRLTALKEFRTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIP 290

Query: 574  CDAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTK 633
            CD +L+ G  IVNE+ML+GES P+ K +         LQ               L  GTK
Sbjct: 291  CDLILLDGSAIVNEAMLSGESTPLLKESIKLRPSEDNLQ------LDGVDKIAVLHGGTK 344

Query: 634  IIRVRNQ--------PGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIG 685
             ++V           P  G ALA+V +TGF T++GSLVR M++         +++  +I 
Sbjct: 345  ALQVTPPEHKSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFIL 404

Query: 686  FMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKK 745
            F+ + A+       ++  ++G     +IL  + IIT VVPP LP  LT+  + +L  L K
Sbjct: 405  FLLIFAVIASWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAK 464

Query: 746  KGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCD 805
              ++C  P R+   G++D+ CFDKTGTLT E L   G              L+ +  D +
Sbjct: 465  FYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEG--------------LAGISADSE 510

Query: 806  EVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHI-DGELLGDPLDLKMFEFTKWAYEEG 864
             +  +H  S   + E     + ++ +   H+L  + DG+++GDP++    +   WA E  
Sbjct: 511  NI--RHLYSAAEAPE-----STILVIGAAHALVKLEDGDIVGDPMEKATLKAVGWAVER- 562

Query: 865  YESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFK 924
                K  N  + TG                      + +IR F+F S L+R + I     
Sbjct: 563  ----KNSNYREGTG---------------------KLDIIRRFQFSSALKRSASIAS--H 595

Query: 925  ENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK 984
             +  ++  KGAPE I +    + IPK++ E+   +T +G R++A A K+LPK S      
Sbjct: 596  NDALFAAVKGAPETIRERL--SDIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQSKIDD 653

Query: 985  VSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGL 1044
            ++R++VE  L F GF++F   LK      +K L  ++ R++M TGDN LTAV V ++ G+
Sbjct: 654  LNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGI 713

Query: 1045 ISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKS----------YT 1094
            +  E +    L+   +   + L +RDV+E  S+       P  DP K           Y 
Sbjct: 714  VFGETL---ILDRAGKSDDNQLLFRDVEETVSI-------PF-DPSKDTFDHSKLFDRYD 762

Query: 1095 LAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGD 1154
            +A+TG     L  + +      +  +L    +YAR+SP +K  L+  L+ + Y    CGD
Sbjct: 763  IAVTGYALNALEGHSQ------LRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGD 816

Query: 1155 GANDCGALKAANIGISL 1171
            G ND GALK A++GI+L
Sbjct: 817  GTNDVGALKQAHVGIAL 833

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 120/250 (48%), Gaps = 28/250 (11%)

Query: 1170 SLSEAEASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYS 1229
            +L   +AS AAPFTS + ++S V ++I++GR +LV +   ++ ++L   I   +++I+Y 
Sbjct: 952  ALKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 1011

Query: 1230 RGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANL----VSPKILVPLCLNI 1285
             G   GD Q     LLL V   +S+S  KP  KL K+RP + +    +   IL    ++I
Sbjct: 1012 AGVKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKQRPQSGIFNVYIMGSILSQFAVHI 1070

Query: 1286 TLIL-----IFQLLPWIAVQYTSWYMKPVVGGDDAVQSS-DNTVLFFVSNFQYILTAVVL 1339
              ++     I++L P           +P V  +     S  NT +F +   Q + T  V 
Sbjct: 1071 ATLVYITTEIYKLEP----------REPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVN 1120

Query: 1340 SQGPPYREPMIKNIGFILDISLSMLVSFGLMYLNVQTWLGEL---LQLTNISDTFKWLIL 1396
             QG P+RE +  N G    +   +L   GL   +   +L EL   ++   ++D FK  + 
Sbjct: 1121 YQGEPFRENIRSNKG----MYYGLLGVTGLALASATEFLPELNEAMKFVPMTDDFKIKLT 1176

Query: 1397 TTAAANYYAS 1406
             T   +++ S
Sbjct: 1177 LTLLLDFFGS 1186

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score =  301 bits (770), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 217/752 (28%), Positives = 367/752 (48%), Gaps = 108/752 (14%)

Query: 447  HGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALHPFYVFQIFSIILWLADDYYYYA- 505
             GL+  +   + L +G+N+ ++   +  E+  + A+ PF+VFQIF + LWL D  +Y + 
Sbjct: 164  RGLSGDLTHMKLL-YGENTFDIPVPSFLELFKEHAVEPFFVFQIFCVALWLFDQMWYLSL 222

Query: 506  ---GCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDLF 562
                 IF +  +S+   +   K+   K   I  +   + V++D  W  + +++L+P DL 
Sbjct: 223  FNLFMIFAMEAVSVFQRLTTLKEF--KTMGIKPYG--INVFRDSKWQLLQTNELLPMDLI 278

Query: 563  EISDPSL-VVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXX 621
             ++       L CD +L+ G CIVNE+ML+GES P+ K +    +  + LQ         
Sbjct: 279  SVTRTDEDSALSCDMILVDGTCIVNEAMLSGESTPLLKESVKLRSSEEKLQ------VEG 332

Query: 622  XXXXXXLFNGTKIIRVRN---------QPGQGMALALVIRTGFSTTKGSLVRSMVFPKPV 672
                  L  GTK+++V            P  G ALA+V +TGF T++G+LVR M++    
Sbjct: 333  LDKNSVLHGGTKVLQVTAPEKGSSSIPAPPDGGALAVVSKTGFETSQGALVRVMIYSSER 392

Query: 673  GFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATL 732
                 +++  +I F+ + A+       ++  R+G     +IL  + IIT VVP  LP  L
Sbjct: 393  VSVGNKEALYFILFLLIFAIAASWYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMEL 452

Query: 733  TIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIH--FAKPEG 790
            T+  + +L  L K  ++C  P R+ + G++D+ CFDKTGTLT E L   G+     K + 
Sbjct: 453  TMAVNNSLAVLSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGLAGLAGKNQP 512

Query: 791  SSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHI-DGELLGDPL 849
             + + + +++  D + V+                          H+L  + D E++GDP+
Sbjct: 513  VNHLFKGTEVPLDTNLVIG-----------------------AAHALVRLDDDEVVGDPM 549

Query: 850  DLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEF 909
            +      T W                K G+  +          + N+    I ++R F+F
Sbjct: 550  EKATLAATGW----------------KVGVKDS----------LSNEKVGDISILRRFQF 583

Query: 910  LSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIAC 969
             S L+R S I    K+  ++S  KGAPE I +    + +P D+ ++   +T  G R++A 
Sbjct: 584  SSALKRSSTIAVHNKQ--HYSAVKGAPETIRE--RLSQVPTDYDQVYKSFTRAGSRVLAL 639

Query: 970  AGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTG 1029
            A K LP  S    +K+ RE VE +LEF GF+VF   LK      +K L  ++ R +M TG
Sbjct: 640  ASKKLPSMSIKQIEKLEREAVESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITG 699

Query: 1030 DNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDP 1089
            DN LTAV V ++  ++  E +    L++ ++ S H L +R+++E         + P N P
Sbjct: 700  DNPLTAVHVAKEVAIVERETL---ILDEPIDGSSHALVFRNIEE-------TIVNPFN-P 748

Query: 1090 EK----------SYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELV 1139
            EK           Y +A+TG   ++L  + +      ++ ++    +YAR+SP +K  ++
Sbjct: 749  EKDTFEHSKLFAKYDIAVTGHALQLLSGHSQ------LNELIRHTWVYARVSPAQKEFIM 802

Query: 1140 EQLQKLDYNVGFCGDGANDCGALKAANIGISL 1171
              L+ + Y    CGDG ND GALK A++GI+L
Sbjct: 803  NSLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 834

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 93/190 (48%), Gaps = 9/190 (4%)

Query: 1170 SLSEAEASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYS 1229
            +L   +AS AAPFTS + ++S V ++I++GR +L+ +   ++ ++L   I   +++++Y 
Sbjct: 953  TLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALINTIQMYKILALNCLITAYSLSVIYL 1012

Query: 1230 RGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLIL 1289
             G   GD Q   +  LLI    +S+S  +P  KL K+RP   + +  I+  +     +  
Sbjct: 1013 AGVKFGDVQ-ATVSGLLITVCFLSISRGQPLEKLSKERPQPGIFNVYIMGSILGQFAV-- 1069

Query: 1290 IFQLLPWIAVQYTSWYMKP----VVGGDDAVQSSDNTVLFFVSNFQYILTAVVLSQGPPY 1345
               +     +    ++++P    +    D   S  NT +F +   Q + T  V  QG P+
Sbjct: 1070 --HIAALAYINREIYFLEPREPQIDLEKDFSPSLLNTGIFLIQLAQQVSTFAVNYQGEPF 1127

Query: 1346 REPMIKNIGF 1355
            RE +  N G 
Sbjct: 1128 RENIRSNKGM 1137

>Scas_583.14*
          Length = 875

 Score =  209 bits (532), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 157/543 (28%), Positives = 262/543 (48%), Gaps = 82/543 (15%)

Query: 641  PGQGMALALVIRTGFSTTKGSLVRSMVF-PKPVGFKFYEDSFKYIGFMTLIAMFGFSISC 699
            P  G AL +V +TGF T +GSLVR M++  + VG    +++  +I F+   A+       
Sbjct: 15   PDHG-ALVVVTKTGFETYQGSLVRVMIYSAERVGVD-NKEALMFILFLLNFAVVASWYVW 72

Query: 700  IQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVG 759
            ++  ++G     +IL  + IIT VVPP LP  LT+  + +L  L K  ++C  P R+ + 
Sbjct: 73   VEGTKMGRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPLA 132

Query: 760  GKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSA 819
            G++D+ CFDKTGTLT E L   G+             LSD   D      +H  S  +++
Sbjct: 133  GRIDVCCFDKTGTLTGEDLVFEGLA-----------GLSDKSEDV-----RHLFSSEDAS 176

Query: 820  EEFKAKNFLVSLLTCHSLKHID-GELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTG 878
            +E      ++ +   H+L  +D GE++GDP++    +   W  E                
Sbjct: 177  QET-----ILVVGAAHALVKLDDGEIVGDPMEKATLKALGWKVE---------------- 215

Query: 879  ISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEV 938
                        +F        + ++R F+F S L+R S +     ++  ++  KGAPE 
Sbjct: 216  ----------GNDFTSRPKTGKLQILRRFQFSSALKRSSSVAS--HKDKLFTAVKGAPET 263

Query: 939  IADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLG 998
            I +    A +PK++ E+   +T +G R++A A K+LP  S      + R+E+E  L F G
Sbjct: 264  IRE--RLAVVPKNYDEIYKSFTRSGSRVLALASKSLPNLSSKQLDDLDRDEIETGLTFNG 321

Query: 999  FIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDN 1058
            F+VF   LK      +K L  +  R++M TGDN LTAV V ++  +++ E +    L+ +
Sbjct: 322  FLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETL---ILDKS 378

Query: 1059 LEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEK----------SYTLAITGDIFRILFRN 1108
                   L + +V+E        T+K   DP             Y +A+TG    +L  +
Sbjct: 379  ETVGDGKLLFFNVEE--------TIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDH 430

Query: 1109 DEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIG 1168
             +      +  ++    +YAR+SP +K  ++  L+++ Y    CGDG ND GALK A++G
Sbjct: 431  SQ------LKDLIRHTWVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVG 484

Query: 1169 ISL 1171
            ++L
Sbjct: 485  VAL 487

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 119/252 (47%), Gaps = 10/252 (3%)

Query: 1170 SLSEAEASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQFITITILYS 1229
            +L   +AS AAPFTS +  +S V ++I++GR +LV +   ++ ++L   I   +++I+Y 
Sbjct: 610  TLKLGDASCAAPFTSKLSKVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 669

Query: 1230 RGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLIL 1289
             G   GD Q     LLL V   +S+S  KP  KL K+RP   + +  I+  + L+   + 
Sbjct: 670  AGVKFGDAQATVSGLLLSVCF-LSISRGKPIQKLSKQRPQKGIFNVYIMGSI-LSQFAVH 727

Query: 1290 IFQLLPWIAVQYTSWYMKPVVGGDDAVQSS-DNTVLFFVSNFQYILTAVVLSQGPPYREP 1348
            IF L+      Y     +P V  +     S  NT +F +   Q + T  V  QG P+RE 
Sbjct: 728  IFTLVYITREIYILEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFREN 787

Query: 1349 MIKNIGF---ILDISLSMLVSFGLMYLNVQTWLGELLQLTNISDTFKWLILTTAAANYYA 1405
            +  N G    +L +S   LVS           L E +    + D FK+ +  T   +++ 
Sbjct: 788  IRNNRGMYFGLLGVSSLALVS----ATEFMPELNEAMNFVPMDDIFKFKLTGTLLLDFFG 843

Query: 1406 SKYIPEKFKHLF 1417
            S      FK+ F
Sbjct: 844  SWAAEYFFKYFF 855

>Kwal_14.1498
          Length = 939

 Score =  142 bits (357), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 193/845 (22%), Positives = 348/845 (41%), Gaps = 128/845 (15%)

Query: 446  QHGL-TSSIQEDRTLAFGKNSVNLKQ------KTVTEILFDEALHPFYVFQIFSIILWLA 498
            Q+GL T S+ E+R   +GKN ++ ++      K VT  + D  +       + S I+   
Sbjct: 50   QNGLPTMSVVEERRAQYGKNEISSEEDEPLWWKFVTTFVGDPLILLLIGSAVISFIMGNI 109

Query: 499  DDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCE-VRVYKDRFWTQVNSSDLV 557
            DD       I ++  +  +     ++K+ E L  +    C  +R  ++   +++ +S LV
Sbjct: 110  DDAVSITLAIVIVVTVGFVQEY-RSEKSLEALNRLVPDQCHLIRCGQE---SKLLASVLV 165

Query: 558  PGDL--FEISDPSLVVLPCDAVLISG-DCIVNESMLTGESVPVSKYAATEATMAQLLQDX 614
            PGD+  F + D     +P D  +I   D  + ES LTGE+ PV K  AT     +  ++ 
Sbjct: 166  PGDVVRFRVGDR----IPADLRIIEAVDLSIEESNLTGENEPVHKSTAT--VNKEFYKEN 219

Query: 615  XXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGF 674
                          F GT    VR   G+G+ +     T F      ++ ++  PK    
Sbjct: 220  LGSIVPVSERSCIAFMGT---LVREGHGRGIVIGTAKNTAFGKV-FEMMNAIEKPKTPLQ 275

Query: 675  KFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTI 734
               +   K + FM+ I +    I C+  +  G  +  M   ++ +    +P  LP  +T+
Sbjct: 276  TAMDKLGKDLSFMSFIVI---GIICLIGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTV 332

Query: 735  GTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGI-HFAKPEGSST 793
              +  + R+ K+         V   G V+++C DKTGTLT   + V  +         S 
Sbjct: 333  TLALGVLRMAKRRAIIRRLPSVETLGSVNVICSDKTGTLTANHMSVNKVWCLGSMSNKSN 392

Query: 794  ILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLKM 853
            IL+L    +      +K      N  E+ +A     +L    +  H   + LG+P D+ +
Sbjct: 393  ILKLDKATSGS---FKK------NLTEDLRATLRTGNLCNNSTYSHEHAKYLGNPTDIAL 443

Query: 854  FE-FTKWAYEEGYESWKFKNAEDKTGISP----AVVHPTSNCNFIENDPDNLIGVIRSFE 908
             E   K+  E+  E  +   +++ +  S     AV    +N  F+       + V  ++E
Sbjct: 444  LEVLHKFGLED--ERPQVTRSDEISFNSKRKFMAVKVKEANGKFV-------VHVKGAYE 494

Query: 909  FLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIA 968
             +  L + +  +    EN          + I D  +                 +G R +A
Sbjct: 495  KI--LEKSTHFINA--ENKVVKLDSNLRQAITDSADA-------------LASDGLRTLA 537

Query: 969  CAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCT 1028
             A   L   +   S+K++ +++ + L F G +   +  +   KAA++ L   ++  +M T
Sbjct: 538  FAQLELSNGN---SKKLTEDDI-NGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMIT 593

Query: 1029 GDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLND 1088
            GD   TAVS+ R  G+                                        P+ +
Sbjct: 594  GDAENTAVSIARQIGI----------------------------------------PVVN 613

Query: 1089 PEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYN 1148
            PE   T  +TGD         + + +D +++++   +I+AR +P+ K  +V  LQK    
Sbjct: 614  PE---TAVLTGDKL-------DHMSEDQLASIIDHVNIFARATPEHKLNIVRALQKRGDI 663

Query: 1149 VGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGRASL-- 1203
            V   GDG ND  ALK A+IG+S+ +    VA   +  V    D S +L  I+EG+     
Sbjct: 664  VAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNN 723

Query: 1204 VTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKL 1263
            + +F  FQ  +  +A+  + I   +   + L   Q L+I++L+  P A S+     + ++
Sbjct: 724  IQNFLTFQLSTSVAALSLVAIATAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEV 783

Query: 1264 VKKRP 1268
            +KK P
Sbjct: 784  MKKPP 788

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 187/836 (22%), Positives = 322/836 (38%), Gaps = 165/836 (19%)

Query: 539  EVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVS 598
            +V V +D   + ++  +L+ GDL ++    +V  P D VL+ G+C  +ES LTGES  + 
Sbjct: 158  QVVVVRDAAESLISIHNLLVGDLLKLQTGDVV--PADCVLVRGECETDESALTGESNTIK 215

Query: 599  KYA---ATEATMAQLLQDXXXXXXXXXXXXX--------XLFNGTKIIRVRNQPGQGMAL 647
            K     A E   A   +D                      L +G++++        G+A 
Sbjct: 216  KLPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVL-------SGLAS 268

Query: 648  ALVIRTGFSTTKGSLVRSMV-----FPKPVGFKFYEDSFKYIGFMTLIAMF--------- 693
            A+V   G ++  G  + S+       P  +      D+    G +  I +F         
Sbjct: 269  AIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLS 328

Query: 694  -----GFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGI 748
                 G     +     G ++  + + A+ +I + VP  LP  +T+  +FA  R+ K G 
Sbjct: 329  YILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGN 388

Query: 749  FCISPTRVNVGGKVDMMCFDKTGTLTEE------------GLDVLGIHFAKPEGSSTILQ 796
                       G    +C DKTGTLTE             G D +G   A P  S+ + +
Sbjct: 389  LVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIG---ADPSKSNLVFK 445

Query: 797  --LSDLITDC--DEVLQKHTL---------SDCNSAEEFKAKNFLVSLLTCHSLKHIDGE 843
               SDL+     D ++   T          ++ NS ++ + +  +  +      K  D E
Sbjct: 446  KKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKKPDDE 505

Query: 844  --LLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLI 901
              LL    + +   +     E    S   K+   K G   +          +E       
Sbjct: 506  ENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTVET------ 559

Query: 902  GVIRSFEFLSELRRMSVIVK--GFKEN---TYWSFTKGAPEVIADICNPATI-------- 948
             +++   F S  +  +++VK    KEN    +  + KGA E++A  C    +        
Sbjct: 560  -IVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEI 618

Query: 949  ----PKDFHELLHHYTHNGFRIIACAGKTLPKSSW----LYSQKVSREEVE--------- 991
                  D  E +     +  R I+ A      + W    L   + S E +          
Sbjct: 619  DQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKP 678

Query: 992  --DNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSER 1049
              + L     +  ++ L+   K ++ + Q A +   M TGDN+LTA ++ R+ G++SS  
Sbjct: 679  HLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSS-- 736

Query: 1050 VFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRND 1109
                                              K LND       A+ G  FR L    
Sbjct: 737  ----------------------------------KSLND----SACAMEGPAFRKL---- 754

Query: 1110 EILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGI 1169
                D     +L K  + AR SP++K  LV  L+++   V   GDG ND  ALK A++G 
Sbjct: 755  ---SDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGTNDAPALKLADVGF 811

Query: 1170 SLSEAEASVAAPFTSAVF---DISCVLDVIKEGR--ASLVTSFSCFQYMSLYSAI--QFI 1222
            S+      VA   +  +    D S +++ IK GR  A+ +  F  FQ +   +A+   F+
Sbjct: 812  SMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQFQLIVNVTAVLLTFV 871

Query: 1223 TITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRP---SANLVSP 1275
            T  I     S L   Q L+++L++    A++++  KP+  ++ ++P   S  L++P
Sbjct: 872  TSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRKPKGRSTPLITP 927

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 200/804 (24%), Positives = 323/804 (40%), Gaps = 158/804 (19%)

Query: 527  SEKLADISHFNCEVRVYKDRFW--TQVNSSDLVPGDL--FEISDPSLVVLPCDAVLI-SG 581
            SEK  +  H       +  RF   T V +S LVPGDL  F++ D     +P D  +I S 
Sbjct: 144  SEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDR----IPADVRIIEST 199

Query: 582  DCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQP 641
            D  ++ES LTGE+ PV K  +     +    D               + GT    VR   
Sbjct: 200  DLSLDESTLTGETEPVHK--SCTPVNSATYSDVPGGIIPIGERTSIAYMGT---LVREGH 254

