Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B08195g33032516480.0
Kwal_26.92183102877821e-103
YOR292C3092977414e-97
Scas_665.293223337112e-92
CAGL0M11330g2963346631e-85
AFR568C3152836581e-84
Kwal_14.26321991521546e-12
AFR120C1821101466e-11
KLLA0F22924g1951091451e-10
YLR251W1971171405e-10
Sklu_1738.32001191388e-10
CAGL0B03465g2101161381e-09
Scas_639.202081181335e-09
Sklu_2275.4101244636.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B08195g
         (325 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyce...   639   0.0  
Kwal_26.9218                                                          305   e-103
YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member...   290   4e-97
Scas_665.29                                                           278   2e-92
CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743 S...   259   1e-85
AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)...   258   1e-84
Kwal_14.2632                                                           64   6e-12
AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [...    61   6e-11
KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomy...    60   1e-10
YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mp...    59   5e-10
Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement         58   8e-10
CAGL0B03465g complement(343994..344626) highly similar to tr|Q06...    58   1e-09
Scas_639.20                                                            56   5e-09
Sklu_2275.4 YLL005C, Contig c2275 4812-7850                            29   6.6  

>KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyces
           cerevisiae YOR292c, start by similarity
          Length = 330

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/325 (96%), Positives = 313/325 (96%)

Query: 1   MPLSLPEESGFASFESGLRDSLTNKIEQWKTITLNLIYSLRRFKILKITIIHWSILSTWI 60
           MPLSLPEESGFASFESGLRDSLTNKIEQWKTITLNLIYSLRRFKILKITIIHWSILSTWI
Sbjct: 1   MPLSLPEESGFASFESGLRDSLTNKIEQWKTITLNLIYSLRRFKILKITIIHWSILSTWI 60

Query: 61  VLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCISCFLSYXXXXXXXXXXXXTR 120
           VLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCISCFLSY            TR
Sbjct: 61  VLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCISCFLSYKVDPVPEVVDKVTR 120

Query: 121 NLVAGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQTDTRNASPGIDSELRHDWDLDS 180
           NLVAGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQTDTRNASPGIDSELRHDWDLDS
Sbjct: 121 NLVAGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQTDTRNASPGIDSELRHDWDLDS 180

Query: 181 NLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYKFLNYFYTEDPTVVQVLERV 240
           NLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYKFLNYFYTEDPTVVQVLERV
Sbjct: 181 NLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYKFLNYFYTEDPTVVQVLERV 240

Query: 241 LSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYITTLGCNYLVWPLVQFINFLM 300
           LSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYITTLGCNYLVWPLVQFINFLM
Sbjct: 241 LSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYITTLGCNYLVWPLVQFINFLM 300

Query: 301 VPKHLQVPFSSSVGVLWNCFLSMRN 325
           VPKHLQVPFSSSVGVLWNCFLSMRN
Sbjct: 301 VPKHLQVPFSSSVGVLWNCFLSMRN 325

>Kwal_26.9218
          Length = 310

 Score =  305 bits (782), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 197/287 (68%), Gaps = 28/287 (9%)

Query: 39  SLRRFKILKITIIHWSILSTWIVLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQ 98
            ++ + +L + I+HW++L+ W++LL+   SVYG +Y+ SAL  T+CTN +LFGTSD LAQ
Sbjct: 46  KIQGYTLLHVGIVHWTLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQ 105

Query: 99  CISCFLSYXXXXXXXXXXXXTRNLVAGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQ 158
           CI  +                 NLV+  +    +   D  +D++S++N+YG         
Sbjct: 106 CILQYTWDPVDPTPAALDATAHNLVSRYALFGDQD-SDAENDSISLYNEYG--------- 155

Query: 159 TDTRNASPGIDSELRHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVP 218
                  PG  ++        S + Y     S+ +   F F+RW+CFM+WG FLSFFQVP
Sbjct: 156 -------PGATAQ--------SPVPYH---QSAQHPPRFDFFRWLCFMAWGSFLSFFQVP 197

Query: 219 WYKFLNYFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNI 278
           WYK LN+FYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIM+ GD+ SF++KI+ +
Sbjct: 198 WYKVLNFFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMQKGDSASFKVKIQKV 257

Query: 279 YITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           Y+ TLGCNYLVWP VQFINFL+VPKHLQVPFSSSVGV+WNCFLSMRN
Sbjct: 258 YLGTLGCNYLVWPPVQFINFLVVPKHLQVPFSSSVGVVWNCFLSMRN 304

>YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member of
           the Mpv17 and PMP22 family, which are peroxisomal
           proteins, has moderate similarity to uncharacterized C.
           albicans Orf6.6217p [930 bp, 309 aa]
          Length = 309

 Score =  290 bits (741), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 150/297 (50%), Positives = 189/297 (63%), Gaps = 24/297 (8%)