Query: 642  GQGMALALVIRTGFSTTKGSLVRSM------VFPKPVGFKFYEDSFKYIGFMTLIAMFGF 695
            G+G    +V+ TG  T  G++   M        P  +          Y+ F  +++   F
Sbjct: 255  GKG----IVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRF--VLSGIIF 308

Query: 696  SISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLK---KKGIFCIS 752
             +  IQ    G  +  M   ++ +    +P  LP  +T+  + ALG L+   +K I    
Sbjct: 309  LLGVIQ----GRSWLEMFQISVSLAVAAIPEGLPIIVTV--TLALGVLRMANRKAIVRRL 362

Query: 753  PTRVNVGGKVDMMCFDKTGTLTEEGLDVLGI-HFAKPEGSSTILQL-----SDLITDCDE 806
            P+ V   G V+++C DKTGTLT   +    I         + +L L       L      
Sbjct: 363  PS-VETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPN 421

Query: 807  VLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYE 866
            +  K+ LSD     + KA   + S+    S  H  G+ LG+P D+ + E  +        
Sbjct: 422  L--KNYLSD-----DVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQ-------- 466

Query: 867  SWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKG-FKE 925
              KF   +++         PT+               +    F S+ + M+V V      
Sbjct: 467  --KFDLVDER---------PTTT-------------RVDELTFNSKRKYMAVKVDSPANS 502

Query: 926  NTYWSFTKGAPEVIAD-----ICNPATIPK--DFHELL-----HHYTHNGFRIIACAGKT 973
              +  + KGA E I +     I     + K  D H+ L           G R +A A   
Sbjct: 503  GKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFA--- 559

Query: 974  LPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVL 1033
                    + K   +    NL F+G I  ++  +S  + A++EL    +  +M TGD   
Sbjct: 560  ---QLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAEN 616

Query: 1034 TAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSY 1093
            TAV++ R  G        IP +N                                PE S 
Sbjct: 617  TAVNIARQIG--------IPVIN--------------------------------PEIS- 635

Query: 1094 TLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCG 1153
               +TGD      R D+ + DD ++ V+   +I+AR +P+ K  +V  LQK    V   G
Sbjct: 636  --VLTGD------RLDQ-MTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRGDIVAMTG 686

Query: 1154 DGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGRASL--VTSFS 1208
            DG ND  ALK A+IG+++      VA   +  V    D S +L  I+EG+     + SF 
Sbjct: 687  DGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQSFL 746

Query: 1209 CFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRP 1268
             FQ  +  +A+  + I   +   + L   Q L+I++L+  P A S+     + ++++K P
Sbjct: 747  TFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPP 806

Query: 1269 ---SANLVSPKILVPLCLNITLIL 1289
               S  +++P+++  L +N   I+
Sbjct: 807  RKRSDKILTPQVMRRLLINAAFII 830

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 200/859 (23%), Positives = 342/859 (39%), Gaps = 154/859 (17%)

Query: 448  GLTSSIQ-EDRTLAFGKNSVNLK------QKTVTEILFDEALHPFYVFQIFSIILWLADD 500
            GL SS +  +R   +G N + ++      +K ++  + D  +       + S+ +   DD
Sbjct: 57   GLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDD 116

Query: 501  YYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEV-RVYKDRFWTQVNSSDLVPG 559
                   IF++  +  +     ++K+ E L  +    C + R  ++   + V +S LVPG
Sbjct: 117  AVSITLAIFIVVTVGFVQEY-RSEKSLEALNKLVPAECHLMRCGQE---SHVLASTLVPG 172

Query: 560  DL--FEISDPSLVVLPCDAVLISG-DCIVNESMLTGESVPVSKYAATEATMAQLLQDXXX 616
            DL  F I D     +P D  +I   D  ++ES LTGE+ PV K + T    +    D   
Sbjct: 173  DLVHFRIGDR----IPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSS--FNDQPN 226

Query: 617  XXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMV-FPKP-VGF 674
                        + GT    V+   G+G    +V+ TG +T+ G++   M    KP    
Sbjct: 227  SIVPISERSCIAYMGT---LVKEGHGKG----IVVGTGTNTSFGAVFEMMNNIEKPKTPL 279

Query: 675  KFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTI 734
            +   D  K    ++L++     + C+  I  G  +  M   ++ +    +P  LP  +T+
Sbjct: 280  QLTMD--KLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTV 337

Query: 735  GTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEE---------------GLD 779
              +  + R+ K+         V   G V+++C DKTGTLT                  L+
Sbjct: 338  TLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLN 397

Query: 780  VLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKH 839
            VL +   K   +S     + L  D  E L    L  CN+A          S    H++  
Sbjct: 398  VLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNL--CNNA----------SFSQEHAI-- 443

Query: 840  IDGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDN 899
                 LG+P D+ + E         +E    +N   K    P           I N  DN
Sbjct: 444  ----FLGNPTDVALLE-----QLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDN 494

Query: 900  LIGVIRSFEFLSELRRMSVIVKGFKE-----NTYWSFTKGAPEVIADICNPATIPKDFHE 954
                           + +V VKG  E     +T +  +KG           ATI    +E
Sbjct: 495  ---------------KCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATI----NE 535

Query: 955  LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAAL 1014
              +     G R+   A  TL  SS   +     E++  +L F G I   +  +   K A+
Sbjct: 536  CANSMASEGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFTGLIGMNDPPRPNVKFAI 590

Query: 1015 KELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEE 1074
            ++L    +  +M TGD+  TAV++ +  G+                              
Sbjct: 591  EQLLQGGVHIIMITGDSENTAVNIAKQIGI------------------------------ 620

Query: 1075 GSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDE 1134
                      P+ DP+ S    ++GD      + DE + DD ++ V+   +I+AR +P+ 
Sbjct: 621  ----------PVIDPKLS---VLSGD------KLDE-MSDDQLANVIDHVNIFARATPEH 660

Query: 1135 KHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISC 1191
            K  +V  L+K    V   GDG ND  ALK ++IG+S+      VA   +  V    D S 
Sbjct: 661  KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST 720

Query: 1192 VLDVIKEGRASL--VTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVP 1249
            +L  I+EG+     + +F  FQ  +  +A+  + ++  +   + L   Q L+I++L+  P
Sbjct: 721  ILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGP 780

Query: 1250 IAISMSWSKPNSKLVKKRP 1268
             A S+     + +++KK P
Sbjct: 781  PAQSLGVEPVDHEVMKKPP 799

>Kwal_47.17547
          Length = 1240

 Score =  126 bits (316), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 190/887 (21%), Positives = 334/887 (37%), Gaps = 202/887 (22%)

Query: 503  YYAGCIFLISVLSIIDTVIETKKNSEKLADISHFN-----CEVRVYKDRFWTQVNSSDLV 557
            +  G   +I+VL +I  ++ +  + +K    S  N      EV V ++     ++  D++
Sbjct: 148  WVEGVAIMIAVLVVI--LVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDIL 205

Query: 558  PGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSK---------YAATEATMA 608
             GD+  +    +V  P D +L+ G C  +ES LTGES  + K         Y    AT A
Sbjct: 206  VGDILSLQTGDVV--PADCILVKGSCECDESALTGESATIKKAAIDVCYEKYKQLSATDA 263

Query: 609  QLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKG-SLVRSMV 667
             +                 L +G+K++        G+  A+V   G ++  G +L+   V
Sbjct: 264  AI---DIGTPGAEKVPDPMLISGSKLL-------SGLGRAVVTSVGVNSMHGRTLMALKV 313

Query: 668  FPKPVGFKFYEDSFK---------------YIGFMTLIAMF--GFSISCIQFIRLGLEYK 710
              +    +   DS                 +I FM  +A    G  +  +   + G  + 
Sbjct: 314  EAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELHDLTPAQKGSRFM 373

Query: 711  VMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKT 770
             + +  + +I + VP  LP  +T+  +FA  R+ K G            G    +C DKT
Sbjct: 374  NIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSATAVCSDKT 433

Query: 771  GTLTEEGLDV----LGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKN 826
            GTLTE  + V    LG  F     S   +  SD  TD D       L+  N   E   K+
Sbjct: 434  GTLTENRMTVVKGFLGSTFFDEAES---VGPSDSETDVD-------LAIANECSEELKKD 483

Query: 827  FLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYES-------WKFKNAEDKTGI 879
             L ++            L     + K  E  K + E  +         W   N   K   
Sbjct: 484  VLTNI-----------TLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNNKSKKPAT 532

Query: 880  SPAVVHPTS----------------------------NCNFIENDPD--NLIGVIRSFEF 909
            +  +V   +                            N +   ++PD   +  +++   F
Sbjct: 533  AKELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEKIVQIIPF 592

Query: 910  LSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIP---------KDFHELLHHYT 960
             S  +   ++VK +K   +  + KGA E++   C               KDF E     T
Sbjct: 593  ESSRKWGGIVVK-YKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTIT 651

Query: 961  H---NGFRIIACAGKTLPKS-SW------------------LYSQKVSR--------EEV 990
            +      R I+ A +  P   +W                  L+  +VSR        +E+
Sbjct: 652  NLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQEL 711

Query: 991  EDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERV 1050
               +   G +  ++ L+   + ++++ Q A +   M TGDN+LTA ++ +   ++S E+ 
Sbjct: 712  VSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQA 771

Query: 1051 FIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDE 1110
                                                 +PE S    + G  FR L   + 
Sbjct: 772  ------------------------------------ENPESS----MEGPRFRKLSNKER 791

Query: 1111 ILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGIS 1170
            +        +L    + AR SP++K  LVE L+K+   V   GDG ND  ALK A++G S
Sbjct: 792  V-------RILPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAPALKLADVGFS 844

Query: 1171 LSEAEASVAAPFTSAVF---DISCVLDVIKEGR--ASLVTSFSCFQYMSLYSAI--QFIT 1223
            +  A   VA   +  +    D S +++ IK GR  ++ +  F  FQ     +A+   F++
Sbjct: 845  MGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQFQLTVNVTAVVLTFVS 904

Query: 1224 ITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSA 1270
                    S L   Q L+++L++    A++++  KP+  +++++P  
Sbjct: 905  AVASSEEASVLTAVQLLWVNLIMDTLAALALATDKPDENILERKPKG 951

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 195/851 (22%), Positives = 324/851 (38%), Gaps = 200/851 (23%)

Query: 555  DLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEA--TMAQLLQ 612
            DL+ GD+  +    +V  P DAVLISG C  +ES LTGES  + K A   A     Q+ +
Sbjct: 256  DLLVGDVISLQTGDVV--PADAVLISGSCECDESALTGESDTIKKVALKPALEKYKQIFE 313

Query: 613  -----DXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSM- 666
                 D              L +G+K++        G+  A++   G ++  G ++ ++ 
Sbjct: 314  KDPTIDIGSHGVGEKVPDPLLISGSKLL-------SGIGNAVITSVGENSVNGRIMMALK 366

Query: 667  ----VFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRL----------------- 705
                  P         D+    G M  + +F      I FIR                  
Sbjct: 367  TESESTPLQERLSNLADNISIYGCMAALVLF-----IILFIRFLTYLPNGKKYHDLPPAQ 421

Query: 706  -GLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDM 764
             G ++  + + A+ +I + VP  LP  +T+  +FA  R+ K G            G    
Sbjct: 422  KGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATA 481

Query: 765  MCFDKTGTLTEEGLDV-------LGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDC- 816
            +C DKTGTLTE  + V       LG        +  I     L ++CD  L    LS+  
Sbjct: 482  ICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRSNCDASLLTDILSNIS 541

Query: 817  -------NSAEEFK-------------------AKNFLVSLLTCHSLKHIDGELLGDPLD 850
                   N   + K                   ++N   S L   ++K  D + LG   +
Sbjct: 542  LNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIADAMKENDEQFLGSKTE 601

Query: 851  LKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNL--IGVIRSFE 908
              +  F +       +S   K+           VH       +   P +L    V++   
Sbjct: 602  TALLAFAQ-------KSLGMKD-----------VHK------LRTKPSDLGIDKVVQVIP 637

Query: 909  FLSELRRMSVIVKGFKENTYWSFTKGAPEVIADIC------NPATIP-------KDFHEL 955
            F S  +  ++ V+      Y  + KGA E++  +C      + + +P       + F ++
Sbjct: 638  FESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKI 697

Query: 956  LHHYTHNGFRIIACAG---KTLPKSSWLYSQKVS---------REEVEDNLEFLGFIV-- 1001
                +H   R I+      K  P   +  S   S          E    NL   G  +  
Sbjct: 698  QDMASH-ALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDA 756

Query: 1002 ---FENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDN 1058
                ++ L+   K ++++ Q A +   M TGDN+LTA ++ R+  ++S            
Sbjct: 757  MVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILS------------ 804

Query: 1059 LEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYIS 1118
                          EEG           NDPE     A+ G  FR        LP   + 
Sbjct: 805  --------------EEG----------YNDPE----CAMEGPTFR-------KLPYKKML 829

Query: 1119 TVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASV 1178
             V+ K  + AR SP++K  LVE L+K+   V   GDG ND  ALK A++G S+  +   V
Sbjct: 830  RVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEV 889

Query: 1179 AAPFTSAVF---DISCVLDVIKEGRASLVT--SFSCFQYMSLYSAI--QFITITILYSRG 1231
            A   +  +    D + +++ IK GR   V+   F  FQ     +A+   F++        
Sbjct: 890  AREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAEET 949

Query: 1232 SNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILV----------PL 1281
            S L   Q L+++L++    A++++  KP+  ++ ++P     +P I V           L
Sbjct: 950  SVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKGR-DAPLIAVSTWKMILGQAAL 1008

Query: 1282 CLNITLILIFQ 1292
             L +T +L F+
Sbjct: 1009 QLTVTFVLHFR 1019

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 197/821 (23%), Positives = 323/821 (39%), Gaps = 162/821 (19%)

Query: 538  CEVRVYKDRFWTQVNSSDLVPGDL--FEISDPSLVVLPCDAVLI-SGDCIVNESMLTGES 594
             E  + +    + V +S+LVPGDL  F++ D     +P D  ++ S D  V+ES LTGE+
Sbjct: 146  AECHLTRSGQLSHVLASNLVPGDLVRFKVGDR----IPADLRIVESIDLCVDESNLTGEN 201

Query: 595  VPVSKYAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTG 654
             PV K  ++ A   +                   F GT    VR   G+G    +VI TG
Sbjct: 202  EPVHK--SSGAVDPKNYSHIPGSIIPVGDRNCIGFMGT---LVREGHGKG----IVIATG 252

Query: 655  FSTTKGSLVRSMV-FPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRL-------- 705
              T  GS+   M    KP                T +   G  +S + F+ +        
Sbjct: 253  KHTVFGSVFEMMSGIDKP-----------KTPLQTAMDKLGQDLSYMSFVLIGIICLIGI 301

Query: 706  --GLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVD 763
              G  +  M   A+ +    +P  LP  +T+  +  + R+ K+         V   G V+
Sbjct: 302  IQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVN 361

Query: 764  MMCFDKTGTLTEEGLDVLGI-HFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEF 822
            ++C DKTGTLT   + V  I      E  +  L LS       +V ++    + + A   
Sbjct: 362  VICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALS-------KVKERPIKMEQDVATTL 414

Query: 823  KAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPA 882
            +  N   +    +S +H+  + LG+P D+ + E  +                        
Sbjct: 415  RIGNICNN--GTYSQEHL--KYLGNPTDIAILESLQ------------------------ 446

Query: 883  VVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKEN-TYWSFTKGAPEVIAD 941
                    +F  ND  N +  I    F S+ + M+V  K    N     + KGA E I +
Sbjct: 447  --------HFGINDCRNSVNKINEIPFNSKRKFMAV--KTIDANDKVVVYVKGAFEKIVE 496

Query: 942  -----ICNPATI----PKD---FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREE 989
                 I     +    P D    ++        G R +A A   +   S  +  K   E+
Sbjct: 497  KSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEV---SATHGDKEFNED 553

Query: 990  VEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSER 1049
            + + L F G I   +  +   ++A++EL   ++  +M TGD   TAVS+ R  G      
Sbjct: 554  MVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIG------ 607

Query: 1050 VFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRND 1109
              IP +N                                PE S    ++GD         
Sbjct: 608  --IPVIN--------------------------------PEYS---VLSGDKL------- 623

Query: 1110 EILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGI 1169
            + + DD +++V+   +++AR +P+ K  +V  LQK    V   GDG ND  ALK A+IG+
Sbjct: 624  DQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV 683

Query: 1170 SLSEAEASVAAPFTSAVF---DISCVLDVIKEGRASL--VTSFSCFQYMSLYSAIQFITI 1224
            S+ +    VA   +  V    D S +L  I+EG+     + +F  FQ  +  +A+  + I
Sbjct: 684  SMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAI 743

Query: 1225 TILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLN 1284
            +      + L   Q L+I++L+  P A S+     + ++++K P     + KIL    L 
Sbjct: 744  STSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR--TDKILTDAVLK 801

Query: 1285 ITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSDNTVLF 1325
              LI       +I V     ++K  +  D  V S D T+ F
Sbjct: 802  RVLISAC----FIIVGTIYVFVKE-MAEDGQVTSRDTTMTF 837

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score =  122 bits (306), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 211/875 (24%), Positives = 356/875 (40%), Gaps = 172/875 (19%)

Query: 490  IFSIILWLADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWT 549
            + S  +   DD    +  I ++  +  I     ++K+ E L  +    C +  Y     T
Sbjct: 116  VLSFAIGQIDDAVSISLAILIVVTVGFIQEY-RSEKSLEALNKLVPTKCHLIRYGRESNT 174

Query: 550  QVNSSDLVPGDL--FEISDPSLVVLPCDAVLISG-DCIVNESMLTGESVPVSKYAATEAT 606
               +S+LVPGDL  F+I D     +P D  +I   D  ++ES LTGE+ P+ K A T   
Sbjct: 175  L--ASELVPGDLVRFKIGDR----IPADVRIIEAVDLSIDESNLTGETEPLHKDAQTIDP 228

Query: 607  MAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGS---LV 663
                 ++               + GT    V+   G+G    +VI TG +T+ G+   +V
Sbjct: 229  -----EEYDNRNVPVSERSCIAYMGT---LVKEGHGKG----IVIGTGTNTSYGAIFEMV 276

Query: 664  RSMVFPK-PVGFKFYEDSFKYIGF-MTLIAMFGFSISCIQFIRLGLEYKVMILRALDIIT 721
             S+  PK P+     +++   +G  ++ I+ F  +I  I  I  G    +M   ++ +  
Sbjct: 277  NSIEKPKTPL-----QETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAV 331

Query: 722  IVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVL 781
              +P  LP  +T+  +  + R+ K+         V   G V+++C DKTGTLT   + V 
Sbjct: 332  AAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVS 391

Query: 782  GIHFAKPEGS--STILQLSDLITDCDEVLQKHTLSD---CNSAEEFKAKNFLVSLLTCHS 836
             +      G+  + I    D   D  +   K TL+    CN+A+  +  N  +       
Sbjct: 392  KLFCLDSSGTYENAISPEEDSEFDVHDNDVKETLTIANICNNAKYSEEHNLYI------- 444

Query: 837  LKHIDGELLGDPLDLKMFE-FTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIEN 895
                     G+P D+ + E  TK+   +  +S +                          
Sbjct: 445  ---------GNPTDVALIEVLTKFGIPDQRDSHE-------------------------- 469

Query: 896  DPDNLIGVIRSFEFLSELRRMSVIVKGFKEN-TYWSFTKGAPEVIAD----ICNPATIPK 950
                    +    F S+ + M++  K  KE+  +  + KGA E I D      + A   +
Sbjct: 470  -------KMEELSFNSKRKYMAI--KSSKESGEHVLYIKGAFERILDKSSYYLDKAGEVR 520

Query: 951  DFHE--------LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVF 1002
            +F E          H    +G R IACA K  P  S      V  E+  + L F G    
Sbjct: 521  EFDEHSKVMVLEAAHSCASDGLRTIACAFK--PTDS----DNVISEDDINGLTFTGLFGL 574

Query: 1003 ENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEES 1062
             +  +   KA++++L    +  +M TGD+V TAVS+    GL   +R             
Sbjct: 575  ADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDR------------- 621

Query: 1063 RHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLM 1122
                       E SV+                   TGD      +  E L +D +S V+ 
Sbjct: 622  -----------ESSVM-------------------TGD------KVSE-LTEDELSKVID 644

Query: 1123 KGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPF 1182
            K +I+AR +P+ K  +V+ L+K    V   GDG ND  ALK A+IGI++  +   VA   
Sbjct: 645  KVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEV 704

Query: 1183 TSAVF---DISCVLDVIKEGRASL--VTSFSCFQYMSLYSAIQFITITILYSRGSNLGDF 1237
            +  +    D S +L  I+EG+     + +F  FQ     + +  I IT +    + L   
Sbjct: 705  SDMILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTIAKLPAPLNPM 764

Query: 1238 QFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWI 1297
            Q L+I++++  P A S+     +S ++ K P +     +I   L +NI L L++ L   I
Sbjct: 765  QILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSR--EERI---LNMNILLRLLY-LAICI 818

Query: 1298 AVQYTSWYMKPVVGGDDAVQSSDNTVLFFVSNFQY 1332
             V     ++K   G D+  Q++   +    + F +
Sbjct: 819  LVGTFYIFLK---GMDENQQTTSKDITMTFTGFVF 850

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 175/825 (21%), Positives = 323/825 (39%), Gaps = 157/825 (19%)

Query: 571  VLPCDAVLISGDCIVNESMLTGESVPVSKYAATEA-------------TMAQLLQDXXXX 617
            V+P D V+ISG C  +ES +TGES  + K+    +               ++ L      
Sbjct: 223  VVPADCVMISGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVN 282

Query: 618  XXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSM-VFPKPVGFKF 676
                      L +G++I+        G+   ++   G ++  G  + S+   P+    + 
Sbjct: 283  EDGNKIADCMLISGSRIL-------SGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQL 335

Query: 677  Y----EDSFKYIGFMTLIAMFGFSISCIQF--------------IRLGLEYKVMILRALD 718
            +     D+    G ++ I +F    +   F               + G ++  + + ++ 
Sbjct: 336  HLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSIT 395

Query: 719  IITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGL 778
            +I + VP  LP  +T+  +FA  R+ K G            G    +C DKTGTLTE  +
Sbjct: 396  VIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVM 455

Query: 779  DVL-GIHFAKPEGSSTILQLSD---------LITDCDEVLQKHTLSDCN-SAEEFKAKNF 827
             V+ G         S  L +S+            +C   L+   L++   ++  F+ +++
Sbjct: 456  TVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRNDLLANIVLNSTAFENRDY 515

Query: 828  LVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPT 887
              +    +  K++   L           F K    E  E   FKN  +K    P +   T
Sbjct: 516  KKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKKGNREDDEDQLFKNV-NKGRQEPFIGSKT 574

Query: 888  ----------------SNCNFIENDPD---NLIGVIRSFEFLSELRRMSVIVKGFKENT- 927
                                ++ + P    N+  V+++  F S  +   ++VK +KE   
Sbjct: 575  ETALLSLARLSLGLQPGELQYLRDQPMEKFNIEKVVQTIPFESSRKWAGLVVK-YKEGKN 633

Query: 928  ----YWSFTKGAPEVIADICNPATIPKDFHELLH------------HYTHNGFRIIACAG 971
                Y  F KGA E+++  C+      D  E ++            +   +  R I+ A 
Sbjct: 634  KKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKETDDEIKNLASDALRAISVAH 693

Query: 972  KTLPK-SSWLYSQKVSRE-----------EVEDNLEFLGFIVFENKLKSRTKAALKELQN 1019
            K   +  SW   Q   ++             +  L   G +  ++ L++  + ++++ Q 
Sbjct: 694  KDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQR 753

Query: 1020 ANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLD 1079
            A +   M TGDN+LTA ++ R+  ++S+                      D+  E     
Sbjct: 754  AGVTVRMVTGDNILTAKAIARNCAILST----------------------DISSE----- 786

Query: 1080 AVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELV 1139
                        +Y+ A+ G  FR L +N+ I        +L    + AR SP++K  LV
Sbjct: 787  ------------AYS-AMEGTEFRKLTKNERI-------RILPNLRVLARSSPEDKRLLV 826

Query: 1140 EQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVI 1196
            E L+ +   V   GDG ND  ALK A++G S+  +   VA   +  +    D S +++ I
Sbjct: 827  ETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAI 886

Query: 1197 KEGRASLVT--SFSCFQYMSLYSAI--QFITITILYSRGSNLGDFQFLYIDLLLIVPIAI 1252
            K GR   V+   F  FQ +   +A+   F++        S L   Q L+I+L++    A+
Sbjct: 887  KWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAAL 946

Query: 1253 SMSWSKPNSKLVKKRP---SANLVSPKILVPLCLNITLILIFQLL 1294
            +++  KP+  ++ ++P   S +L+S      +    TL LI   +
Sbjct: 947  ALATDKPDPNIMDRKPRGRSTSLISVSTWKMILSQATLQLIVTFI 991

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 199/861 (23%), Positives = 346/861 (40%), Gaps = 170/861 (19%)

Query: 451  SSIQE--DRTLAFGKNSVN------LKQKTVTEILFDEALHPFYVFQIFSIILWLADDYY 502
            SS++E   R   +G N ++      L +K ++  + D  +       I S+ L   DD  
Sbjct: 67   SSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLGNIDDAI 126

Query: 503  YYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDL- 561
                 I ++  +  +     ++K+ E L  +    C +   +    + V +++LVPGDL 
Sbjct: 127  SITMAIVIVVTVGFVQEY-RSEKSLEALNKLVPQECHL--IRGGRESNVLATNLVPGDLV 183

Query: 562  -FEISDPSLVVLPCDAVLIS-GDCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXX 619
             F I D     +P D  +I   D  ++ES LTGE+ PV K  + +A       D      
Sbjct: 184  RFRIGDR----IPADIRIIECNDLTIDESNLTGETDPVHK--SYKALSRDSYNDQPNSIV 237

Query: 620  XXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMV-FPKP-VGFKFY 677
                     + GT    V+   G+G    +V+ TG  T+ G++   M    KP    +  
Sbjct: 238  PVAERTNIAYMGT---LVKEGNGRG----IVVGTGRETSFGNVFEMMSSIEKPKTPLQLT 290

Query: 678  EDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTS 737
             D  K    ++L +     I C+  I  G  +  M   ++ +    +P  LP  +T+  +
Sbjct: 291  MD--KLGKDLSLASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLA 348

Query: 738  FALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDV-----LG--------IH 784
              + R+ K+         V   G V+++C DKTGTLT   + V     LG        + 
Sbjct: 349  LGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLS 408

Query: 785  FAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGEL 844
              K +G +    L+D   D    L    L  CN+A               +S +H   + 
Sbjct: 409  LDKNKGGNLKNYLTD---DVKTTLLCGNL--CNNAS--------------YSQEH--AKY 447

Query: 845  LGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVI 904
            LG+P D+ + E          +  KF+ A+ ++  +                       +
Sbjct: 448  LGNPTDVALLE----------QLQKFELADVRSEYTK----------------------V 475

Query: 905  RSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELL---HHYT- 960
            +   F S+ + M+  ++  ++ T   F KGA E I D  +     K   E L   H  T 
Sbjct: 476  KELSFNSKRKMMATKIQDNEKKTTL-FIKGAFERILDKSSSYLTEKGKIEKLTAGHRETI 534

Query: 961  --------HNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKA 1012
                      G R++A A + +  SS     K+  +++ D L F G I   +  +S  K 
Sbjct: 535  IDCANTLASEGLRVLAFAKRAMTDSS----SKLVEDDISD-LVFTGLIGMNDPPRSSVKF 589

Query: 1013 ALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVD 1072
            A+ +     I  +M TGD+  TAV++ R  G+                            
Sbjct: 590  AIDQFLQGGIHIIMITGDSENTAVNIARQIGI---------------------------- 621

Query: 1073 EEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSP 1132
                        P+ DP+ S    ++GD       N+  + DD ++ V+   +I+AR +P
Sbjct: 622  ------------PVIDPKLS---VLSGDKL-----NE--MTDDQLANVIDHVNIFARATP 659

Query: 1133 DEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DI 1189
            + K  +V  L++    V   GDG ND  ALK A+IG+S+      VA   +  +    D 
Sbjct: 660  EHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDF 719

Query: 1190 SCVLDVIKEGRASL--VTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLI 1247
            S +L  I+EG+     + +F  FQ  +  +A+  + ++  +   + L   Q L+I++L+ 
Sbjct: 720  STILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINILMD 779

Query: 1248 VPIAISMSWSKPNSKLVKKRP 1268
             P A S+     + +++KK P
Sbjct: 780  GPPAQSLGVEPVDHEVMKKPP 800

>Scas_707.48*
          Length = 741

 Score =  112 bits (280), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 181/786 (23%), Positives = 310/786 (39%), Gaps = 148/786 (18%)

Query: 457  RTLAFGKNSV------NLKQKTVTEILFDEALHPFYVFQIFSIILWLADDYYYYAGCIFL 510
            R L +G N +      +L +K ++  + D  +       + S I+   DD       I +
Sbjct: 67   RKLVYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSITLAIVI 126

Query: 511  ISVLSIIDTVIETKKNSEKLADISHFNCE-VRVYKDRFWTQVNSSDLVPGDL--FEISDP 567
            +  +  +     ++K+ E L  +    C  +R  ++   + V +S LVPGDL  F+I D 
Sbjct: 127  VVSVGFVQEY-RSEKSLEALNKLVPAECHLIRCGQE---SHVLASGLVPGDLVHFKIGDR 182

Query: 568  SLVVLPCDAVLISG-DCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXXXXXXX 626
                +P D  +I   D  ++ES LTGE+ PV K A  +        D             
Sbjct: 183  ----IPADLRIIEAVDLSIDESNLTGENEPVHKSA--KEVNKDSFNDQPNSIIPISDRTC 236

Query: 627  XLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGF 686
              + GT    V+   G+G+ + +   T F      ++ ++  PK       +++   +G 
Sbjct: 237  VAYMGT---LVKEGHGKGIVVGIGKNTSFGAIF-EMLSNIEKPKTP----LQNAMDKLGK 288

Query: 687  -MTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKK 745
             ++L +     + C+  I  G  +  M   ++ +    +P  LP  +T+  +  + R+ K
Sbjct: 289  DLSLFSFIVIGLICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 348

Query: 746  KGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCD 805
            +         V   G V+++C DKTGTLT         H      +S I  L       D
Sbjct: 349  RKAIVRRLPSVETLGSVNVICSDKTGTLTSN-------HMT----ASKIWCL-------D 390

Query: 806  EVLQKHTLSDCNSAEEFKAKNFLV----SLLT----CH--SLKHIDGELLGDPLDLKMFE 855
             +  K  +     ++    KN+L     S LT    C+  S     G+ LG+P D+ + E
Sbjct: 391  SMANKANVLSLEKSKSGSLKNYLTEDVKSTLTIGNICNNASFSQEHGKYLGNPTDIALLE 450

Query: 856  FTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRR 915
                      +  KF    D + I P           ++  P N      + + ++   +
Sbjct: 451  ----------QLSKF----DLSDIRPTFKK-------VQEIPFNSKRKFMAVKIVNSEGK 489

Query: 916  MSVIVKG-----FKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACA 970
             S+ VKG       + +++   KG  E +        I     E  +     G R++A A
Sbjct: 490  YSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVII-----ETANSLASEGLRMLAFA 544

Query: 971  GKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGD 1030
              TLP S  L +     EE   +L F G I   +  +   K A+++L    +  +M TGD
Sbjct: 545  KTTLPDSPTLLT-----EESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGD 599

Query: 1031 NVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPE 1090
            +  TAV++ R  G+                                        P+ DP+
Sbjct: 600  SENTAVNIARQIGI----------------------------------------PVLDPK 619

Query: 1091 KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVG 1150
             S    ++GD       N+  + DD ++ V+   +I+AR +P+ K  +V  L+K    V 
Sbjct: 620  LSV---LSGDKL-----NE--MSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVA 669

Query: 1151 FCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGRASL--VT 1205
              GDG ND  ALK A+IG+S+      VA   +  V    D S +L  I+EG+     + 
Sbjct: 670  MTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQ 729

Query: 1206 SFSCFQ 1211
            +F  FQ
Sbjct: 730  NFLTFQ 735

>Kwal_23.3160
          Length = 1100

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 187/848 (22%), Positives = 324/848 (38%), Gaps = 166/848 (19%)

Query: 445  VQHGLTSSIQEDRTLAFGKNSVNLKQKT-VTEILFDEALHPFYVFQIFSIILWLADDYYY 503
            +Q GL S+    R   +G+NS+    K     IL  +  +   +    S+++ LA   + 
Sbjct: 39   LQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAIRDWI 98

Query: 504  YAGCIFLISVLSIIDTVIETKKNSEKLADISHFNC-EVRVYKDRFWTQVNSSDLVPGDLF 562
              G I  +  +++     +  K S+ +  +   +     V +D     + S  LVPGDL 
Sbjct: 99   SGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGDLC 158

Query: 563  EISDPSLVVLPCDAVLISGDCI---VNESMLTGESVPVSK-----YAATEATMAQLLQDX 614
             +     V  P D  LI  +C+    +E++LTGES+P++K     Y ATE T        
Sbjct: 159  VVKAGDTV--PADLRLI--ECVNFETDEALLTGESLPIAKEASQVYPATEDT-------- 206

Query: 615  XXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGF 674
                         + +   +    +   +G A  +V++TG +T  G + +S+     +  
Sbjct: 207  ------------PVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254

Query: 675  KFYEDSFKYIGFMTLIAMFG----------------------FSISCIQFIRLGLEYKVM 712
            K    +F     +TL A  G                      F I+ +  I +    K +
Sbjct: 255  KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFV 314

Query: 713  ILRALDIITIVV-----PPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCF 767
            + + + I  I V     P +L   LTI  S     +  + +       +   G V+ +C 
Sbjct: 315  VNKEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCS 374

Query: 768  DKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNF 827
            DKTGTLT+ G  ++   +    G+ T+   S+     D  ++   L    S  ++K  + 
Sbjct: 375  DKTGTLTQ-GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIE---LIPRFSPHQYKHDST 430

Query: 828  L-VSLLTCHSLKHIDGELLGDPLDLKMFEFTKW-----------AYEE-GYESWKFKNAE 874
              V ++T    K  + +L   P  L    F  W            Y++   E WK     
Sbjct: 431  EDVGIITSFKNKFYNDKL---PAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDP 487

Query: 875  DKTGIS--------PAVVHPTSNCNFIENDPDNLIGV-----------IRSFEFLSELRR 915
             +  I         P       + +  E+D D  +G            I  F F S ++R
Sbjct: 488  TEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKR 547

Query: 916  MSVIVKGFKE-NTYWSFTKGAPEVIADIC-------------NPATIPKDFHELLHH--- 958
            MS +     E N +  FTKGA E + D C              P T  +D  E+  +   
Sbjct: 548  MSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMT-EEDKEEVFKNVET 606

Query: 959  YTHNGFRIIACAGKTLPKSSWLYSQ---KVSREEVEDNLEFLGFIVFENKLKSRTKAALK 1015
             +  G R++A A K+  +S  L      + +R+ VE +L F G +   +  +  T  A+K
Sbjct: 607  LSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVK 666

Query: 1016 ELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEG 1075
            +   A I   M TGD   TA ++ ++ G++                 R+L  +     + 
Sbjct: 667  QFHKAGINVHMLTGDFPGTAKAIAQEVGIL----------------PRNLYHYPKEVVDS 710

Query: 1076 SVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEK 1135
             V+ A     L D E                          I  +L+   + AR +P  K
Sbjct: 711  MVMTAAQFDQLTDEE--------------------------IDNLLLLPLVIARCAPQTK 744

Query: 1136 HELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCV 1192
              +++ L + +      GDG ND  +LK AN+GI++    + VA   +  V    + + +
Sbjct: 745  VRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASI 804

Query: 1193 LDVIKEGR 1200
            L+ ++EGR
Sbjct: 805  LNAVEEGR 812

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 133/540 (24%), Positives = 241/540 (44%), Gaps = 89/540 (16%)

Query: 691  AMFGFSISCIQFIRLG-LEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIF 749
             +F  SI  + F   G  ++ V I+R L + + ++P +L   L +G S    +++     
Sbjct: 417  CVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATI 476

Query: 750  CISPTRVNV----GGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITD-C 804
              +  R +      G+++ +  DKTGTLT+  + +  +H       S  +   D++TD  
Sbjct: 477  PDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGT---VSYTMDTMDIVTDYV 533

Query: 805  DEVLQKHTLSDCNSAEEFK-----AKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMF 854
             E++   T +    +   K      ++ +V+L  CH++     DGEL      P ++ + 
Sbjct: 534  QELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIV 593

Query: 855  EFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELR 914
            +FT+     G   +K     D+  +S  + H  S  NF E D      +++ F F S+ +
Sbjct: 594  KFTESV---GLSLFK----RDRHSVS--LFHQHSATNF-EYD------ILQVFPFNSDTK 637

Query: 915  RMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTL 974
            RM +IV    +  +W   KGA  V+A I           E + +    G R +    K L
Sbjct: 638  RMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDW---LDEEVGNMAREGLRTLVIGRKKL 694

Query: 975  -PKSSWLYSQK-----------------VSREEVEDNLEFLGFIVFENKLKSRTKAALKE 1016
             PKS   + ++                 V ++ +E NLE LG    E+KL++  K++++ 
Sbjct: 695  SPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIEL 754

Query: 1017 LQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGS 1076
            L+NA ++  M TGD V TA  V   + LIS  +    +++   + SR          EG+
Sbjct: 755  LRNAGVKIWMLTGDKVETARCVSISAKLISRGQ----YVHTVTKLSR---------PEGA 801

Query: 1077 VLDAVTLKPLNDPEKSYTLAITGD---IFRILFRND--EILPDDYISTVLMKGSIYARMS 1131
             L+A+    +N   KS  L I G+   +F   ++ +  +I+ D       +   I  R +
Sbjct: 802  -LNALEYLKIN---KSSCLLIDGESLGMFLTYYKQEFFDIVVD-------LPAVIACRCT 850

Query: 1132 PDEKHELVEQLQKLDYNVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVF 1187
            P +K ++   ++++      C GDG ND   ++ A++G+ +   E   AS+AA F+   F
Sbjct: 851  PQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQF 910

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 177/786 (22%), Positives = 317/786 (40%), Gaps = 143/786 (18%)

Query: 545  DRFWTQVNSSDLVP------GDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGE 593
            +  +  +N+S LVP      GDL ++   S +  P D +L+     SG+  V    L GE
Sbjct: 271  NELYEVLNNSQLVPSKNLRVGDLVKLHKDSRI--PADMILLQSSEPSGETFVKTDQLDGE 328

Query: 594  S---VPVSKYAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQP--------- 641
            +   + V+       T  ++L                +F G    +  + P         
Sbjct: 329  TDWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIH-MFTGKLTYKGSSAPLSVDNTLWA 387

Query: 642  -----GQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFS 696
                   G  +A VI TG + T+ ++  S    K    +   +S   I     + +  F+
Sbjct: 388  NTVLASSGTCVACVIYTG-TDTRQAMNTSKSSVKTGLLELEINSLSKI-----LCICVFT 441

Query: 697  ISCIQFIRLGLE---YKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISP 753
            +S +  +  GL+   + V I+R L + + ++P +L   L +G S    +++       + 
Sbjct: 442  LSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTI 501

Query: 754  TRVNV----GGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQ 809
             R +      G+++ +  DKTGTLT+  + +  IH       S  ++  D++TD  + L 
Sbjct: 502  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGT---VSYTMETMDMVTDYIQTLT 558

Query: 810  KHT------LSDCNSAEEF--KAKNFLVSLLTCHSL--KHIDGELL---GDPLDLKMFEF 856
                     ++   S +E   + ++ +V+L TCH++     D EL      P ++ + +F
Sbjct: 559  SPANMGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKF 618

Query: 857  TKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRM 916
            T+     G   +K     D+  ++  + H  S  N   +       ++  F F S+ +RM
Sbjct: 619  TE---RVGLSLFK----RDRHSLT--LFHEYSGVNLQYD-------ILHVFPFTSDTKRM 662

Query: 917  SVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPK 976
             +IV+   +N  W   KGA  V++ I           E + +    G R +  A K L  
Sbjct: 663  GIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVSNMAREGLRTLVIARKKL-- 717

Query: 977  SSWLYSQ--------------------KVSREEVEDNLEFLGFIVFENKLKSRTKAALKE 1016
            S+ LY Q                    +V +  +E NLE LG    E+KL+   K +++ 
Sbjct: 718  STRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIEL 777

Query: 1017 LQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGS 1076
            L+NA ++  M TGD V TA  V   + LIS  +                L+ RD    G+
Sbjct: 778  LRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITK---------LTRRD----GA 824

Query: 1077 VLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKH 1136
            +     LK      ++  L I GD   I   +     + +   + +   I  R +P +K 
Sbjct: 825  LSRLEYLK----ANRNSCLLIDGDSLAIYMSHYR--AEFFEIVICLPVVIACRCTPQQKA 878

Query: 1137 ELVEQLQKLDYNVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCV 1192
            ++   ++++      C GDG ND   ++ A++G+ +   E   AS+AA ++   F   C 
Sbjct: 879  DVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQF---CH 935

Query: 1193 LD--VIKEGRASLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPI 1250
            L   ++  GR S   S    Q++ ++  +       +YS  SNL              PI
Sbjct: 936  LTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISVCQAVYSISSNLK-------------PI 981

Query: 1251 AISMSW 1256
            A+   W
Sbjct: 982  ALYQGW 987

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 146/655 (22%), Positives = 265/655 (40%), Gaps = 102/655 (15%)

Query: 644  GMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFI 703
            G  +A V+ TG  T +     +      V     E     I  +    +F  SI  + F 
Sbjct: 378  GFCIACVVYTGRDTRQAMNTTT----AKVKTGLLELEINSISKILCACVFALSILLVAFA 433

Query: 704  RL-GLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV---- 758
                 ++ + ILR L + + ++P +L   L +  S    +++       +  R +     
Sbjct: 434  GFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPED 493

Query: 759  GGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQL-----SDLITDCDEVLQ--KH 811
             G+++ +  DKTGTLT+  + +  IH      +S  L +       L++  ++ L   K 
Sbjct: 494  LGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKV 553

Query: 812  TLSDCNSAEEFKAKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYE 866
             LS       F+ ++ +++L  CH++     D EL      P ++ + +FT+     G  
Sbjct: 554  ALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV---GLS 610

Query: 867  SWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKEN 926
             +K     D+  IS    H     N+          +++ F F S+ +RM +IV+  + +
Sbjct: 611  LFK----RDRHSISLLHEHSGKTLNY---------EILQVFPFNSDSKRMGIIVRDEQLD 657

Query: 927  TYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK-- 984
             YW   KGA  V++ I           E   +    G R +    K L K  +   QK  
Sbjct: 658  EYWFMQKGADTVMSKIVESNDW---LEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEY 714

Query: 985  -------VSREE---------VEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCT 1028
                   ++R++         +E +LE LG    E+KL+   K++++ L+NA I+  M T
Sbjct: 715  NDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 774

Query: 1029 GDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLND 1088
            GD V TA  V   + LIS                +++ +   V       + +    +N 
Sbjct: 775  GDKVETARCVSISAKLIS--------------RGQYVHTITKVTRPEGAFNQLEYLKIN- 819

Query: 1089 PEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYA-RMSPDEKHELVEQLQKLDY 1147
              ++  L I G+   +  ++ E    ++   V+   ++ A R +P +K ++   ++K+  
Sbjct: 820  --RNACLLIDGESLGMFLKHYE---QEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTG 874

Query: 1148 NVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCVLD--VIKEGRA 1201
                C GDG ND   ++ A++G+ +   E   AS+AA F+   F   C L   ++  GR 
Sbjct: 875  KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CHLTELLLWHGRN 931

Query: 1202 SLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSW 1256
            S   S    Q+              +  RG  +   Q +Y    L  PIA+   W
Sbjct: 932  SYKRSAKLAQF--------------VMHRGLIIAICQAVYSICSLFEPIALYQGW 972

>Kwal_23.5789
          Length = 1133

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 159/729 (21%), Positives = 297/729 (40%), Gaps = 121/729 (16%)

Query: 551  VNSSDLVPGDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGES-------VPVS 598
            V S DL  GDL +I   +    P D VL+     SG+  +    L GE+        P++
Sbjct: 251  VPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLT 308

Query: 599  KYAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQP--------------GQG 644
            ++ + +     LL                         +++QP                G
Sbjct: 309  QHLSQD----DLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAG 364

Query: 645  MALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIR 704
             A+A V+ TG + T+ ++  SM     V     E     +  +    +F  S++ + F  
Sbjct: 365  TAIACVVYTG-ADTRQAMNTSM---SSVKTGLLELEINSLSKILCACVFILSVALVAFAG 420

Query: 705  LGL-EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----G 759
                ++ V I+R L + + ++P +L   L +G S    +++       +  R +      
Sbjct: 421  FNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDL 480

Query: 760  GKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSA 819
            G+++ +  DKTGTLT+  +++  +H       S  +   D++TD    +  +  S    +
Sbjct: 481  GRIEYLLSDKTGTLTQNDMELKKLHLGT---VSYTMDTMDIVTDYVRAMSDNLNSSAVPS 537

Query: 820  EEFK-----AKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESWK 869
               K      ++ +++L  CH +     DGEL      P ++ + +FT+     G   ++
Sbjct: 538  ASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESV---GLTLFR 594

Query: 870  FKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYW 929
                 D+  I+  ++H  S  NF E D      ++  F F S+ +RM +++   +++ YW
Sbjct: 595  ----RDRHSIT--LLHDQSGTNF-EYD------ILHVFPFNSDNKRMGIVIFDKQKDEYW 641

Query: 930  SFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPK------------- 976
               KGA  V++ I           E   +    G R +    K L K             
Sbjct: 642  FLQKGADVVMSKIVQKNDW---LEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDA 698

Query: 977  SSWLYSQKVSREEV-----EDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDN 1031
            S  + +++V+   V     E +LE LG    E+KL+   K++++ L+NA I+  M TGD 
Sbjct: 699  SLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758

Query: 1032 VLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEK 1091
            V TA  V   + L+S                +++ +   V++    L  + L  +N    
Sbjct: 759  VETARCVSISAKLVS--------------RGQYVHTVTKVNKPEGALTHLELLKIN---T 801

Query: 1092 SYTLAITGDIFRILFRNDEILPDDYISTVL-MKGSIYARMSPDEKHELVEQLQKLDYNVG 1150
            +  L I G+   +     E     +   V+ +   I  R +P +K ++   ++++     
Sbjct: 802  NSCLLIDGESLGLYL---EYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRV 858

Query: 1151 FC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCVLD--VIKEGRASLV 1204
             C GDG ND   +++A++G+ +   E   AS+AA F+   F   C L   ++  GR S  
Sbjct: 859  CCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQF---CHLSKLLLWHGRNSYK 915

Query: 1205 TSFSCFQYM 1213
             S    Q++
Sbjct: 916  RSAKLAQFV 924

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 185/848 (21%), Positives = 323/848 (38%), Gaps = 179/848 (21%)

Query: 445  VQHGLTSSIQEDRTLAFGKNSVNLKQK-TVTEILFDEALHPFYVFQIFSIILWLADDYYY 503
            +  GL ++   +R    G+N++    K  +  I   +  +   +  I S+++  A   + 
Sbjct: 35   INQGLNTTQIAERLGLIGENTLGDDSKINIKGIFISQICNAMIMVLIISMVISFAIKDWI 94

Query: 504  YAGCIFLISVLSIIDTVIETKKNSEKLADISHFNC-EVRVYKDRFWTQVNSSDLVPGDLF 562
              G I  +  ++++    +    S+ +  +   +     V +      + S +LVPGD+ 
Sbjct: 95   SGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRAGNDLTIESKELVPGDIC 154

Query: 563  EISDPSLVVLPCDAVLISG-DCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXX 621
             I     V  P D  L    +   +E++LTGES+PV+K           + D        
Sbjct: 155  IIRVGDTV--PADLRLFEAINLETDEALLTGESLPVAKSHGEVYEQDTPVGDRLNLA--- 209

Query: 622  XXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSF 681
                   F  + + +       G A  +VI+T  +T  G + +S+     +  +    SF
Sbjct: 210  -------FAASTVTK-------GRATGIVIKTALNTEIGKIAKSLKSEASLISRDKSKSF 255

Query: 682  KYIGFMTL---IAMF-GFSISCIQFIRLGL--------------------EYKV---MIL 714
                ++TL   I  F G S+      +L                      ++KV   + +
Sbjct: 256  GRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQVAI 315

Query: 715  RALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLT 774
             A+ +   ++P +L   LTI  S     +  + +       +   G V+ +C DKTGTLT
Sbjct: 316  YAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTGTLT 375

Query: 775  EEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFK---AKNFLVSL 831
            +                        +I     + Q  T++  NS E F     +  L+  
Sbjct: 376  Q----------------------GKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPK 413

Query: 832  LTCHSLKHIDGELLG--------------DPLDLKMFEFTKWAYEEGY----------ES 867
             + +  KH D E +G               PL++ +F  T+W Y              E+
Sbjct: 414  FSPYQYKHDDEEDVGMITDFKSKYYADELGPLNVSLF--TQWLYTATLANIATVFRDPET 471

Query: 868  WKFKNAEDKTGISPAVVH-----PTSNCNFIENDPDNLIGVIRSFEFLSE------LRRM 916
              +K   D T I+  V       P       +ND +  I    +FE ++E      ++RM
Sbjct: 472  QDWKAHGDPTEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRM 531

Query: 917  SVIVKGFKENT---YWSFTKGAPEVIADICN-----PATIPKDFHEL--------LHHYT 960
            S I K  +E     Y  FTKGA E +   CN     P   P+   E         +   +
Sbjct: 532  SAIYKNVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLS 591

Query: 961  HNGFRIIACAGKTLPKSSWLYSQKV---SREEVEDNLEFLGFIVFENKLKSRTKAALKEL 1017
              G R++A A KT  +S +  ++      R+ VE+NL FLG +   +  +  + AA+K+ 
Sbjct: 592  SEGLRVLAFAKKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKC 651

Query: 1018 QNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSV 1077
              A I   M TGD   TA S+ ++ G++       P      +E  + +          V
Sbjct: 652  HLAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYP------KEVVNFM----------V 695

Query: 1078 LDAVTLKPLNDPEKSYTLAITGDIFRILFRNDE--ILPDDYISTVLMKGSIYARMSPDEK 1135
            + A     L+D E                  DE  +LP            + AR +P  K
Sbjct: 696  MTATDFDALSDKEI-----------------DELPVLP-----------LVIARCAPQTK 727

Query: 1136 HELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCV 1192
              ++E L + +      GDG ND  +LK AN+GI++    + VA   +  V    + + +
Sbjct: 728  VRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASI 787

Query: 1193 LDVIKEGR 1200
            L+ ++EGR
Sbjct: 788  LNAVEEGR 795

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 177/833 (21%), Positives = 327/833 (39%), Gaps = 149/833 (17%)

Query: 445  VQHGLTSSIQEDRTLAFGKNSVNLKQK-TVTEILFDEALHPFYVFQIFSIILWLADDYYY 503
            +  GL ++   +R    G+N++    K  +  IL  +  +   +  I S+++ LA   + 
Sbjct: 35   INQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVITLAIKDWI 94

Query: 504  YAGCIFLISVLSIIDTVIETKKNSEKLADISHFNC-EVRVYKDRFWTQVNSSDLVPGDLF 562
              G +  +  ++++    +    S+ +  +   +     V +D     + S +LVPGD+ 
Sbjct: 95   SGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGDIC 154

Query: 563  EISDPSLVVLPCDAVLI-SGDCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXX 621
             I     V  P D  L+ S +   +E++LTGES+PV+K  +        + D        
Sbjct: 155  IIKVGDTV--PADLRLLESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLA--- 209

Query: 622  XXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSM-------------VF 668
                   F  + + +       G A  +VI+T  +T  G + +S+              F
Sbjct: 210  -------FAASTVTK-------GRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSF 255

Query: 669  PKPVGFKFYEDSFKYIG----------FMTLIAMFGFSISCIQFIRLGLE-YKV---MIL 714
             + +     E    ++G             L  +          + +G + Y+V   + +
Sbjct: 256  GQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKYRVNKQVAI 315

Query: 715  RALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLT 774
             A+ +   ++P +L   LTI  S     +  + +       +   G V+ +C DKTGTLT
Sbjct: 316  YAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLT 375

Query: 775  EEGLDVLGIHFAK----PEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVS 830
            +      G   AK    P+  +  +Q S+   +   + + H +   +  +        V 
Sbjct: 376  Q------GKMIAKQVWIPQFGTITVQESNEPFN-PTIGEIHLIPKFSPYQYKHDDEEDVG 428

Query: 831  LLTCHSLKHIDGELLGDPLDLKMFEFTKWAYE----------EGYESWKFKNAEDKTGIS 880
            ++     K++ GEL   PL++ +F+  +W Y           +  E+  +K   D T I+
Sbjct: 429  IIPDFKSKYLAGEL--GPLNVSLFD--QWLYTATLANIATVFQDSETQDWKAHGDPTEIA 484

Query: 881  PAVVH-----PTSNCNFIENDPDNLIGVIRSFEFLSE------LRRMSVIVKGFKENT-- 927
              V       P       + D +       SFE ++E      ++RMS I K  ++    
Sbjct: 485  IQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATP 544

Query: 928  -YWSFTKGAPEVIADICN---------PATIPKDFHELLHH----YTHNGFRIIACAGKT 973
             Y  FTKGA E +   C+         P+ + K+  E +       +  G R++A A K+
Sbjct: 545  IYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKS 604

Query: 974  LPKSSWLYSQK---VSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGD 1030
              +S +  ++      R+ VE  L FLG I   +  +  + AA+K+   A I   M TGD
Sbjct: 605  FNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGD 664

Query: 1031 NVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPE 1090
               TA S+ ++ G++       P      +E  + +          V+ A     L+D E
Sbjct: 665  FPGTAKSIAQEVGILPHNLYHYP------KEVVNFM----------VMAATDFDALSDQE 708

Query: 1091 KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVG 1150
                     D  R+L                    + AR +P  K  ++E L +      
Sbjct: 709  I--------DDLRVL------------------PLVIARCAPQTKVRMIEALHRRSKFCA 742

Query: 1151 FCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGR 1200
              GDG ND  +LK AN+GI++    + VA   +  V    + + +L+ ++EGR
Sbjct: 743  MTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 795

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 132/549 (24%), Positives = 233/549 (42%), Gaps = 93/549 (16%)

Query: 708  EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----GGKVD 763
            ++ V I+R L + + ++P +L   L +G S    +++       +  R +      G+++
Sbjct: 442  DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIE 501

Query: 764  MMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFK 823
             +  DKTGTLT+  + +  IH      ++  +   D++TD  + +   T    NS     
Sbjct: 502  YLLSDKTGTLTQNDMQLKKIHLGTVSYTNETM---DIVTDFIQSMNSRT---SNSTPTTT 555

Query: 824  AKN-------FLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESWKFK 871
             KN        + +L  CH++     DGEL      P ++ + +FT+     G   ++  
Sbjct: 556  RKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESV---GLSLFR-- 610

Query: 872  NAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSF 931
               D+  IS  + H  S    +E D   L      F F S+ +RM VI+    +  YW  
Sbjct: 611  --RDRHSIS--LFHDHSGMK-LEYDIKIL------FPFNSDSKRMGVIIFDKLKQEYWFL 659

Query: 932  TKGAPEVIADICNPATIPKDF-HELLHHYTHNGFRIIACAGKTLPKSSW----------- 979
             KGA  V++ I     +  D+  E   +    G R +    K L  + +           
Sbjct: 660  QKGADTVMSSI----VVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEAS 715

Query: 980  -------LYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNV 1032
                   ++ Q V R+ +E++LE LG    E+KL+   K++++ L+NA I+  M TGD V
Sbjct: 716  LTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 775

Query: 1033 LTAVSVGRDSGLISSERVFIPFLNDNLEE-SRHLLSWRDVDEEGSVLDAVTLKPLNDPEK 1091
             TA  V   + LIS  +        N  E + H L +  V++   +L             
Sbjct: 776  ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLL------------- 822

Query: 1092 SYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYA-RMSPDEKHELVEQL-QKLDYNV 1149
                 I G+   +     +  PD++   V+   ++ A R +P +K ++   + Q     V
Sbjct: 823  -----IDGESLGLYL---QYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRV 874

Query: 1150 GFCGDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCVLD--VIKEGRASLV 1204
               GDG ND   ++ A++G+ +   E   AS+AA F+   F   C L   ++  GR S  
Sbjct: 875  CCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF---CHLTKLLLWHGRNSYK 931

Query: 1205 TSFSCFQYM 1213
            +S    Q++
Sbjct: 932  SSAKLSQFV 940

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 180/840 (21%), Positives = 330/840 (39%), Gaps = 159/840 (18%)

Query: 445  VQHGLTSSIQEDRTLAFGKNSVNLKQK-TVTEILFDEALHPFYVFQIFSIILWLADDYYY 503
            ++ GLT+     R    G N++  ++   V  IL  +  +   +  I S+++ LA   + 
Sbjct: 37   LRRGLTAEEARARLEVVGDNTLGEEEGINVRAILLKQMCNAMILVLIISMVIALAIKDWI 96

Query: 504  YAGCIFLISVLSI-IDTVIETK--KNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGD 560
              G I  +  L++ I    E    K    L D+S      RV ++     + S+ +VPGD
Sbjct: 97   SGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLS--TPSARVIRNGEDVVMASAQVVPGD 154

Query: 561  LFEISDPSLVVLPCDAVLISG-DCIVNESMLTGESVPVSKYAATEATMAQLLQDXXXXXX 619
            + ++     V  P D  L+   +   +E++LTGE++PV+K  A     A   QD      
Sbjct: 155  IVQVRVGDTV--PADLRLVEALNLETDEALLTGEALPVAKDPA-----AVFEQD------ 201

Query: 620  XXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKFYED 679
                    + +   +    +   +G A  +V+RTG  +  G +  S+   + +  +    
Sbjct: 202  ------TPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENK 255

Query: 680  SFKYIGFMTLIAMFG----------------------FSISCIQFIRLGLEYKVMILRAL 717
            S      +T+ A  G                      F+I+ +  + +    K ++ R +
Sbjct: 256  SGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQKFIVNREV 315

Query: 718  DIITIVV-----PPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGT 772
             I  I V     P +L   LTI  S     +  + +       +   G V+ +C DKTGT
Sbjct: 316  AIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGT 375

Query: 773  LTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFL---- 828
            LT +G  +L      PE  + ++  S++  D        T+ D +    F    +     
Sbjct: 376  LT-QGKMILK-QLWVPEFGTVVVNRSNVPFD-------PTVGDVSLIPRFSPWEYQHDEE 426

Query: 829  --VSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYE----------EGYESWKFKNAEDK 876
              V ++     +     L   P  L   +F  W +           +  +S +++   D 
Sbjct: 427  EDVGIIANFKQRWQSNSL---PKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDP 483

Query: 877  TGISPAVV-----HP----TSNCNFIENDPDNLIGVIRSFE------FLSELRRMSVIVK 921
            T I+  V      HP    T+  +  ++D        R +E      F S ++RMS +  
Sbjct: 484  TEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKRMSAVYI 543

Query: 922  GFKE-NTYWSFTKGAPEVIADIC-----NPAT-----IPKDFHELLHH----YTHNGFRI 966
              ++ NT   FTKGA E +   C     +P T     + +D  E++       ++ G R+
Sbjct: 544  NLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRV 603

Query: 967  IACAGKTLP-KSSWLYSQKVSREE--VEDNLEFLGFIVFENKLKSRTKAALKELQNANIR 1023
            +A A KT+P + +    ++++++   VE +L F G +   +  +  T  A+K+   A I 
Sbjct: 604  LAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGIN 663

Query: 1024 TVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTL 1083
              M TGD   TA ++ ++ G++       P      +E   ++          V+ A   
Sbjct: 664  VHMLTGDFPGTAKAIAQEVGILPHNLYHYP------KEVVDIM----------VMTATQF 707

Query: 1084 KPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQ 1143
              L D E                    +LP            + AR +P  K  +++ L 
Sbjct: 708  DSLTDEE---------------LDQLPVLP-----------LVIARCAPQTKVRMIDALH 741

Query: 1144 KLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGR 1200
            + +      GDG ND  +LK AN+GI++    + VA   +  V    + + +L+ ++EGR
Sbjct: 742  RREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 801

>Scas_704.38
          Length = 1161

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 152/702 (21%), Positives = 275/702 (39%), Gaps = 113/702 (16%)

Query: 551  VNSSDLVPGDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGES---VPVSKYAA 602
            V S DL  GDL +IS      LP D VL+     SG+  +    L GE+   + ++    
Sbjct: 275  VPSKDLKVGDLIKISKGDR--LPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALT 332

Query: 603  TEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQP--------------GQGMALA 648
               T   L+                           + P                G  + 
Sbjct: 333  QNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIG 392

Query: 649  LVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRL-GL 707
             V+ TG  T +     +      V     E     I  +   ++F  SI  + F      
Sbjct: 393  CVVYTGRDTRQAMNTTTAT----VKTGLLELEINSISKILCASVFALSIILVVFAGFHNS 448

Query: 708  EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----GGKVD 763
            ++ + ++R L + + ++P +L   L +  S    +++       +  R +      G+++
Sbjct: 449  DWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIE 508

Query: 764  MMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEF- 822
             +  DKTGTLT+  + +  IH      +S  L   D+++D  + L   + S   S +   
Sbjct: 509  YLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL---DIVSDYVDALVNSSNSANPSGKSVP 565

Query: 823  ---------KAKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESW 868
                     + ++ +V+L  CH++     D EL      P ++ + +FT+     G   +
Sbjct: 566  STSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV---GLSLF 622

Query: 869  KFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTY 928
            K     D+  IS    H  S   +          +++ F F S+ +RM +IV   +++ Y
Sbjct: 623  K----RDRHSISLLHGHSGSILTY---------EILQVFPFNSDSKRMGIIVHDEQKDEY 669

Query: 929  WSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK---- 984
            W   KGA  V+A I           E   +    G R +    K L ++ +   +K    
Sbjct: 670  WFMQKGADTVMARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDD 726

Query: 985  -----VSREE---------VEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGD 1030
                 V+R++         +E +LE LG    E+KL++  K++++ L+NA I+  M TGD
Sbjct: 727  ASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGD 786

Query: 1031 NVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPE 1090
             V TA  V   + LIS  +              H+++ +    EG++     LK      
Sbjct: 787  KVETARCVSISAKLISRGQYV------------HIIT-KLTKPEGALNQLEYLK----VN 829

Query: 1091 KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYA-RMSPDEKHELVEQLQKLDYNV 1149
            K   L I G+   +  R       ++   V+   ++ A R +P +K ++   +++     
Sbjct: 830  KGACLLIDGESLGMFLR---YYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKR 886

Query: 1150 GFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVF 1187
              C GDG ND   ++ A++G+ +   E   AS+AA F+   F
Sbjct: 887  VCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEF 928