Query: 29  WKTITLNLIYSLRRFKILKITIIHWSILSTWIVLLLHFTSVYGSLYQSSALLATMCTNVL 88
           W       + +L   +I +IT+ HW +L  W+  L  FTS Y  LY +SA+ AT+CTN+L
Sbjct: 34  WTRRAAAALRTLMNKRIQRITLTHWLLLVIWVTSLWKFTSHYRQLYANSAVFATLCTNIL 93

Query: 89  LFGTSDCLAQCISCFLSYXXXXXXXXXXXXTRNLVAGLSFRRTESFDDNYSDNVSIFNDY 148
           LFG SD LAQ I+CF SY              ++      R  E+     SD +SIFND+
Sbjct: 94  LFGISDILAQSIACFYSYHVDPIPQILNDTFHHVQNN---RDVENGGGYESDELSIFNDF 150

Query: 149 GVERPSFEGQTDTRNASPGIDSELRHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSW 208
             E  S+    D     P +D  L                 ++   + F F+RW CFM W
Sbjct: 151 TSEHSSYTDNDDY----PELDRPL-----------------ATFKTDTFDFFRWGCFMFW 189

Query: 209 GWFLSFFQVPWYKFLNYFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDA 268
           G+F+SFFQ PWYKFLN+FYTEDPTVVQV ERVLSDQL+YSPISLYCFFM+SNY+ME GD 
Sbjct: 190 GFFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQLLYSPISLYCFFMFSNYVMEGGDK 249

Query: 269 ESFQIKIRNIYITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           ++   KI+ +YI+TLGCNYLVWP+VQFINFL++P+  Q PFSSSVGV+WNCFLSMRN
Sbjct: 250 DTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPFSSSVGVVWNCFLSMRN 306

>Scas_665.29
          Length = 322

 Score =  278 bits (711), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 207/333 (62%), Gaps = 27/333 (8%)

Query: 1   MPLSLPEESGFASF--ESGLRDSLTNKIEQWKTITLNLIYSLRRF---KILKITIIHWSI 55
           M L L  E    +F  +S  R  + +  +  +T   N +  ++RF   +I +IT+ H  I
Sbjct: 1   MALELAGEDSITAFNDDSETRGVIKSSFKNIRTFEENAVGKVKRFFTIRIYRITLTHLII 60

Query: 56  LSTWIVLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCISCFLSYXXXXXXXXX 115
           L  W+  LL +TS Y  +Y  +AL+AT+  N +LFG SDCLAQ I+CF S          
Sbjct: 61  LIIWVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPKIV 120

Query: 116 XXXTRNLVAGLSFRRTESFD--DNY-SDNVSIFNDYGVERPSFEGQTDTRNASPGIDSEL 172
               R+++        ES D  + Y SD +S+FNDYG+              SP   S  
Sbjct: 121 DDTARHIMNQFRSPAHESLDLENGYESDTLSVFNDYGL--------------SPASSSIG 166

Query: 173 RHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYKFLNYFYTEDPT 232
             +  L S      +   ++   LF+F R+  FM WG+F+SFFQVPWYK LN+FYTEDPT
Sbjct: 167 NEEGFLPSE-----EEVGTTRTYLFNFRRFFSFMFWGFFISFFQVPWYKILNFFYTEDPT 221

Query: 233 VVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYITTLGCNYLVWPL 292
           V+QVLERVLSDQL YSP+ LY FFMY+NYIME G+AE+F  KI++IYI+TLGCNYLVWP 
Sbjct: 222 VIQVLERVLSDQLTYSPVQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPA 281

Query: 293 VQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           VQFINFL++PK  QVPFSSSVGVLWNCFLSMRN
Sbjct: 282 VQFINFLLLPKPFQVPFSSSVGVLWNCFLSMRN 314

>CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743
           Saccharomyces cerevisiae YOR292c, hypothetical start
          Length = 296

 Score =  259 bits (663), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 140/334 (41%), Positives = 196/334 (58%), Gaps = 50/334 (14%)

Query: 1   MPLSLPEESGFASFESGLRDSLTNKIEQWKTITLNLIYSLRRFKILKITIIHWSILSTWI 60
           M ++LP   G  ++   +R               N+  ++    +  I++ HW ++  W+
Sbjct: 1   MTIALPGVDGSTAYNYAVRQR-------------NVFRTVFTANVFHISLTHWFLMFCWL 47

Query: 61  VLL-LHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCISCFLSYXXXXXXXXXXXXT 119
            L+  ++ + Y  LY+ + L+A+  +N +LFG SD LAQCI+C+ S              
Sbjct: 48  NLMWRYYFNHYKDLYKYNRLIASQLSNCMLFGLSDILAQCITCYFSREMDPVPRIIDETV 107