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 164/706 (23%), Positives = 272/706 (38%), Gaps = 122/706 (17%)

Query: 551  VNSSDLVPGDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGESVPVSKYAAT-- 603
            V S DL  GDL +IS  + V  P D +L+     SG+  +    L GE+    + A T  
Sbjct: 259  VASKDLKVGDLIKISKGARV--PADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLT 316

Query: 604  EATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPG---------------QGMALA 648
            +      L +               F G    +  N  G                G  + 
Sbjct: 317  QNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIG 376

Query: 649  LVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRL-GL 707
             VI TG  T +     S      V     E     I  +    +F  SI  + F  L   
Sbjct: 377  CVIYTGRDTRQAMNTTS----AKVKTGLLELEINDISKILCACVFILSILLVVFAGLHND 432

Query: 708  EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----GGKVD 763
            ++ V I+R L + + ++P +L   L +  S    +++       +  R +      G+++
Sbjct: 433  DWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIE 492

Query: 764  MMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDC---------DEVLQKHTLS 814
             +  DKTGTLT+  + +  +H       S   + +D+++D          D V      S
Sbjct: 493  YLLSDKTGTLTQNDMQLKKVHLGNV---SYTTETADIVSDYIQGMIESKNDSVTNLGPRS 549

Query: 815  DCNSAEEFKAKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESWK 869
                       + + +L  CH++     D EL      P ++ + +FT+     G   +K
Sbjct: 550  TTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV---GLSLFK 606

Query: 870  FKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYW 929
                 D+  +S    H  +  N+          V+  F F S+ +RM +IV   +++ YW
Sbjct: 607  ----RDRHSMSLLHEHSGTILNY---------DVLTMFPFNSDTKRMGIIVYDKQKDQYW 653

Query: 930  SFTKGAPEVIADICNPATIPKDF-HELLHHYTHNGFRIIACAGKTLPKSSWLYSQ-KVSR 987
               KGA  V+    N      D+  E   +    G R +    K L K   +Y Q K   
Sbjct: 654  FLQKGADTVM----NRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKK--IYEQFKKEY 707

Query: 988  EEV-------------------EDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCT 1028
            EEV                   E +LE LG    E+KL+   K++++ L+NA I+  M T
Sbjct: 708  EEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 767

Query: 1029 GDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLND 1088
            GD V TA  V   + LIS  +              H+++ +    EG+      LK    
Sbjct: 768  GDKVETARCVSISAKLISRGQYV------------HVVT-KLSKPEGAFNQLEYLK---- 810

Query: 1089 PEKSYTLAITGD---IFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKL 1145
              K+  L I G+   +F   +R +      ++ TV     I  R +P +K ++   +++L
Sbjct: 811  VNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTV-----IACRCTPQQKADVALIIREL 865

Query: 1146 DYNVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVF 1187
                  C GDG ND   ++ A++G+ +   E   AS+AA F+   F
Sbjct: 866  TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF 911

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 119/498 (23%), Positives = 206/498 (41%), Gaps = 68/498 (13%)

Query: 760  GKVDMMCFDKTGTLTEEGLDVLGIHFAK-------PEGSSTILQLSDLITDCDEVLQKHT 812
            G+++ +  DKTGTLT   ++   +  A        PE     ++    I        K  
Sbjct: 556  GQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDK 615

Query: 813  LSDCNSAEEFKAKNFLVSLLTCHSL---KHIDGELLGDPLDLKMFEFTKWAYEEGYESWK 869
            ++D    E      FL  L TCH++      DG +             K+      E   
Sbjct: 616  MTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTI-------------KYQAASPDEGAL 662

Query: 870  FKNAEDKTGISPAVVHPTS---NCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKEN 926
             + A D  G    +  P S   +  F E     L+ +    EF S  +RMS I +   + 
Sbjct: 663  VQGAAD-LGFRFDIRRPNSVSISTPFSEQLEYQLLNIC---EFNSTRKRMSAIFR-MPDG 717

Query: 927  TYWSFTKGAPEVIADICNPATIPKDFHELLH--HYTHNGFRIIACAGKTLPKSSWLYSQK 984
            +   F KGA  VI +  +    P     L H   Y   G R +  A +T+P+  +    K
Sbjct: 718  SIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSK 777

Query: 985  V-----------------SREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMC 1027
            +                 + E +E +L FLG    E+KL+      +  LQ A ++  + 
Sbjct: 778  IYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVL 837

Query: 1028 TGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLN 1087
            TGD   TA+++G    L+S +   +    +  E++R  L         S L+A+    ++
Sbjct: 838  TGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQ--------SKLNAIESHQIS 889

Query: 1088 DPEKSYTLAITGDIFRILFRNDEILPDDYIST-VLMKGSIYARMSPDEKHELVEQLQKLD 1146
              + + +LA+  D   + +  +E L D +++   L K  I  R+SP +K  +V+ +++  
Sbjct: 890  QQDMN-SLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKT 948

Query: 1147 YNVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCVLDVIKEG--- 1199
             ++    GDGAND   ++AA++G+ +S  E   A+ +A F    F     L ++      
Sbjct: 949  SSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSY 1008

Query: 1200 -RASLVTSFSCFQYMSLY 1216
             R SL   +S ++ M+LY
Sbjct: 1009 QRISLAILYSFYKNMALY 1026

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 7/108 (6%)

Query: 502 YYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDL 561
           Y   G + ++ ++S +   +E  K S    +++H  C+V   +   + +    D+  GD+
Sbjct: 252 YTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDI 311

Query: 562 FEISDPSLVVLPCDAVLIS-----GDCIVNESMLTGESVPVSKYAATE 604
             +   S   +P D +++S     G C +  + L GE+    K A  E
Sbjct: 312 IRVR--SEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQE 357

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 134/314 (42%), Gaps = 62/314 (19%)

Query: 907  FEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADIC--------NPATIPKD-----FH 953
            F F S ++RMS + +     TY  +TKGA E + + C        N AT+  D       
Sbjct: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIK 589

Query: 954  ELLHHYTHNGFRIIACAGKTLPKSSWLYS--QKV--SREEVEDNLEFLGFIVFENKLKSR 1009
            E +   +  G R++A A K+ PKS       QK+   R+  E  L FLG I   +  +  
Sbjct: 590  ENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREE 649

Query: 1010 TKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWR 1069
            T  A+K+   A I   M TGD   TA ++ ++ G++ +          NL    +  S  
Sbjct: 650  TAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPT----------NL----YHYSKE 695

Query: 1070 DVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYAR 1129
             VD                      + +TG  F       + L +D I  + +   + AR
Sbjct: 696  VVD---------------------IMVMTGKQF-------DNLSEDEIDNLPVLPLVIAR 727

Query: 1130 MSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF-- 1187
             SP  K  ++E L + +      GDG ND  +LK AN+GI++    + VA   +  V   
Sbjct: 728  CSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSD 787

Query: 1188 -DISCVLDVIKEGR 1200
             + + +L+ ++EGR
Sbjct: 788  DNFASILNAVEEGR 801

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 80/360 (22%), Positives = 155/360 (43%), Gaps = 53/360 (14%)

Query: 448 GLTSSIQEDRTLAFGKNSVNLKQKT-VTEILFDEALHPFYVFQIFSIILWLADDYYYYAG 506
           G++    + R    G+NS+    K     +L  +  +   +  I S+I+  A   +   G
Sbjct: 32  GISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAMILVLIISMIISFAIRDWITGG 91

Query: 507 CIFLISVLSIIDTVIETKKNSEKLADISHFNC-EVRVYKDRFWTQVNSSDLVPGDLF--E 563
            I  +  +++I  +I+  K S+ +  +   +     V ++     V+S+D+VPGDL   +
Sbjct: 92  VICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDSTDVVPGDLVVVK 151

Query: 564 ISDPSLVVLPCDAVLISGDCI-VNESMLTGESVPVSKYAATEATMAQLLQDXXXXXXXXX 622
           + D     +P D  L+S      +E++LTGES+PVSK A       ++  D         
Sbjct: 152 VGD----TIPADLRLVSQQNFETDEALLTGESLPVSKDA------NEIFDDETPVGDRIN 201

Query: 623 XXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSM-----VFPKPVGFKFY 677
                 F+ + +++ R    QG+A    I+TG +T  G + +S+     +  +     +Y
Sbjct: 202 LA----FSSSTVVKGR---AQGIA----IKTGLNTEIGKIAKSLRGGNELISRDPAKTWY 250

Query: 678 EDSF--------KYIGF---------MTLIAMFGFSISCIQFIRLGLEYKVMILRALDII 720
           ++++         ++G          ++ +A+  F I+ +  I +    K  + R + I 
Sbjct: 251 QNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIY 310

Query: 721 TIVV-----PPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTE 775
            + V     P +L   LTI  S     +  + +       +   G V+ +C DKTGTLT+
Sbjct: 311 AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQ 370

>Kwal_26.7070
          Length = 1315

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 124/486 (25%), Positives = 200/486 (41%), Gaps = 104/486 (21%)

Query: 760  GKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLIT-DCDEV------LQKHT 812
            G+++ +  DKTGTLT   ++      A      TI +     T D  E+        K T
Sbjct: 551  GQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIGFRKFDSMKET 610

Query: 813  LSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYESWKFKN 872
            L+D    +     +FL  L TCH++               + EF     E+G  S K++ 
Sbjct: 611  LNDTQDPDSHIINDFLTLLATCHTV---------------IPEFQ----EDG--SIKYQA 649

Query: 873  AEDKTGISPAVVHPTSNCN--FIENDPDNLIGVIRSF------------EFLSELRRMSV 918
            A    G   A+V   ++    FI   P+++  +I               EF S  +RMS 
Sbjct: 650  ASPDEG---ALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSA 706

Query: 919  IVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLH--HYTHNGFRIIACAGKTLPK 976
            I +         F KGA  VI +       P     L H   Y   G R +  A +T+ +
Sbjct: 707  IFR-LPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTE 765

Query: 977  SSW-----LY----------SQKV--SREEVEDNLEFLGFIVFENKLKSRTKAALKELQN 1019
            S +     +Y          +QK+  + E +E +L  LG    E+KL+      +  LQ+
Sbjct: 766  SEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQD 825

Query: 1020 ANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESR------------HLLS 1067
            A I+  + TGD   TAV++G    L+S +   +    ++ E +R            H +S
Sbjct: 826  AGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQIS 885

Query: 1068 WRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTV--LMKGS 1125
             +D++    V+D           KS   A+  D+            +DY+  +  L K  
Sbjct: 886  QQDMNSLALVIDG----------KSLGFALEADL------------EDYLLAIGKLCKAV 923

Query: 1126 IYARMSPDEKHELVEQLQ-KLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTS 1184
            I  R+SP +K  +V+ ++ K D  +   GDGAND   ++AA++G+ +S  E   AA   S
Sbjct: 924  ICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA--RS 981

Query: 1185 AVFDIS 1190
            A F I+
Sbjct: 982  ADFAIA 987

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 132/307 (42%), Gaps = 57/307 (18%)

Query: 908  EFLSELRRMSVIVKGFKENTYWSFTKGAPEVI----ADICNPATIPKDFHELLHHYTHNG 963
            EF S  +RMS I + F +N+     KGA  VI    A   NP       H  L  Y   G
Sbjct: 693  EFNSTRKRMSAIFR-FPDNSIRLLCKGADTVILERLAATSNPYVAATLRH--LEDYAAEG 749

Query: 964  FRIIACAGKTLPKSSW-----LY----------SQKVSR--EEVEDNLEFLGFIVFENKL 1006
             R +  A +T+P+S +     LY          S+++ +  E +E  L  LG    E+KL
Sbjct: 750  LRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKL 809

Query: 1007 KSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESR--- 1063
            +      +  LQ A I+  + TGD   TA+++G    L+S +   +    D  E +R   
Sbjct: 810  QDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNL 869

Query: 1064 ---------HLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPD 1114
                     H +S +D++    V+D  +L    +P+    L   G + R +         
Sbjct: 870  IDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAV--------- 920

Query: 1115 DYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFC-GDGANDCGALKAANIGISLSE 1173
                       I  R+SP +K  +V+ +++   ++    GDGAND   ++AA++G+ +S 
Sbjct: 921  -----------ICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISG 969

Query: 1174 AEASVAA 1180
             E   AA
Sbjct: 970  MEGMQAA 976

>Scas_499.3
          Length = 346

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 82/146 (56%), Gaps = 14/146 (9%)

Query: 461 FGKNSVNLKQKTVTEILFDEALHPFYVFQIFSIILWLADDYYYYAGCIFLISVLSIIDTV 520
           +G+N+ ++   T  E+  + A+ P +VFQ+F + LWL D+++YY+    L +++ I+   
Sbjct: 177 YGENAFDIPVPTFMELFKEHAVAPLFVFQLFCVALWLLDEFWYYS----LFNLMMIVS-- 230

Query: 521 IETKKNSEKLADISHFNC------EVRVYKDRFWTQVNSSDLVPGDLFEISDPS-LVVLP 573
           +E     ++L  +  F         + V ++  W  + +++L+  D+  ++  +    +P
Sbjct: 231 MEGAAVFQRLQSLKEFRTMGIKPFAINVLRNEHWVTLQTNELLTMDVVSLTTTTEESAIP 290

Query: 574 CDAVLISGDCIVNESMLTGESVPVSK 599
           CD +LI G CIVNE+M +GES P+ K
Sbjct: 291 CDMILIDGACIVNEAM-SGESTPLLK 315

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 108/458 (23%), Positives = 195/458 (42%), Gaps = 68/458 (14%)

Query: 760  GKVDMMCFDKTGTLTEEGLD-----VLGIHFAK--PEGSSTILQ--LSDLITDCDEVLQK 810
            G+++ +  DKTGTLT   ++     + G  +A+  PE  +   +  +       D++ ++
Sbjct: 535  GQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRSFDDLKKQ 594

Query: 811  HTLS--DCNSAEEFKAKNFLVSLLTCHSLK---HIDGELLGDPLDLKMFEFTKWAYEEGY 865
             T +  DC   +EF     L  L TCH++      DG +          ++   + +EG 
Sbjct: 595  LTTNSDDCKIIDEF-----LTLLATCHTVIPEFQADGSI----------KYQAASPDEG- 638

Query: 866  ESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKE 925
                        G    +  P S    I  + +    ++   EF S  +RMS I + F +
Sbjct: 639  ---ALVEGGALLGYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFR-FPD 694

Query: 926  NTYWSFTKGAPEVI----ADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSW-L 980
            ++     KGA  VI    ++  N        H  L  Y   G R +  A K +P+  +  
Sbjct: 695  DSIKLLCKGADSVILERLSETGNFYVDATTRH--LEDYATEGLRTLCLATKDIPEDEYNA 752

Query: 981  YSQK----------------VSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRT 1024
            +++K                   EE+E  L  +G    E+KL+      ++ LQ A I+ 
Sbjct: 753  WNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKI 812

Query: 1025 VMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLK 1084
             + TGD   TA+++G    L+S +   +    +  E +R     R+++E+ + L   +L 
Sbjct: 813  WVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATR-----RNMEEKLAALHEHSLS 867

Query: 1085 PLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLM-KGSIYARMSPDEKHELVEQLQ 1143
                     TLA+  D   + F  +  L D +++   M K  I  R+SP +K  +V+ ++
Sbjct: 868  ----EHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVK 923

Query: 1144 KLDYNVGFC-GDGANDCGALKAANIGISLSEAEASVAA 1180
            +   ++    GDGAND   ++AA++G+ +S  E   AA
Sbjct: 924  RKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 961

>Scas_297.1
          Length = 800

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 117/278 (42%), Gaps = 61/278 (21%)

Query: 1029 GDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLND 1088
            GDN+LTA ++ R+  ++S E   IP                                   
Sbjct: 1    GDNILTARAIARNCNILSEETYLIP----------------------------------- 25

Query: 1089 PEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYN 1148
                   AI G  FR L + + I        +L    + AR SP++K  LVE L+ +   
Sbjct: 26   -----ECAIEGPKFRTLTKQERI-------KMLPNLRVMARSSPEDKRLLVETLKGMGDV 73

Query: 1149 VGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGRASLVT 1205
            V   GDG ND  ALK A++G S+  +   VA   +  +    D + ++D IK GR   ++
Sbjct: 74   VAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKWGRCVSIS 133

Query: 1206 --SFSCFQYMSLYSAI--QFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNS 1261
               F  FQ +   +A+   F++        S L   Q L+I+L++    A++++  KP+ 
Sbjct: 134  IKKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMDTLAALALATDKPDP 193

Query: 1262 KLVKKRP---SANLVSPK----ILVPLCLNITLILIFQ 1292
             ++ ++P   S  L+ P     IL   CL + +  I  
Sbjct: 194  NIMDRKPRGRSTPLIFPSTWKMILSQSCLQLIVTFILH 231

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 555 DLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEA 605
           +L+ GD+  +      V+P D VL+ G C V+ES +TGES  + K     A
Sbjct: 615 NLLVGDIITLQTGD--VIPADGVLVEGQCEVDESSITGESDTIKKVKVFNA 663

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 132/311 (42%), Gaps = 55/311 (17%)

Query: 998  GFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLND 1057
            G +   + L+   K ++K  Q + +   M TGDN+ T  ++ R  G++S           
Sbjct: 708  GVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILS----------- 756

Query: 1058 NLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYI 1117
               ES +       D E                     A+ G +FR L R         +
Sbjct: 757  ---ESEY------ADHE--------------------CAMEGPVFRKLSRRQ-------M 780

Query: 1118 STVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEAS 1177
                 K  + AR SP++K   V+ L+K++  V   GDG ND  AL  A++G S+  +   
Sbjct: 781  MDAAPKLKVLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTG 840

Query: 1178 VAAPFTSAVF---DISCVLDVIKEGRA-SL-VTSFSCFQYMSLYSAIQFITITILYSRGS 1232
            VA   +  +    D + +++ IK GR  SL +  F  FQ     +A+    +T + S   
Sbjct: 841  VAREASDIILMTDDFTSIVNAIKWGRCVSLSIKKFIQFQLTVNITAVTLTCVTAVTSTEE 900

Query: 1233 N--LGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLNITLILI 1290
            N  L   Q L+++L++    A++++  KP+  ++++ P+    SP I V     I    +
Sbjct: 901  NPVLTAVQLLWVNLIMDTLAALALATDKPDPHILERIPTGR-DSPLIAVSTWKMILGQAV 959

Query: 1291 FQLLPWIAVQY 1301
             QL+    + Y
Sbjct: 960  LQLIIAFVLHY 970

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 121/315 (38%), Gaps = 54/315 (17%)

Query: 537 NCEVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVP 596
           + EV V ++     ++  DL+ GDL  +    +V  P D +L+ G C  +ES +TGES  
Sbjct: 182 DTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVV--PVDCILVEGKCECDESGITGESDT 239

Query: 597 VSKYAATEATMAQLLQDXXXXXXXXXXXXX-------------XLFNGTKIIRVRNQPGQ 643
           + K      ++A  LQ                            L +G+K++        
Sbjct: 240 IKK-----VSLAMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLL-------S 287

Query: 644 GMALALVIRTGFSTTKGSLVRSM-----VFPKPVGFKFYEDSFKYIG----FMTLIAMFG 694
           G+  A+V   G  +  G ++ ++       P         D     G    F+  + +F 
Sbjct: 288 GIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLFL 347

Query: 695 FSISCIQFIRL---------GLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKK 745
             +S +   RL         G  +  + + A+ +I + VP  LP  +T+  +FA  R+ K
Sbjct: 348 RFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTK 407

Query: 746 KGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVL-----GIHFAKPEGSSTILQLSDL 800
            G            G    +C DKTGTLT+  + V+       HF      S   Q   L
Sbjct: 408 DGNLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFDDISEDSNCAQSDAL 467

Query: 801 ITDCDEVLQKHTLSD 815
             D    + +HTL+D
Sbjct: 468 RQD----MSQHTLND 478

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 101/417 (24%), Positives = 176/417 (42%), Gaps = 68/417 (16%)

Query: 813  LSDCNSAEEFKA-KNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYESWKFK 871
            L   NS E+ +A ++F++SL  CHS+   + +   + LD+K     + A  E      F 
Sbjct: 762  LGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGF- 820

Query: 872  NAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSF------EFLSELRRMSVIVK--GF 923
                      + V  T N   IE     + GV + F      EF S  +RMS IVK    
Sbjct: 821  ----------SFVGRTKNGVIIE-----IQGVQKEFRILNVLEFNSTRKRMSCIVKIPAA 865

Query: 924  KENTYWS---FTKGAPEVI-ADICNPATIPKDFHEL---LHHYTHNGFRIIACAGKTLPK 976
             EN+        KGA  VI + +      PK        L  +   G R +  A + +  
Sbjct: 866  DENSKPKALLLCKGADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDW 925

Query: 977  SSWL-YSQKV--------SREE--------VEDNLEFLGFIVFENKLKSRTKAALKELQN 1019
              +L ++++         +REE        +E  L  LG    E++L+     ++  L +
Sbjct: 926  DEYLNWNERRELAAASLDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILAD 985

Query: 1020 ANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLD 1079
            A I+  + TGD V TA+++G    L+ S+   +  +  + E+  H L  +D D   +++D
Sbjct: 986  AGIKLWVLTGDKVETAINIGFSCNLLGSDMELL-VIKSSGEDVEH-LGEKDSDVVLALID 1043

Query: 1080 ----------------AVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMK 1123
                            A   K    P+ ++ + I GD  ++    ++I     +     K
Sbjct: 1044 KYLETHFNMKGSPEELAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCK 1103

Query: 1124 GSIYARMSPDEKHELVEQLQK-LDYNVGFCGDGANDCGALKAANIGISLSEAEASVA 1179
              +  R+SP +K  +V+ +++ LD      GDG+ND   ++AA++GI ++  E   A
Sbjct: 1104 AVLCCRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQA 1160

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 132/321 (41%), Gaps = 70/321 (21%)

Query: 904  IRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNP-----------------A 946
            I  F F S ++RMS +       TY  + KGA E I   C+                   
Sbjct: 532  IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVE 591

Query: 947  TIPKDFHELLHHYTHNGFRIIACAGKTLPKSS----WLYSQKVSREEVEDNLEFLGFIVF 1002
            TI K+ + L    ++ G R++  A K+  K       L +   +R   E +L FLG I  
Sbjct: 592  TIRKNVYSL----SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGI 647

Query: 1003 ENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEES 1062
             +  ++ T  A+K+   A I   M TGD V TA ++ ++ G++ +          NL   
Sbjct: 648  YDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT----------NL--- 694

Query: 1063 RHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLM 1122
             +  S   VD                     ++ +TG  F       + L ++ +  + +
Sbjct: 695  -YHYSQEIVD---------------------SMVMTGSQF-------DGLSEEEVDDLPV 725

Query: 1123 KGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPF 1182
               + AR SP  K  ++E L +        GDG ND  +LK AN+GI++    + V+   
Sbjct: 726  LPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEA 785

Query: 1183 TSAVF---DISCVLDVIKEGR 1200
            +  V    + + +L+ ++EGR
Sbjct: 786  SDIVLSDDNFASILNAVEEGR 806

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/379 (22%), Positives = 154/379 (40%), Gaps = 75/379 (19%)

Query: 443 EVVQHGLTSSIQEDRTL----AFGKNSVNLKQKT-VTEILFDEALHPFYVFQIFSIILWL 497
           E +   LT  + +D +L    A G+N++    K     ++  +  +   +  + S+ +  
Sbjct: 27  EFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISF 86

Query: 498 ADDYYYYAGCI-FLISVLSIIDTVIETK--KNSEKLADISHFNCEVRVYKDRFWTQVNSS 554
           A   +   G I F+I+V  +I  V E K  K    L ++S  N    V ++     +NS 
Sbjct: 87  AVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNA--HVIRNGKSETINSK 144

Query: 555 DLVPGD--LFEISDPSLVVLPCDAVLI-SGDCIVNESMLTGESVPVSKYA------ATEA 605
           D+VPGD  L ++ D     +P D  LI + +   +ES+LTGES+PVSK A        E 
Sbjct: 145 DVVPGDICLVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET 200

Query: 606 TMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRS 665
           ++   L                 F+ + +++       G A  +VI+T  ++  G + +S
Sbjct: 201 SVGDRLN--------------LAFSSSAVVK-------GRAKGIVIKTALNSEIGKIAKS 239

Query: 666 M-----------------------------VFPKPVGFKFYEDSFKYIGFMTLIAMFGFS 696
           +                                  VG   +    K    +  IA+  F+
Sbjct: 240 LQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FA 298

Query: 697 ISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRV 756
           I  +   +  ++ +V I  A+ +   ++P +L   LTI  S     +  + +       +
Sbjct: 299 IIVMASQKFDVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSL 357

Query: 757 NVGGKVDMMCFDKTGTLTE 775
              G V+ +C DKTGTLT+
Sbjct: 358 EALGAVNDICSDKTGTLTQ 376

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 132/321 (41%), Gaps = 70/321 (21%)

Query: 904  IRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNP-----------------A 946
            I  F F S ++RMS +       TY  + KGA E I   C+                   
Sbjct: 532  IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVE 591

Query: 947  TIPKDFHELLHHYTHNGFRIIACAGKTLPKSS----WLYSQKVSREEVEDNLEFLGFIVF 1002
            TI K+ + L    ++ G R++  A K+  K       L +   +R   E +L FLG I  
Sbjct: 592  TIRKNVYSL----SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGI 647

Query: 1003 ENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEES 1062
             +  ++ T  A+K+   A I   M TGD V TA ++ ++ G++ +          NL   
Sbjct: 648  YDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT----------NL--- 694

Query: 1063 RHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLM 1122
             +  S   VD                     ++ +TG  F       + L ++ +  + +
Sbjct: 695  -YHYSQEIVD---------------------SMVMTGSQF-------DGLSEEEVDDLPV 725

Query: 1123 KGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPF 1182
               + AR SP  K  ++E L +        GDG ND  +LK AN+GI++    + V+   
Sbjct: 726  LPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEA 785

Query: 1183 TSAVF---DISCVLDVIKEGR 1200
            +  V    + + +L+ ++EGR
Sbjct: 786  SDIVLSDDNFASILNAVEEGR 806

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/379 (22%), Positives = 154/379 (40%), Gaps = 75/379 (19%)

Query: 443 EVVQHGLTSSIQEDRTL----AFGKNSVNLKQKT-VTEILFDEALHPFYVFQIFSIILWL 497
           E +   LT  + +D +L    A G+N++    K     ++  +  +   +  + S+ +  
Sbjct: 27  EFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISF 86

Query: 498 ADDYYYYAGCI-FLISVLSIIDTVIETK--KNSEKLADISHFNCEVRVYKDRFWTQVNSS 554
           A   +   G I F+I+V  +I  V E K  K    L ++S  N    V ++     +NS 
Sbjct: 87  AVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNA--HVIRNGKSETINSK 144

Query: 555 DLVPGD--LFEISDPSLVVLPCDAVLI-SGDCIVNESMLTGESVPVSKYA------ATEA 605
           D+VPGD  L ++ D     +P D  LI + +   +ES+LTGES+PVSK A        E 
Sbjct: 145 DVVPGDICLVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET 200

Query: 606 TMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRS 665
           ++   L                 F+ + +++       G A  +VI+T  ++  G + +S
Sbjct: 201 SVGDRLN--------------LAFSSSAVVK-------GRAKGIVIKTALNSEIGKIAKS 239

Query: 666 M-----------------------------VFPKPVGFKFYEDSFKYIGFMTLIAMFGFS 696
           +                                  VG   +    K    +  IA+  F+
Sbjct: 240 LQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FA 298

Query: 697 ISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRV 756
           I  +   +  ++ +V I  A+ +   ++P +L   LTI  S     +  + +       +
Sbjct: 299 IIVMASQKFDVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSL 357

Query: 757 NVGGKVDMMCFDKTGTLTE 775
              G V+ +C DKTGTLT+
Sbjct: 358 EALGAVNDICSDKTGTLTQ 376

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 132/321 (41%), Gaps = 70/321 (21%)

Query: 904  IRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNP-----------------A 946
            I  F F S ++RMS +       TY  + KGA E I   C+                   
Sbjct: 532  IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVE 591

Query: 947  TIPKDFHELLHHYTHNGFRIIACAGKTLPKSS----WLYSQKVSREEVEDNLEFLGFIVF 1002
            TI K+ + L    ++ G R++  A K+  K       L +   +R   E +L FLG I  
Sbjct: 592  TIRKNVYSL----SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGI 647

Query: 1003 ENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEES 1062
             +  ++ T  A+K+   A I   M TGD V TA ++ ++ G++ +          NL   
Sbjct: 648  YDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT----------NL--- 694

Query: 1063 RHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLM 1122
             +  S   VD                     ++ +TG  F       + L ++ +  + +
Sbjct: 695  -YHYSQEIVD---------------------SMVMTGSQF-------DGLSEEEVDDLPV 725

Query: 1123 KGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPF 1182
               + AR SP  K  ++E L +        GDG ND  +LK AN+GI++    + V+   
Sbjct: 726  LPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEA 785

Query: 1183 TSAVF---DISCVLDVIKEGR 1200
            +  V    + + +L+ ++EGR
Sbjct: 786  SDIVLSDDNFASILNAVEEGR 806

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 86/379 (22%), Positives = 153/379 (40%), Gaps = 75/379 (19%)

Query: 443 EVVQHGLTSSIQED----RTLAFGKNSVNLKQKT-VTEILFDEALHPFYVFQIFSIILWL 497
           E +   LT  + +D    R    G+N++    K     ++  +  +   +  + S+I+  
Sbjct: 27  EFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISF 86

Query: 498 ADDYYYYAGCI-FLISVLSIIDTVIETK--KNSEKLADISHFNCEVRVYKDRFWTQVNSS 554
           A   +   G I F+I+V  +I  V E K  K    L ++S  N    V ++     +NS 
Sbjct: 87  AMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNA--HVIRNGKSETINSK 144

Query: 555 DLVPGD--LFEISDPSLVVLPCDAVLI-SGDCIVNESMLTGESVPVSKYA------ATEA 605
           D+VPGD  L ++ D     +P D  LI + +   +ES+LTGES+PVSK A        E 
Sbjct: 145 DVVPGDICLVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET 200

Query: 606 TMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRS 665
           ++   L                 F+ + +++       G A  +VI+T  ++  G + +S
Sbjct: 201 SVGDRLN--------------LAFSSSAVVK-------GRAKGIVIKTALNSEIGKIAKS 239

Query: 666 M-----------------------------VFPKPVGFKFYEDSFKYIGFMTLIAMFGFS 696
           +                                  VG   +    K    +  IA+  F+
Sbjct: 240 LQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FA 298

Query: 697 ISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRV 756
           I  +   +  ++ +V I  A+ +   ++P +L   LTI  S     +  + +       +
Sbjct: 299 IIVMASQKFDVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSL 357

Query: 757 NVGGKVDMMCFDKTGTLTE 775
              G V+ +C DKTGTLT+
Sbjct: 358 EALGAVNDICSDKTGTLTQ 376

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/328 (24%), Positives = 136/328 (41%), Gaps = 61/328 (18%)

Query: 903  VIRSFEFLSELRRMSVIVK-----GFKENTYWSFTKGAPEVIAD----ICNPATIPKDFH 953
            V+   EF S  +RMS I+K        E       KGA  VI        N AT+ +   
Sbjct: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940

Query: 954  ELLHHYTHNGFRIIACAGKTLPKSS---WLYSQKVS------REE--------VEDNLEF 996
              L  Y   G R +  A + L  S    W+ +  V+      REE        +E  L  
Sbjct: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000

Query: 997  LGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLN 1056
            LG    E++L+     ++  L  A I+  + TGD V TA+++G    +          LN
Sbjct: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNV----------LN 1050

Query: 1057 DNLEESRHLLSWRDVDEEGS----VLDAVTLKPLND--------------------PEKS 1092
            +++E      S  DV+E GS    V++ +  K L +                    P+ +
Sbjct: 1051 NDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGN 1110

Query: 1093 YTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-LDYNVGF 1151
            + + I GD  ++    +E+     +     K  +  R+SP +K  +V+ ++K LD     
Sbjct: 1111 FAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLA 1170

Query: 1152 CGDGANDCGALKAANIGISLSEAEASVA 1179
             GDG+ND   +++A++G+ ++  E   A
Sbjct: 1171 IGDGSNDVAMIQSADVGVGIAGEEGRQA 1198

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/330 (24%), Positives = 133/330 (40%), Gaps = 66/330 (20%)

Query: 903  VIRSFEFLSELRRMSVIVKGFKENTYWS-----FTKGAPEVIADICNPATIPKDFHEL-- 955
            ++   EF S  +RMS I+K   EN           KGA  +I    +     K   +   
Sbjct: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTAL 940

Query: 956  -LHHYTHNGFRIIACAGKTLPKSSWLYSQK------------VSREE--------VEDNL 994
             L  Y   G R +  A + L   SW   Q+            V RE+        +E  L
Sbjct: 941  HLEQYATEGLRTLCIAQREL---SWKEYQEWNEKHEIAAAALVDREDEMEKVADVIEREL 997

Query: 995  EFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPF 1054
              LG    E++L+     ++  L  A I+  + TGD V TA+++G    L          
Sbjct: 998  TLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNL---------- 1047

Query: 1055 LNDNLEESRHLLSWRDVDEEGS----VLDAVTLKPLND--------------------PE 1090
            LN+ +E      S  DVD  GS    ++  + LK L +                    P 
Sbjct: 1048 LNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPT 1107

Query: 1091 KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-LDYNV 1149
             ++ + I GD  ++  RND++  +  +     K  +  R+SP +K  +V+ ++  LD   
Sbjct: 1108 GNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMT 1167

Query: 1150 GFCGDGANDCGALKAANIGISLSEAEASVA 1179
               GDG+ND   +++A+IG+ ++  E   A
Sbjct: 1168 LAIGDGSNDVAMIQSADIGVGIAGEEGRQA 1197

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 134/303 (44%), Gaps = 49/303 (16%)

Query: 908  EFLSELRRMSVIVKGFKENTYWSFTKGAPEVIA----DICNPATIPKDFHELLHHYTHNG 963
            EF S  +RMS I + F + +   F KGA  VI     D  N        H  L  Y   G
Sbjct: 697  EFNSTRKRMSAIFR-FPDGSIKLFCKGADTVILERLDDEANQYVEATMRH--LEDYASEG 753

Query: 964  FRIIACAGKTLPKSSW-----LYSQKVS----REE--------VEDNLEFLGFIVFENKL 1006
             R +  A + + +  +     +Y++  +    R E        +E NL  +G    E+KL
Sbjct: 754  LRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKL 813

Query: 1007 KSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLL 1066
            +      +  LQ A I+  + TGD   TA+++G    L+ SE + +  +N   EE+R   
Sbjct: 814  QDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLL-SEDMNLLIIN---EETRD-- 867

Query: 1067 SWRDVDEEGSVLDAVTLKPLNDPE------KSYTLAITGDIFRILFRNDEILPDDYISTV 1120
                 D E ++L+ +    LN+ +      KS  L I G          E   +DY+ TV
Sbjct: 868  -----DTERNLLEKIN--ALNEHQLSTHDMKSLALVIDGKSLGFAL---EPELEDYLLTV 917

Query: 1121 --LMKGSIYARMSPDEKHELVEQLQKLDYNVGFC-GDGANDCGALKAANIGISLSEAEAS 1177
              L K  I  R+SP +K  +V+ +++   ++      GAND   ++AA++G+ +S  E  
Sbjct: 918  AKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGM 977

Query: 1178 VAA 1180
             AA
Sbjct: 978  QAA 980

>Scas_576.8
          Length = 1591

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 133/321 (41%), Gaps = 45/321 (14%)

Query: 903  VIRSFEFLSELRRMSVIVKGFKEN-----TYWSFTKGAPEVI------ADICNPATIPKD 951
            ++ + EF S  +RMS IVK    N           KGA  +I       +  N   + + 
Sbjct: 852  ILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGTKNGANSENLLEK 911

Query: 952  FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK---------VSREE--------VEDNL 994
                L  Y   G R +  A + L    +L   K          +REE        +E  L
Sbjct: 912  TALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSDEIEREL 971

Query: 995  EFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFI-- 1052
              LG    E++L+     ++  L  A I+  + TGD V TA+++G    L++++   +  
Sbjct: 972  TLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVV 1031

Query: 1053 --------PFLNDNLEESRHLLSWRDVDEE----GSVLDAVTLKPLND-PEKSYTLAITG 1099
                     F ND  E +  L++ + + E+    GS ++    K  +D P   + + I G
Sbjct: 1032 KTNGDDVQEFGNDPAEIAESLIT-KYLREKFGLTGSEMELADAKKNHDFPRGDFAVVIDG 1090

Query: 1100 DIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVE-QLQKLDYNVGFCGDGAND 1158
            +  ++    + I     +     K  +  R+SP +K  +V+  +  LD      GDG+ND
Sbjct: 1091 EALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVMTLAIGDGSND 1150

Query: 1159 CGALKAANIGISLSEAEASVA 1179
               +++A++G+ ++  E   A
Sbjct: 1151 VAMIQSADVGVGIAGEEGRQA 1171

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 137/322 (42%), Gaps = 47/322 (14%)

Query: 903  VIRSFEFLSELRRMSVIVK--GFK---ENTYWSFTKGAPEVI------ADICNPATIPKD 951
            ++   EF S  +RMS IVK  G     E       KGA  +I          N   I + 
Sbjct: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEK 895

Query: 952  FHELLHHYTHNGFRIIACAGKTLPKSSW-------------LYSQKVSREEVEDNLE--- 995
                L  Y   G R +  A + L  S +             L +++   E V D++E   
Sbjct: 896  TALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIEREL 955

Query: 996  -FLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSER--VFI 1052
              LG    E++L+      ++ L  A I+  + TGD V TA+++G    L+++E   + I
Sbjct: 956  ILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVI 1015

Query: 1053 PFLNDNLEE-------------SRHLLSWRDV-DEEGSVLDAVTLKPLNDPEKSYTLAIT 1098
                D+++E             S++L  + ++   E  + +A   K    P+ +Y + I 
Sbjct: 1016 KTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAK--KDHEFPKGNYAIVID 1073

Query: 1099 GDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQ-KLDYNVGFCGDGAN 1157
            GD  ++    ++I     +     +  +  R+SP +K  +V+ ++  LD      GDG+N
Sbjct: 1074 GDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSN 1133

Query: 1158 DCGALKAANIGISLSEAEASVA 1179
            D   +++A++GI ++  E   A
Sbjct: 1134 DVAMIQSADVGIGIAGEEGRQA 1155

>Scas_89.1
          Length = 271

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 106/212 (50%), Gaps = 33/212 (15%)

Query: 985  VSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGL 1044
            V ++ +E NLE LG    E+KL++  K++++ L+NA ++  M TGD V TA  V   + L
Sbjct: 26   VIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 85

Query: 1045 ISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGD---I 1101
            IS  +    +++   + SR          EG+ L+A+    +N   KS  L I G+   +
Sbjct: 86   ISRGQ----YVHTVTKLSR---------PEGA-LNALEYLKIN---KSSCLLIDGESLGM 128

Query: 1102 FRILFRND--EILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFC-GDGAND 1158
            F   ++ +  +I+ D       +   I  R +P +K ++   ++++      C GDG ND
Sbjct: 129  FLTYYKQEFFDIVVD-------LPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGND 181

Query: 1159 CGALKAANIGISLSEAE---ASVAAPFTSAVF 1187
               ++ A++G+ +   E   AS+AA F+   F
Sbjct: 182  VSMIQCADVGVGIVGKEGKQASLAADFSVTQF 213

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 113/250 (45%), Gaps = 26/250 (10%)

Query: 989  EVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLIS-- 1046
            E+ED L  LG    E+KL+     A+++++ A I+  M TGD   TA+++G    LI   
Sbjct: 1075 EIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDY 1134

Query: 1047 SERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILF 1106
            S  V +   ++N+    + +S ++VD  G++   V             + I G     +F
Sbjct: 1135 STVVILTTTDENIISKMNAVS-QEVD-SGNIAHCV-------------VVIDGATM-AMF 1178

Query: 1107 RNDEILPDDYISTVLMKGS-IYARMSPDEKHELVEQLQKLDYNVG--FCGDGANDCGALK 1163
              +      ++       S I  R SP +K  +V  ++  D N+     GDGAND   ++
Sbjct: 1179 EGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQ 1238

Query: 1164 AANIGISLSEAE---ASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQ 1220
            +A+IG+ ++  E   AS  + ++   F     L +   GR + + + S F   + Y  I 
Sbjct: 1239 SADIGVGIAGKEGLQASRVSDYSIGQFRFLLKL-LFVHGRYNYIRT-SKFMLCTFYKEIT 1296

Query: 1221 FITITILYSR 1230
            F    ++Y R
Sbjct: 1297 FYFTQLIYQR 1306

>Scas_636.16
          Length = 1554

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 134/324 (41%), Gaps = 51/324 (15%)

Query: 903  VIRSFEFLSELRRMSVIVK-----GFKENTYWSFTKGAPEVIADIC------NPATIPKD 951
            ++   EF S  +RMS IVK        E       KGA  VI          N  T+ + 
Sbjct: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874

Query: 952  FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK------------VSREE--------VE 991
                L  Y   G R + C G+   + SW   Q+              REE        +E
Sbjct: 875  TALHLEQYATEGLRTL-CVGQR--EISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931

Query: 992  DNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS--ER 1049
             +L  LG    E++L+     ++  L  A I+  + TGD V TA+++G    L+++  E 
Sbjct: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMEL 991

Query: 1050 VFIPFLNDNLEE-------------SRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLA 1096
            + I    ++++E             S++L+   ++      L A   K  + P+  + + 
Sbjct: 992  LVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEEL-AAAKKDHSPPQGEFAII 1050

Query: 1097 ITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-LDYNVGFCGDG 1155
            I G+  +I    D +     +     K  +  R+SP +K  +V+ ++  LD      GDG
Sbjct: 1051 IDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDG 1110

Query: 1156 ANDCGALKAANIGISLSEAEASVA 1179
            +ND   +++A++G+ ++  E   A
Sbjct: 1111 SNDVAMIQSADVGVGIAGEEGRQA 1134

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 106/246 (43%), Gaps = 44/246 (17%)