Query: 120 RNLV--------AGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQTDTRNASPGIDSE 171
           +NL+         G+     E  D +  DN+S+FNDYG        + D  N        
Sbjct: 108 QNLIPYNVMPLPGGIFEANEELLDSDNDDNLSVFNDYG--------EYDNSN-------- 151

Query: 172 LRHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYKFLNYFYTEDP 231
                     ++Y+     ++    F F RW+ FM WG F+SFFQVPWY  LN  YTEDP
Sbjct: 152 --------DEIEYNHTEKVAT----FHFRRWLGFMGWGGFISFFQVPWYIILNTIYTEDP 199

Query: 232 TVVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYITTLGCNYLVWP 291
           TVVQVLERVL+DQL+YSP+SLY FFMYSNY++E GD  +F +KIR +Y+TTLGCNY++WP
Sbjct: 200 TVVQVLERVLTDQLLYSPVSLYFFFMYSNYVIEQGDRYTFSMKIRRLYVTTLGCNYMIWP 259

Query: 292 LVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           ++QFINFL++PKH QVPFSSSVGV+WNCFLSMRN
Sbjct: 260 MMQFINFLVIPKHYQVPFSSSVGVVWNCFLSMRN 293

>AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)
           [948 bp, 315 aa]
          Length = 315

 Score =  258 bits (658), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 135/283 (47%), Positives = 175/283 (61%), Gaps = 30/283 (10%)

Query: 42  RFKILKITIIHWSILSTWIVLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCIS 101
           R  +L +   +W++    ++L+   T VYG LY+ S L+AT C+NVLLFG SDC AQ ++
Sbjct: 53  RMHLLGVPPTYWAVGGATLMLVALLTRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLA 112

Query: 102 CFLSYXXXXXXXXXXXXTRNLVAGLSFRRTESFDDNYSDNVSIFNDYGVERPSFEGQTDT 161
           C  +             TR L+  L  +     D+   D +  F+DYG   P  E    T
Sbjct: 113 C--AATEASRAGGPLAATRELLVQLRPQPPVRLDEE--DELRAFSDYG---PRPESHM-T 164

Query: 162 RNASPGIDSELRHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYK 221
            +    ++ E R                       F FYRW CFM WG  ++ FQVPWY+
Sbjct: 165 ESEGVWVEEEPRR----------------------FDFYRWGCFMLWGPVMANFQVPWYR 202

Query: 222 FLNYFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYIT 281
            LNY YT+DPTVVQVLERVLSDQL+YSP+SLYCFF YSNY++E G  E+F +KI+ +Y++
Sbjct: 203 LLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFFWYSNYVIEGGTEETFALKIQRVYVS 262

Query: 282 TLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMR 324
           TLGCNY VWPLVQF+NFL++PK LQVPFSSSVGVLWN FLS+R
Sbjct: 263 TLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVLWNIFLSLR 305

>Kwal_14.2632
          Length = 199

 Score = 63.9 bits (154), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 74/152 (48%), Gaps = 6/152 (3%)

Query: 177 DLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYKFLNYFYTEDPTV--- 233
           D  + L +  D +++   ++    R + + S     SF    W+K LN            
Sbjct: 32  DAIAQLCFPGDKSATRQYDIARTVRAVTYGSL--IFSFIGDKWFKTLNKIKLASFPANHW 89

Query: 234 VQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYITTLGCNYLVWPLV 293
             +  RV +DQL+++P+ +  +F     +ME    +  + KIRN++   L  N++VWP V
Sbjct: 90  SNLALRVGTDQLLFAPLCVPFYFGILT-LMEGKSPKHAENKIRNVWWDILKTNWMVWPAV 148

Query: 294 QFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           Q INF +VP   ++   + V + WN FLS RN
Sbjct: 149 QIINFSLVPVQHRLLAVNLVAIFWNTFLSFRN 180

>AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [549
           bp, 182 aa]
          Length = 182

 Score = 60.8 bits (146), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 4/110 (3%)

Query: 219 WYKFLNYFYTED-PTV--VQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKI 275
           WY+FL+       P      VL RV  DQL+++PI +  ++  +  +ME G  E  +I++
Sbjct: 69  WYRFLSTVRLGRLPQAHWANVLARVACDQLIFAPIGVPLYYT-AMALMEGGSLEDVRIRL 127

Query: 276 RNIYITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
              + +TL  N++VWP  Q  NF +VP   ++   + + + WN +LS  N
Sbjct: 128 SEKWWSTLLANWIVWPAFQLCNFSLVPVQHRLLTVNVLSIFWNTYLSYSN 177

>KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomyces
           cerevisiae YLR251w, hypothetical start
          Length = 195