Query: 542 VYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCI--VNESMLTGESVPVSK 599
           V +D    ++ ++++VPGD+ ++ D +  V+P D  +++ DC   +++S +TGES+ V K
Sbjct: 182 VIRDGQLVEIPANEVVPGDILQLEDGT--VIPTDGRIVTEDCFLQIDQSAITGESLAVDK 239

Query: 600 YAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTK 659
           +   +                        F+ + + R       G    +V  TG +T  
Sbjct: 240 HYGDQT-----------------------FSSSTVKR-------GEGFMVVTATGDNTFV 269

Query: 660 GSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYK----VMILR 715
           G    ++V     G   + +    IG + L+      I+ +  +     Y+    V ILR
Sbjct: 270 GR-AAALVNKAAGGQGHFTEVLNGIGIILLV----LVIATLLLVWTACFYRTNGIVRILR 324

Query: 716 -ALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLT 774
             L I  I VP  LPA +T   +     L KK       + +     V+++C DKTGTLT
Sbjct: 325 YTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLT 384

Query: 775 EEGLDV 780
           +  L +
Sbjct: 385 KNKLSL 390

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 96/275 (34%), Gaps = 73/275 (26%)

Query: 933  KGAPE-VIADICNPATIPKDFHE----LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSR 987
            KGAP  V+  +     IP+D HE     +      GFR +                 V+R
Sbjct: 474  KGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG----------------VAR 517

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS 1047
            +  E + E LG +   +  +  T   + E ++  +R  M TGD V  A    R  G    
Sbjct: 518  KRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLG---- 573

Query: 1048 ERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFR 1107
                   L  N+  +  L      D  GS L                             
Sbjct: 574  -------LGTNIYNAERLGLGGGGDMPGSELA---------------------------- 598

Query: 1108 NDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANI 1167
                   D++         +A + P  K+ +VE LQ   Y V   GDG ND  +LK A+ 
Sbjct: 599  -------DFVE----NADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADT 647

Query: 1168 GISLSEA--EASVAAPFTSAVFDISCVLDVIKEGR 1200
            GI++  A   A  AA        +S ++D +K  R
Sbjct: 648  GIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 682

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 110/249 (44%), Gaps = 26/249 (10%)

Query: 990  VEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLI--SS 1047
            +E +LE LG    E+KL+     A+++++ A I+  M TGD   TA+++G    LI   S
Sbjct: 995  IETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYS 1054

Query: 1048 ERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFR 1107
              V +   +DNL      L        G  LD   +           L I G    + F 
Sbjct: 1055 TVVILKKNDDNLISKMTAL--------GEELDTGKIAHC-------VLVIDGASLAV-FE 1098

Query: 1108 NDEILPDDYISTVLMKGS-IYARMSPDEKHELVE--QLQKLDYNVGFCGDGANDCGALKA 1164
            N+  +   +I       S I  R SP +K  +V   +L+  D      GDGAND   +++
Sbjct: 1099 NNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQS 1158

Query: 1165 ANIGISLSEAE---ASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQF 1221
            A+IG+ ++  E   AS ++ ++ A F     L +   GR + V + S F   + Y  + F
Sbjct: 1159 ADIGVGITGKEGLQASRSSDYSIAQFRYLLKL-LFVHGRYNYVRT-SKFVLCTFYKEVLF 1216

Query: 1222 ITITILYSR 1230
                ++Y R
Sbjct: 1217 YLTQMIYQR 1225

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 116/250 (46%), Gaps = 26/250 (10%)

Query: 989  EVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLIS-- 1046
            ++ED L  LG    E+KL+     A+++++ A I+  M TGD   TA+++G    LI   
Sbjct: 1015 QIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDY 1074

Query: 1047 SERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILF 1106
            S  V +   ++N+    + +S ++VD  G+V   V             + I G     +F
Sbjct: 1075 STVVILTTSDENIISKMNAIS-QEVD-SGNVAHCV-------------IVIDGATL-AMF 1118

Query: 1107 RNDEILPDDYISTVLMKGSIY-ARMSPDEKHELVEQLQKLDYNVG--FCGDGANDCGALK 1163
             ++  L   +        S+   R SP +K  +V  ++  D ++     GDGAND   ++
Sbjct: 1119 EDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQ 1178

Query: 1164 AANIGISLSEAE---ASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAIQ 1220
            +A+IG+ ++  E   AS +A ++   F     L ++  GR + + + + F   + Y  + 
Sbjct: 1179 SADIGVGIAGKEGLQASRSADYSIGQFRFILKL-LLVHGRYNYIRT-AKFILCTFYKELT 1236

Query: 1221 FITITILYSR 1230
            F    ++Y R
Sbjct: 1237 FYLTQLIYQR 1246

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 132/330 (40%), Gaps = 63/330 (19%)

Query: 903  VIRSFEFLSELRRMSVIVK--GFKENT---YWSFTKGAPEVIADIC------NPATIPKD 951
            ++   EF S  +RMS I+K  G   N         KGA  VI          N  T+ + 
Sbjct: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891

Query: 952  FHELLHHYTHNGFRIIACAGKTLPKSSWL---------YSQKVSREE--------VEDNL 994
                L  Y   G R +  A + L  S +           +   +REE        +E +L
Sbjct: 892  TALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDL 951

Query: 995  EFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPF 1054
              LG    E++L+     ++  L  A I+  + TGD V TA+++G    L          
Sbjct: 952  ILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNL---------- 1001

Query: 1055 LNDNLEESRHLLSWRDVDEEGS----VLDAVTLKPLND--------------------PE 1090
            LN+++E      +  DV E G     V++++  K L +                    P+
Sbjct: 1002 LNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPK 1061

Query: 1091 KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-LDYNV 1149
              + + I GD  +I    D++     +     K  +  R+SP +K  +V+ ++  LD   
Sbjct: 1062 GDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMT 1121

Query: 1150 GFCGDGANDCGALKAANIGISLSEAEASVA 1179
               GDG+ND   +++A++GI ++  E   A
Sbjct: 1122 LAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1151

>Kwal_23.3556
          Length = 1597

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 112/251 (44%), Gaps = 26/251 (10%)

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLIS- 1046
            E VE +L  LG    E+KL+     A+ +++ A I+  M TGD   TA+++G    LI  
Sbjct: 1013 ELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHD 1072

Query: 1047 -SERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRIL 1105
             S  V +   ++N+  S  L +     E G++   V             + I G      
Sbjct: 1073 YSTVVILSAKDENI--SSKLTAVSQEIERGNIAHCV-------------VVIDGSTL-TT 1116

Query: 1106 FRNDEILPDDYISTVLMKGS-IYARMSPDEKHELVEQLQKLDYNVG--FCGDGANDCGAL 1162
            F ++  L   ++       S I  R SP +K  +V  ++  D  +     GDGAND   +
Sbjct: 1117 FESNPTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMI 1176

Query: 1163 KAANIGISLSEAE---ASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAI 1219
            ++A+IG+ ++  E   AS ++ ++ A F     L ++  GR + V + + F   + Y  +
Sbjct: 1177 QSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKL-LLVHGRYNYVRT-TKFVLCTFYKEL 1234

Query: 1220 QFITITILYSR 1230
             F    ++Y R
Sbjct: 1235 LFYLTQMIYQR 1245

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 146/356 (41%), Gaps = 73/356 (20%)

Query: 447 HGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALHPF-----YVFQIFSIILWLADDY 501
           +GLTS     R   +G N ++ +    TE LF + L  F     +V +  +I+    +D+
Sbjct: 67  YGLTSDEVTKRRKKYGLNQMSEE----TENLFVKFLMFFIGPIQFVMEAAAILAAGLEDW 122

Query: 502 YYYA---GCIFLISVL---------SIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWT 549
             +    G +FL + +         SI+D + +T  NS              V +D    
Sbjct: 123 VDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANS------------AVVIRDGNLV 170

Query: 550 QVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCI--VNESMLTGESVPVSKYAATEATM 607
           +V S+++VPGD+ ++ D   VV+P D  L++ DC   +++S +TGES+ V K        
Sbjct: 171 EVPSNEVVPGDILQLEDG--VVIPADGRLVTEDCFIQIDQSAITGESLAVDKRFGDST-- 226

Query: 608 AQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMV 667
                                F+ + + R       G A  +V  TG ST  G     + 
Sbjct: 227 ---------------------FSSSTVKR-------GEAFMIVTATGDSTFVGRAAALVN 258

Query: 668 FPKPVGFKFYEDSFKYIGFMTLIAMFGFSIS--CIQFIRLGLEYKVMILRALDIITIV-V 724
                G   + +    IG + LI +    +      F R      V ILR    ITIV V
Sbjct: 259 K-AAAGSGHFTEVLNGIGTILLILVIVTLLLVWVASFYR--TNKIVRILRYTLAITIVGV 315

Query: 725 PPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDV 780
           P  LPA +T   +     L KK       + +     V+++C DKTGTLT+  L +
Sbjct: 316 PVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSL 371

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 96/275 (34%), Gaps = 73/275 (26%)

Query: 933  KGAPE-VIADICNPATIPKDFHE----LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSR 987
            KGAP  V+  +     IP+D  E     +      GFR +                 V+R
Sbjct: 455  KGAPLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRALG----------------VAR 498

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS 1047
            +  E + E LG +   +  +  T   + E ++  +R  M TGD V  A    R  G    
Sbjct: 499  KRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG---- 554

Query: 1048 ERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFR 1107
                   L  N+  +  L      D  GS L                             
Sbjct: 555  -------LGTNIYNAERLGLGGGGDMPGSELA---------------------------- 579

Query: 1108 NDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANI 1167
                   D++         +A + P  K+ +VE LQ+  Y V   GDG ND  +LK A+ 
Sbjct: 580  -------DFVE----NADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADT 628

Query: 1168 GISLSEA--EASVAAPFTSAVFDISCVLDVIKEGR 1200
            GI++  A   A  AA        +S ++D +K  R
Sbjct: 629  GIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 663

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 93/206 (45%), Gaps = 20/206 (9%)

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS 1047
            E +E +L  LG I  E+KL+     A+ +L+ A I+  M TGD   TA+++G    LI  
Sbjct: 994  EIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHD 1053

Query: 1048 ERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFR 1107
                I    ++   +  + +     E G+V   V             + I G    I F 
Sbjct: 1054 YSTVIILAPNDENMASKITTITQEIEAGNVAHCV-------------VVIDGATLTI-FE 1099

Query: 1108 NDEILPDDYISTVLMKGS-IYARMSPDEKHELVEQLQKLDYNVG--FCGDGANDCGALKA 1164
             +  L   +I       S I  R SP +K  +V +++K D  +     GDGAND   +++
Sbjct: 1100 GNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQS 1159

Query: 1165 ANIGISLSEAE---ASVAAPFTSAVF 1187
            A+IG+ ++  E   AS ++ ++ A F
Sbjct: 1160 ADIGVDITGKEGLQASRSSDYSIAQF 1185

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 134/334 (40%), Gaps = 72/334 (21%)

Query: 903  VIRSFEFLSELRRMSVIVK--GFKEN---TYWSFTKGAPEVIADICNPATIPKD------ 951
            ++   EF S  +RMS IVK  G   N         KGA  VI    +   + ++      
Sbjct: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKT 902

Query: 952  -FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK------------VSREE--------V 990
              H  L  Y   G R +  A + L   SW   ++            V REE        +
Sbjct: 903  ALH--LEQYATEGLRTLCLAQREL---SWEEYERWNKKYDIAAAAVVDREEELEKVSDEI 957

Query: 991  EDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERV 1050
            E +L  LG    E++L+     ++  L  A I+  + TGD V TA+++G    L      
Sbjct: 958  ERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNL------ 1011

Query: 1051 FIPFLNDNLEESRHLLSWRDVDEEGS----VLDAVTLKPLND------------------ 1088
                LN+++E      +  DV++ G+    ++D +  + L+D                  
Sbjct: 1012 ----LNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEH 1067

Query: 1089 --PEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-L 1145
              P   + + I G+  +     +++     +     K  +  R+SP +K  +V+ ++  L
Sbjct: 1068 DIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTL 1127

Query: 1146 DYNVGFCGDGANDCGALKAANIGISLSEAEASVA 1179
            D      GDG+ND   +++ANIG+ ++  E   A
Sbjct: 1128 DVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQA 1161

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 103/252 (40%), Gaps = 56/252 (22%)

Query: 542 VYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIV--NESMLTGESVPVSK 599
           V +D    ++ ++++VPGD+ ++ D   V++P D  +++  C V  ++S +TGES+ V K
Sbjct: 163 VIRDGSLVEIPANEVVPGDILQLEDG--VIIPADGRIVTEGCFVQIDQSAITGESLAVDK 220

Query: 600 YAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTK 659
               +AT                      F+ + + R       G    +V  TG ST  
Sbjct: 221 RYG-DAT----------------------FSSSTVKR-------GEGFMIVTATGDSTFV 250

Query: 660 GSLVRSMVFPKPVGFKFYEDSFKYIGFMTL-----------IAMFGFSISCIQFIRLGLE 708
           G    ++V     G   + +    IG + L           +A F  SI  +  +R    
Sbjct: 251 GR-AAALVNKASAGSGHFTEVLNGIGTILLILVILTLLVVYVACFYRSIDIVTILRY--- 306

Query: 709 YKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFD 768
                   L I  + VP  LPA +T   +     L KK       + +     V+++C D
Sbjct: 307 -------TLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSD 359

Query: 769 KTGTLTEEGLDV 780
           KTGTLT+  L +
Sbjct: 360 KTGTLTKNKLSL 371

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 1112 LPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISL 1171
            +P   ++  +     +A + P  K+ +VE LQ+  Y V   GDG ND  +LK A+ GI++
Sbjct: 573  MPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV 632

Query: 1172 SEA--EASVAAPFTSAVFDISCVLDVIKEGR 1200
              A   A  AA        +S ++D +K  R
Sbjct: 633  EGATDAARSAADIVFLAPGLSAIIDALKTSR 663

>Scas_669.3
          Length = 1638

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 117/251 (46%), Gaps = 26/251 (10%)

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLI-- 1045
            EE+E +L+ LG    E+KL+     A+++++ A I+  M TGD   TA+++G    LI  
Sbjct: 1048 EEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYD 1107

Query: 1046 SSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRIL 1105
             S  V +   ++N+    + +S ++VD  G+V   V +             I G     +
Sbjct: 1108 YSTVVILAKGDENIISKMNAIS-QEVD-SGNVAHCVII-------------IDGSTL-AM 1151

Query: 1106 FRNDEILPDDYISTVLMKGS-IYARMSPDEKHELVEQLQKLDYNVG--FCGDGANDCGAL 1162
            F  +  L   +I       S I  R SP +K  +V  ++  + N+     GDGAND   +
Sbjct: 1152 FEGNPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMI 1211

Query: 1163 KAANIGISLSEAE---ASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQYMSLYSAI 1219
            ++A+IGI +   E   AS  A ++ A F     L ++  GR + + + + F   + +  I
Sbjct: 1212 QSADIGIGIGGKEGLQASRTADYSIAQFRFILKL-LLVHGRYNYIRT-AKFILCTFFKEI 1269

Query: 1220 QFITITILYSR 1230
             F    +++ R
Sbjct: 1270 TFYLTQLIFQR 1280

>Scas_569.0d
          Length = 468

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (48%), Gaps = 13/127 (10%)

Query: 1080 AVTLKPLNDPEKSYT---LAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKH 1136
            AV    L D  KS +   + +TG  F      DE+ P+  I  + +   + AR SP  K 
Sbjct: 62   AVGENSLGDDMKSNSTENMVMTGSQF------DELTPEQ-IDNLPVLPLVIARCSPQTKV 114

Query: 1137 ELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVL 1193
             ++E L + D      GDG ND  +LK AN+GI++    + VA   +  V    + + +L
Sbjct: 115  RMIEALHRRDKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASIL 174

Query: 1194 DVIKEGR 1200
            + I+EGR
Sbjct: 175  NAIEEGR 181

>Scas_688.1
          Length = 913

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 98/275 (35%), Gaps = 73/275 (26%)

Query: 933  KGAPE-VIADICNPATIPKDFHE----LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSR 987
            KGAP  V+  +     IP+D HE     +      GFR +                 V+R
Sbjct: 469  KGAPLFVLKTVEEDHPIPEDIHENYENKVAELASRGFRALG----------------VAR 512

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS 1047
            +  E + E LG +   +  +  T   + E +   +R  M TGD V  A    R  GL   
Sbjct: 513  KRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGL--- 569

Query: 1048 ERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFR 1107
                      N+  +  L                             L+  GD       
Sbjct: 570  --------GTNVYNAERL----------------------------GLSGGGD------- 586

Query: 1108 NDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANI 1167
                +P   ++  +     +A + P +K+ +VE LQ   Y V   GDG ND  +LK A+ 
Sbjct: 587  ----MPGSELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLKKADT 642

Query: 1168 GISLSEA--EASVAAPFTSAVFDISCVLDVIKEGR 1200
            GI++  A   A  AA        +S ++D +K  R
Sbjct: 643  GIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 677

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 39/61 (63%), Gaps = 4/61 (6%)

Query: 542 VYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIV--NESMLTGESVPVSK 599
           V +D    +V ++++VPGD+ ++ D   V++P D  +++ DC V  ++S +TGES+   K
Sbjct: 177 VIRDGQLVEVPANEVVPGDILQLEDG--VIIPADGRIVTEDCFVQIDQSAITGESLAADK 234

Query: 600 Y 600
           +
Sbjct: 235 H 235

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 711 VMILRALDIITIV-VPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDK 769
           V ILR    ITIV VP  LPA +T   +     L KK       + +     V+++C DK
Sbjct: 315 VRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDK 374

Query: 770 TGTLTEEGLDV 780
           TGTLT+  L +
Sbjct: 375 TGTLTKNKLSL 385

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P-type
            ATPase of the plasma membrane, expression not detected
            under normal growth conditions [2844 bp, 947 aa]
          Length = 947

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 96/275 (34%), Gaps = 73/275 (26%)

Query: 933  KGAPE-VIADICNPATIPKDFHE----LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSR 987
            KGAP  V+  +     IP+D HE     +      GFR +                 V+R
Sbjct: 503  KGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG----------------VAR 546

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS 1047
            +  E + E LG +   +  +  T   + E +N  +R  M TGD V  A    R  G    
Sbjct: 547  KRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLG---- 602

Query: 1048 ERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFR 1107
                   L  N+  +  L      D  GS L                             
Sbjct: 603  -------LGTNIYNAERLGLGGGGDMPGSELA---------------------------- 627

Query: 1108 NDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANI 1167
                   D++         +A + P  K+ +VE LQ   Y V   GDG ND  +LK A+ 
Sbjct: 628  -------DFVE----NADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADT 676

Query: 1168 GISLSEA--EASVAAPFTSAVFDISCVLDVIKEGR 1200
            GI++  A   A  AA        +S ++D +K  R
Sbjct: 677  GIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 711

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 102/246 (41%), Gaps = 44/246 (17%)

Query: 542 VYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCI--VNESMLTGESVPVSK 599
           V +D    ++ ++++VPG++ ++   S  + P D  +++ DC   +++S +TGES+   K
Sbjct: 211 VIRDGQLIEIPANEVVPGEILQLE--SGTIAPADGRIVTEDCFLQIDQSAITGESLAAEK 268

Query: 600 YAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTK 659
           +   E                       +F+ + +         G A  +V  TG +T  
Sbjct: 269 HYGDE-----------------------VFSSSTV-------KTGEAFMVVTATGDNTFV 298

Query: 660 GSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYK----VMILR 715
           G     +     V   F E     IG + L+      I+ +  +     Y+    V ILR
Sbjct: 299 GRAAALVGQASGVEGHFTE-VLNGIGIILLV----LVIATLLLVWTACFYRTVGIVSILR 353

Query: 716 -ALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLT 774
             L I  I VP  LPA +T   +     L KK       + +     V+++C DKTGTLT
Sbjct: 354 YTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLT 413

Query: 775 EEGLDV 780
           +  L +
Sbjct: 414 KNKLSL 419

>Scas_710.41
          Length = 904

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 102/243 (41%), Gaps = 36/243 (14%)

Query: 541 RVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCI--VNESMLTGESVPVS 598
           RV +D    ++ ++++VPGD+ E+ + +++  P D  L++ +    V++S +TGES+ V 
Sbjct: 168 RVIRDGTLQEIPANEIVPGDILELDEGTII--PADGRLVTENRFLQVDQSAITGESLAVD 225

Query: 599 KYAATEATMAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTT 658
           K                              N   +    +    G ++ +V  TG +T 
Sbjct: 226 K------------------------------NYGDVTFSSSTVKTGTSVMVVTATGDNTF 255

Query: 659 KGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILR-AL 717
            G    ++V     G   + D    IG + L+ +    +          +  VMILR  L
Sbjct: 256 VGR-AAALVGEASGGQGHFTDILNDIGTILLVLVIITLLLVWTACFYRTDGIVMILRFTL 314

Query: 718 DIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEG 777
            I  I VP  LPA +T   +     L KK       + +     V+++C DKTGTLT+  
Sbjct: 315 GITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNK 374

Query: 778 LDV 780
           L +
Sbjct: 375 LSL 377

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 62/136 (45%), Gaps = 5/136 (3%)

Query: 1112 LPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISL 1171
            +P   ++  +     +A + P  K+++VE LQ   Y V   GDG ND  +LK A+ GI++
Sbjct: 579  MPGSELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV 638

Query: 1172 SEA--EASVAAPFTSAVFDISCVLDVIKEGRASLVTSFSCFQY---MSLYSAIQFITITI 1226
              A   A  AA        +S ++D +K  R      +S   Y   +SL+  I F     
Sbjct: 639  EGATDAARSAADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLEIFFGLWIA 698

Query: 1227 LYSRGSNLGDFQFLYI 1242
            + +R  N+    F+ I
Sbjct: 699  ILNRSLNIELIVFIAI 714

>Kwal_47.17522
          Length = 899

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 96/275 (34%), Gaps = 73/275 (26%)

Query: 933  KGAPE-VIADICNPATIPKDFHE----LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSR 987
            KGAP  V+  +     IP+D HE     +      GFR +                 V+R
Sbjct: 455  KGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG----------------VAR 498

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS 1047
            +  E + E LG +   +  +  T   + E +   +R  M TGD V  A    R  G    
Sbjct: 499  KRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLG---- 554

Query: 1048 ERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFR 1107
                   L  N+  +  L      D  GS L                             
Sbjct: 555  -------LGTNIYNAERLGLGGGGDMPGSELA---------------------------- 579

Query: 1108 NDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANI 1167
                   D++         +A + P  K+ +VE LQ+  Y V   GDG ND  +LK A+ 
Sbjct: 580  -------DFVE----NADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADT 628

Query: 1168 GISLSEA--EASVAAPFTSAVFDISCVLDVIKEGR 1200
            GI++  A   A  AA        +S ++D +K  R
Sbjct: 629  GIAVEGATDAARSAADIVFLAPGLSAIIDALKTSR 663

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 711 VMILR-ALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDK 769
           V ILR  L I  I VP  LPA +T   +     L KK       + +     V+++C DK
Sbjct: 301 VRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDK 360

Query: 770 TGTLTEEGLDV 780
           TGTLT+  L +
Sbjct: 361 TGTLTKNKLSL 371

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 39/61 (63%), Gaps = 4/61 (6%)

Query: 542 VYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCI--VNESMLTGESVPVSK 599
           V +D    ++ ++++VPGD+ ++ D   VV+  D  L++ +C   +++S +TGES+ V K
Sbjct: 163 VVRDGNLVEIPANEVVPGDIMQLEDG--VVICADGRLVTEECFLQIDQSAITGESLAVDK 220

Query: 600 Y 600
           +
Sbjct: 221 H 221

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type
           copper-transporting ATPase, involved in resistance to
           cadmium [3651 bp, 1216 aa]
          Length = 1216

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 95/242 (39%), Gaps = 41/242 (16%)

Query: 549 TQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEATMA 608
           T++N   L  GD+F++   S +  P D  +ISG   V+E+++TGES+PV K   +     
Sbjct: 707 TEINIRLLQYGDIFKVLPDSRI--PTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAG 764

Query: 609 QLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVF 668
            +                    GT  +++   PG              +T  ++V     
Sbjct: 765 SVNG-----------------TGTLFVKLSKLPGNNTI----------STIATMVDEAKL 797

Query: 669 PKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVM---------ILRALDI 719
            KP      +    Y  F+  I        C+ +I +G+  +           I+ A+ +
Sbjct: 798 TKPKIQNIADKIASY--FVPTIIGITVVTFCV-WIAVGIRVEKQSRSDAVIQAIIYAITV 854

Query: 720 ITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLD 779
           + +  P  +   + I    A G   K+G+   S   + V      + FDKTGTLTE  L 
Sbjct: 855 LIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLT 914

Query: 780 VL 781
           V+
Sbjct: 915 VV 916

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 1125 SIYARMSPDEKHELVEQL----------QKLDYNVGFCGDGANDCGALKAANIGISLSEA 1174
            +I +  +P EK E ++ +          Q     V FCGDG ND   L  A IG+ ++E 
Sbjct: 1068 NIRSHATPAEKSEYIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEG 1127

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
            Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
            Saccharomyces cerevisiae YPL036w PMA2, hypothetical start
          Length = 902

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 105/455 (23%), Positives = 171/455 (37%), Gaps = 104/455 (22%)

Query: 933  KGAPE-VIADICNPATIPKDFHE----LLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSR 987
            KGAP  V+  +     IP+D HE     +      GFR +                 V+R
Sbjct: 458  KGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG----------------VAR 501

Query: 988  EEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS 1047
            +  E + E LG +   +  +  T   + E +   +R  M TGD V  A    R  G    
Sbjct: 502  KRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLG---- 557

Query: 1048 ERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFR 1107
                   L  N+  +  L      D  GS L                             
Sbjct: 558  -------LGTNIYNAERLGLGGGGDMPGSELA---------------------------- 582

Query: 1108 NDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANI 1167
                   D++         +A + P  K+++VE LQ   Y V   GDG ND  +LK A+ 
Sbjct: 583  -------DFVE----NADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADT 631

Query: 1168 GISLSEAEASVAAPFTSAVF---DISCVLDVIKEGRASLVTSFSCFQY---MSLYSAIQF 1221
            GI++ E  +  A      VF    +S ++D +K  R      +S   Y   +SL+  + F
Sbjct: 632  GIAV-EGASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEL-F 689

Query: 1222 ITITILYSRGSNLGDFQFLYIDLLLIVPIAI-----SMSWSKPNSKLVKKRPSANLVSPK 1276
            + + I+    S         +D+ LIV IAI     +++ +  N+   +     NL  P+
Sbjct: 690  LGLWIIILNHS---------LDIELIVFIAIFADVATLAIAYDNAPFSQTPVKWNL--PR 738

Query: 1277 ILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSDNTVLFFVSNFQYILTA 1336
            +     ++I L ++  +  WI +  T+ ++ P  G      S D  +   +S  +  L  
Sbjct: 739  L---WGMSIILGIVLAIGTWICL--TTMFL-PRGGIIQNFGSIDGVLFLQISLTENWLIF 792

Query: 1337 VVLSQGPPYRE-PMIKNIG--FILDISLSMLVSFG 1368
            V  + GP +   P  +  G  F +DI  +M   FG
Sbjct: 793  VTRAVGPFWSSIPSWQLAGAVFAVDIIATMFTLFG 827

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 542 VYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCI--VNESMLTGESVPVSK 599
           V +D    +V ++++VPGD+ ++ D +  ++P D  L++ +C   V++S +TGES+ V K
Sbjct: 166 VIRDGQLVEVPANEVVPGDILQLEDGT--IIPADGRLVTENCFLQVDQSAITGESLAVDK 223

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 711 VMILR-ALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDK 769
           V ILR  L I  I VP  LPA +T   +     L KK       + +     V+++C DK
Sbjct: 304 VKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDK 363

Query: 770 TGTLTEEGLDV 780
           TGTLT+  L +
Sbjct: 364 TGTLTKNKLSL 374

>Kwal_55.21575
          Length = 989

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 1125 SIYARMSPDEKHELVEQLQKLDY-NVGFCGDGANDCGALKAANIGISLS 1172
            ++Y+ ++P +K++LV+ LQ     NV F GDG ND  AL  +++G+S+S
Sbjct: 791  NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 67/316 (21%), Positives = 123/316 (38%), Gaps = 64/316 (20%)

Query: 486 YVFQIFSIILWLADDYYYYAGCIFLISVLSI----IDTVIETKKNSE------KLADISH 535
           + F ++SI + +A         IF  SV+ I    +  ++E K  S+      KL  ++ 
Sbjct: 349 FAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408

Query: 536 FNCEVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESV 595
             C   + ++    ++    L  GD  EI   + +  P D V+I G+  V+ES++TGES+
Sbjct: 409 STC--TIIENGKAREIPVEFLQVGDTVEIKPGAKI--PTDGVIIEGESEVDESLITGESL 464

Query: 596 PVSKYAATEATMAQLLQDXXXXXXXXXXXXXXLFNG-TKIIRVRNQPGQGMALALVIRTG 654
            V +Y         +                   NG  + +      G    LA +I+T 
Sbjct: 465 MVPRYKGFPVIAGSI-------------------NGPNRFLLTATSVGDDTKLAQIIQT- 504

Query: 655 FSTTKGSLVRSMVFPKPVGFKFYED--SFKYIGFMTLIAMFGFSISCIQ----------F 702
                  + ++ +   P+  + Y D  + K++  + ++AM  F    I           F
Sbjct: 505 -------MKQAQLSKAPI--QHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIF 555

Query: 703 IRLGLEYKVMILRALDIITIVVPPAL----PATLTIGTSFALGRLKKKGIFCISPTRVNV 758
                ++ + +   + +I +  P AL    P  + +GT        K G+       +  
Sbjct: 556 DSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLG----AKHGVLIKGGDILEK 611

Query: 759 GGKVDMMCFDKTGTLT 774
              ++   FDKTGTLT
Sbjct: 612 CSSLETFLFDKTGTLT 627

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
            Saccharomyces cerevisiae YDR270w CCC2, start by
            similarity
          Length = 1012

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 1125 SIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEA 1174
            ++Y+ ++PD K + VE L++    + F GDG ND  AL  +++GI++S  
Sbjct: 807  NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSG 856

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
            cerevisiae YDR270w CCC2 probable copper-transporting
            ATPase, start by similarity
          Length = 975

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 1126 IYARMSPDEKHELVEQLQKLDYN-VGFCGDGANDCGALKAANIGISLSEA 1174
            +++ ++P++K ++V QLQ      V F GDG ND  AL  A++GIS+S  
Sbjct: 794  VFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISISSG 843

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 63/129 (48%), Gaps = 13/129 (10%)

Query: 486 YVFQIFSIILWLADDYYYYAGCIFLISVLSI----IDTVIETKKNSE------KLADISH 535
           Y+F  +SII  +          IF  +V+ +    +  ++E K  SE      KL  ++ 
Sbjct: 347 YIFSCYSIISSIYHKSTKMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTP 406

Query: 536 FNCEVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESV 595
            +C + V  D    +++   L P D+ E+  P + + P D V+I  +  V+ES++TGES+
Sbjct: 407 SSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMKI-PADGVVIRNETEVDESLITGESM 463

Query: 596 PVSKYAATE 604
            V K   ++
Sbjct: 464 LVEKIVGSQ 472

>Scas_615.9
          Length = 942

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1125 SIYARMSPDEKHELVEQLQKLDYN-VGFCGDGANDCGALKAANIGISLS 1172
            ++Y+ ++P  K E+VE LQ      V F GDG ND   L  ++IG++LS
Sbjct: 746  NVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS 794

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 67/143 (46%), Gaps = 20/143 (13%)

Query: 486 YVFQIFSIILWLA-----DDYYYYAGCIFLISVLSI----IDTVIETKKNSE------KL 530
           Y+F IFSII  +      ++       +F  SV+ I       ++E K  ++      KL
Sbjct: 291 YLFSIFSIIHTMVLSRGNEESPMLPNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKL 350

Query: 531 ADISHFNCEVRVYKDRFWT---QVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNE 587
             ++   C +   K+   +   ++ ++ L   D+ EI  P + + P D ++I G+  ++E
Sbjct: 351 IQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIK-PGMKI-PADGIIIQGESEIDE 408

Query: 588 SMLTGESVPVSKYAATEATMAQL 610
           S++TGES+ V K   ++     L
Sbjct: 409 SLMTGESILVHKQKGSQVIAGSL 431

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..514400)
            [2433 bp, 810 aa]
          Length = 810

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 33/49 (67%), Gaps = 2/49 (4%)

Query: 1125 SIYARMSPDEKHELVEQL-QKLDYNVGFCGDGANDCGALKAANIGISLS 1172
            ++++   P+ K +++ QL QK DY V F GDG ND  AL  +++GISLS
Sbjct: 631  NVFSERLPEGKCDVLRQLRQKYDY-VAFIGDGINDSVALAESDLGISLS 678

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 572 LPCDAVLISGDCIVNESMLTGESVPVSKY 600
           LP D  ++ G+  V+ES++TGES  V KY
Sbjct: 284 LPADGTVLEGEAEVDESLMTGESTLVPKY 312

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 30/108 (27%)

Query: 1095 LAITGDIFRILFRNDEILPDDYIS----------TVLMKG------------------SI 1126
            +++ G +F +   NDE+  D Y +          T ++ G                  ++
Sbjct: 749  VSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENV 808

Query: 1127 YARMSPDEKHELVEQLQKLDYN--VGFCGDGANDCGALKAANIGISLS 1172
            Y+ +SP  K +LV+++Q  + N  V   GDG ND  AL  +++GI++S
Sbjct: 809  YSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAIS 856

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 6/53 (11%)

Query: 552 NSSDLVPGDLFEISD-----PSLVVLPCDAVLISGDCIVNESMLTGESVPVSK 599
           N +  +P +L +++D     P + + P D ++  G+  ++ES++TGES+ V K
Sbjct: 421 NETKEIPIELLQVNDIVEIKPGMKI-PADGIITRGESEIDESLMTGESILVPK 472

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 119/306 (38%), Gaps = 75/306 (24%)

Query: 503 YYAGCIFLISVLSIIDTVIET---KKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPG 559
           Y+   +FL   L +I  ++E+    K +  ++++S F  E      +   Q    + V  
Sbjct: 511 YFDSVVFLTFFL-LIGRLLESLAKTKTASAISNLSSFKQETATLMQKVGDQYQEVETVQI 569

Query: 560 DLFEISDPSLVVL----PCDAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQDXX 615
              E+ D   +      P D++++ G+   +ES LTGES+P          M +L  D  
Sbjct: 570 QYLELGDYIKISPGQSPPLDSIILEGETEFDESALTGESIP----------MVRLRGD-- 617

Query: 616 XXXXXXXXXXXXLFNGT-------KIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVF 668
                       +F GT        I +V +  G+ + L  ++ T      G L R+ + 
Sbjct: 618 -----------QIFAGTVNVGSSSVIAKVSSFDGESL-LDQIVNT---VRDGQLNRAPI- 661

Query: 669 PKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKV---------------MI 713
                 +   D     G+   I +F   ++ + ++ LGL  K+                +
Sbjct: 662 ------ERLADILT--GYFVPIIIFLAILTWVVWLSLGLSGKLPEHYLDTDIGGWPVWSL 713

Query: 714 LRALDIITIVVPP----ALPATLTIGTSFALGRLKKKGIFCISPTRV-NVGGKVDMMCFD 768
             A+ +  I  P     A P  L +G+  A     K GI C         G K+ ++CFD
Sbjct: 714 EFAISVFVIACPCGIGLAAPTALFVGSGMA----AKFGILCRGGGAAFQEGCKIAIVCFD 769

Query: 769 KTGTLT 774
           KTGTLT
Sbjct: 770 KTGTLT 775

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 7/57 (12%)

Query: 1125 SIYARMSPDEKHELVEQLQKLDYN-------VGFCGDGANDCGALKAANIGISLSEA 1174
            ++ A + P+EK   V+ +Q  +         V   GDG ND  AL AA++GI+L+  
Sbjct: 971  NVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALASG 1027

>Scas_505.4
          Length = 1025

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 1114 DDYISTV--LMKGSIYARMSPDEKHELVEQLQKLDYNVGFC-GDGANDCGALKAANIGIS 1170
            +DY+  +  + K  +  R+SP +K  +V+ +++   ++    GDGAND   ++AA++G+ 
Sbjct: 576  EDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVG 635

Query: 1171 LSEAEASVAA 1180
            +S  E   AA
Sbjct: 636  ISGMEGMQAA 645

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129)
           [3702 bp, 1233 aa]
          Length = 1233

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 92/234 (39%), Gaps = 39/234 (16%)

Query: 557 VPGDLFEISDPSLVVLP-----CDAVLISGDCIVNESMLTGESVPVSKYA-----ATEAT 606
           V  ++ E+ D  +++ P      DA+++ G+   +ES LTGES P++ +      A    
Sbjct: 659 VSAEMLELGD-HILIKPGASPAVDALIVQGETEFDESSLTGESRPITHFPGDQIFAGTVN 717

Query: 607 MAQLLQDXXXXXXXXXXXXXXLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSM 666
           + Q                  + +  +  ++R  P + +A  L          G  V  +
Sbjct: 718 VGQCAVIAKVSTAPGNSLLDHVISAVRDGQLRGAPIERIADVLT---------GYFVPFI 768

Query: 667 VFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPP 726
           V    + +  +      +GF  +++      S   +    LE+      A+ +  I  P 
Sbjct: 769 VLLAILTWAIW----LILGFAGVLSQEKLDGSVGGWPFWSLEF------AIAVFVIACPC 818

Query: 727 ----ALPATLTIGTSFALGRLKKKGIFCISPTRV-NVGGKVDMMCFDKTGTLTE 775
               A P  L +G + A     K GI     +    +G KV  +CFDKTGTLT+
Sbjct: 819 GIGLAAPTALFVGANIA----AKYGILARGGSAAFQMGSKVTTVCFDKTGTLTK 868

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 3/73 (4%)

Query: 1105 LFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLD---YNVGFCGDGANDCGA 1161
            +   D  L  + ++  +    + A + P+ K E ++ +++       +   GDG ND  A
Sbjct: 1040 MISGDNSLAANAVALEVGIKHVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPA 1099

Query: 1162 LKAANIGISLSEA 1174
            + AA++GISL+  
Sbjct: 1100 IAAADVGISLASG 1112

>CAGL0B01485g 132868..134892 similar to tr|Q08282 Saccharomyces
           cerevisiae YOL141w PPM2, hypothetical start
          Length = 674

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 390 PESRHYHHHETEWNPNLPILISFQYRYFTLVYSPIDDIF---RSNSNWADPDWLDLEVVQ 446
           P++R  H +++  +  L ILI  +       + P +D+F   +  ++W     LD  + +
Sbjct: 421 PDARVCHSYDSLMDGKLDILIGGR----KAPHQPFNDVFIFEKQTASWEKVATLDYPIYR 476

Query: 447 HGLTSSIQEDRTLAFGKN 464
           H  TSS+  D+ L FG N
Sbjct: 477 HA-TSSLSNDKLLLFGGN 493

>KLLA0D00858g complement(80327..81952) similar to sp|P38628
            Saccharomyces cerevisiae YEL058w PCM1
            phosphoacetylglucosamine mutase singleton, start by
            similarity
          Length = 541

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 1378 LGELLQLTNISDTFKWLILTTAAANYYASKYIPEKFK 1414
            + +LL+   +SDT K  ++ TA AN  ++KYI +K K
Sbjct: 314  IADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLK 350

>YGR003W (CUL3) [1974] chr7 (500134..502368) Member of the cullin
            family with similarity to Cdc53p and Rtt101p [2235 bp,
            744 aa]
          Length = 744

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 1045 ISSERVFIPFLNDNLEESRHLLSWRD-----VDEEGSVLDAVTLKP--LNDPEKSYTLAI 1097
            I+   + IPF   N ++ ++ ++W          + S L+++      LN+     + AI
Sbjct: 309  INKNAINIPFNEGNRKKGQNAITWSSEIVELYRSQHSFLESIDFGSVRLNNLTGDVSNAI 368

Query: 1098 TGDIFRILFRNDEILPDDYIST 1119
             GD+F + F  +  LP +Y+ST
Sbjct: 369  LGDVFSMYFSKEGALPSEYLST 390

>Scas_584.5
          Length = 367

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 1111 ILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGAND 1158
            I+PD  +    +KGS Y +  P +  E   QLQK D  V    DG  D
Sbjct: 247  IIPDSLLKEAALKGSSYIQNVPSDADEYTFQLQKNDI-VMMATDGVTD 293

>YBL106C (SRO77) [97] chr2 complement(10847..13879) Protein that
           functions together with Sec9p in exocytosis downstream
           of the Rho3p GTPase [3033 bp, 1010 aa]
          Length = 1010

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 64/149 (42%), Gaps = 23/149 (15%)

Query: 350 EWVVVENEFGELTVESVKRRWYNRPLSTVLMETNEDRIGTPESRHYHHHETEWNPNLPIL 409
           +W+++  E G + +  V R      +S + +E  +  +  P+ R       +WNP     
Sbjct: 137 DWMLIGLESGSILIYDVDRNQ----MSKLKIENFQKSVFLPKERLSPVISIQWNPRDIGT 192

Query: 410 ISFQYRYFTLVYSPIDDIFRSNSNWADPDWLDLEVVQHG--LTSSIQEDRTLAFGKNSVN 467
           I   Y + T++YS ID  ++   ++    +  LE    G  L+++I++ RT         
Sbjct: 193 ILISYEHITVIYSFID--YKVKQHF----FYQLEPYAPGGDLSTNIEKKRT--------- 237

Query: 468 LKQKTVTEILFDEALHPFYVFQIFSIILW 496
              K +  +    +LH   V +  +++ W
Sbjct: 238 --PKVIQSLYHPNSLHILTVHEDNALVFW 264

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 43,622,067
Number of extensions: 1870844
Number of successful extensions: 4832
Number of sequences better than 10.0: 88
Number of HSP's gapped: 4792
Number of HSP's successfully gapped: 170
Length of query: 1417
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1303
Effective length of database: 12,649,657
Effective search space: 16482503071
Effective search space used: 16482503071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)