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

Query: 219 WYKFLNYFYTEDPTV--VQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIR 276
           WYKFLN      P         RV  DQL+++P+ +  ++   + I+E       + KI 
Sbjct: 70  WYKFLNQKVIVKPGKHWTNTAARVGCDQLLFAPVGIPMYYGVMS-ILEGKSLVDAKKKIE 128

Query: 277 NIYITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           + +  TL  N+ VWP  Q INF +VP H ++   + + + WN FLS +N
Sbjct: 129 DNWWPTLVTNWYVWPAFQLINFSLVPVHHRLFSVNIISIFWNAFLSFKN 177

>YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mpv17
           and PMP22 family, which are peroxisomal proteins, has
           low similarity to mouse Mpv17, which functions in
           peroxisomal reactive oxygen metabolism and is associated
           with glomerulosclerosis and inner ear defects [594 bp,
           197 aa]
          Length = 197

 Score = 58.5 bits (140), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 213 SFFQVPWYKFLN--YFYTEDPTV--VQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDA 268
           SF    WYK LN   +    P      ++ RV  DQL ++P+ L  F+     IME    
Sbjct: 64  SFIGDKWYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAPLGL-PFYFTCMSIMEGRSF 122

Query: 269 ESFQIKIRNIYITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           +  ++KI+  +  TL  N+ VWPL Q INF +VP   ++   + V + WN +LS +N
Sbjct: 123 DVAKLKIKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFWNTYLSYKN 179

>Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement
          Length = 200

 Score = 57.8 bits (138), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 59/119 (49%), Gaps = 5/119 (4%)

Query: 211 FLSFFQVPWYKFLNYFYTEDPTVVQ----VLERVLSDQLVYSPISLYCFFMYSNYIMEHG 266
           F SF    WYKFLN         +      + RV  DQL +SPI +  +F     I+E  
Sbjct: 64  FFSFVGDKWYKFLNNKIRLPHRPINHWSNTVCRVGVDQLGFSPIGVPLYFGIMT-ILEGR 122

Query: 267 DAESFQIKIRNIYITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           + +  + +I + +  TL  N+ VWP  Q +NF +VP   ++   + V + WN FLS +N
Sbjct: 123 NIDEARTRISDNWWPTLVTNWAVWPAFQLVNFSLVPLSHRLLAVNVVSIFWNTFLSYKN 181

>CAGL0B03465g complement(343994..344626) highly similar to tr|Q06563
           Saccharomyces cerevisiae YLR251w, hypothetical start
          Length = 210

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 61/116 (52%), Gaps = 4/116 (3%)

Query: 213 SFFQVPWYKFLNYF-YTEDPTV--VQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAE 269
           SF    WY+FL    ++  P      ++ RV  DQL ++P+ L  +F   + +  HG   
Sbjct: 77  SFIGDRWYRFLTKVKFSNKPAKHWSNMVLRVCVDQLGFAPLGLPFYFGCMSLLEGHGLGA 136

Query: 270 SFQIKIRNIYITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
           + + KI+  +  TL  N+ VWPL Q +NF +VP   ++  ++ V + WN FLS  N
Sbjct: 137 ARE-KIKLQWWDTLKTNWCVWPLFQMVNFSLVPLQHRLLAANVVAIFWNTFLSYTN 191

>Scas_639.20
          Length = 208

 Score = 55.8 bits (133), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 6/118 (5%)

Query: 213 SFFQVPWYKFLN-----YFYTEDPTVVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGD 267
           SF    WYK L          +    + +L +V  DQL ++P+ +  F+     IME G 
Sbjct: 74  SFIGDKWYKILQNNVKLPLRFQHNKSLSMLYKVSVDQLAFAPLGV-PFYFSCMTIMEGGT 132

Query: 268 AESFQIKIRNIYITTLGCNYLVWPLVQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRN 325
            +  + KI+  +  TL  N+ VWPL Q +NF  VP   ++   + V + WN +LS  N
Sbjct: 133 MKDVETKIKTQWWRTLVTNWCVWPLFQMVNFTWVPLQHRLLAVNVVAIFWNTYLSYMN 190

>Sklu_2275.4 YLL005C, Contig c2275 4812-7850
          Length = 1012

 Score = 28.9 bits (63), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 28/44 (63%)

Query: 27  EQWKTITLNLIYSLRRFKILKITIIHWSILSTWIVLLLHFTSVY 70
           E++K I ++  + LR  KIL I  +  ++++  I++ +H+TS Y
Sbjct: 149 EEYKQIGMDAFFFLRFLKILGIFFLTLAVINIPILVPIHYTSGY 192

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.138    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,787,506
Number of extensions: 464920
Number of successful extensions: 1662
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1683
Number of HSP's successfully gapped: 27
Length of query: 325
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 223
Effective length of database: 13,065,073
Effective search space: 2913511279
Effective search space used: 2913511279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)