Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0B06303g1203118564140.0
Scas_707.471200119257400.0
Kwal_14.14921197118657160.0
YPR010C (RPA135)1203119257140.0
CAGL0J01848g1202118956390.0
ABR029W1198117854460.0
Scas_70.125923411111e-143
Kwal_26.85531171117510421e-122
YOR207C (RET1)1149114110321e-121
Scas_605.141150114510261e-120
ADL275C1141104410251e-120
CAGL0L02849g1133113210221e-119
KLLA0F01078g1142112210011e-116
Kwal_47.18783122011679971e-115
AFR404C122211729811e-113
YOR151C (RPB2)122411749781e-113
Scas_714.41122411769661e-111
CAGL0L04246g122311809651e-111
KLLA0B05577g122111719381e-107
CAGL0J07942g1244106800.33
YGL084C (GUP1)560144760.91
CAGL0E00847g1825162751.5
Scas_682.171923200732.5
Sklu_2406.818570675.3
CAGL0L04950g80549705.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0B06303g
         (1185 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0B06303g complement(555780..559391) highly similar to sp|P22...  2475   0.0  
Scas_707.47                                                          2215   0.0  
Kwal_14.1492                                                         2206   0.0  
YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA pol...  2205   0.0  
CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharo...  2176   0.0  
ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH] complement...  2102   0.0  
Scas_70.1                                                             432   e-143
Kwal_26.8553                                                          405   e-122
YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polym...   402   e-121
Scas_605.14                                                           399   e-120
ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..22...   399   e-120
CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharo...   398   e-119
KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharom...   390   e-116
Kwal_47.18783                                                         388   e-115
AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH] (1162949..1...   382   e-113
YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polym...   381   e-113
Scas_714.41                                                           376   e-111
CAGL0L04246g complement(493026..496697) highly similar to sp|P08...   376   e-111
KLLA0B05577g complement(501690..505355) highly similar to sp|P08...   365   e-107
CAGL0J07942g 772758..776492 similar to sp|P38717 Saccharomyces c...    35   0.33 
YGL084C (GUP1) [1898] chr7 complement(350617..352299) Protein in...    34   0.91 
CAGL0E00847g <73766..79244 highly similar to sp|P11075 Saccharom...    33   1.5  
Scas_682.17                                                            33   2.5  
Sklu_2406.8 YOR215C, Contig c2406 12868-13425                          30   5.3  
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    32   5.4  

>KLLA0B06303g complement(555780..559391) highly similar to sp|P22138
            Saccharomyces cerevisiae YPR010c RPA135 DNA-directed RNA
            polymerase I, 135 KD subunit, start by similarity
          Length = 1203

 Score = 2475 bits (6414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1185/1185 (100%), Positives = 1185/1185 (100%)

Query: 1    MSSVILPPQAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEG 60
            MSSVILPPQAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEG
Sbjct: 1    MSSVILPPQAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEG 60

Query: 61   PDGGLLNLGAKDIGSKVIFDGKGSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERK 120
            PDGGLLNLGAKDIGSKVIFDGKGSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERK
Sbjct: 61   PDGGLLNLGAKDIGSKVIFDGKGSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERK 120

Query: 121  VFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYEL 180
            VFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYEL
Sbjct: 121  VFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYEL 180

Query: 181  VEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVR 240
            VEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVR
Sbjct: 181  VEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVR 240

Query: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNS 300
            PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNS
Sbjct: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNS 300

Query: 301  FLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLV 360
            FLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLV
Sbjct: 301  FLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLV 360

Query: 361  HLGENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEYL 420
            HLGENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEYL
Sbjct: 361  HLGENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEYL 420

Query: 421  QNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQV 480
            QNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQV
Sbjct: 421  QNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQV 480

Query: 481  SGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGL 540
            SGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGL
Sbjct: 481  SGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGL 540

Query: 541  LNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIGWCSHEQG 600
            LNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIGWCSHEQG
Sbjct: 541  LNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIGWCSHEQG 600

Query: 601  KVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPLDKE 660
            KVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPLDKE
Sbjct: 601  KVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPLDKE 660

Query: 661  DIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQM 720
            DIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQM
Sbjct: 661  DIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQM 720

Query: 721  GKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY 780
            GKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY
Sbjct: 721  GKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY 780

Query: 781  DMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLEKLD 840
            DMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLEKLD
Sbjct: 781  DMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLEKLD 840

Query: 841  DDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQELQAI 900
            DDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQELQAI
Sbjct: 841  DDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQELQAI 900

Query: 901  TIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIG 960
            TIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIG
Sbjct: 901  TIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIG 960

Query: 961  MFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEE 1020
            MFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEE
Sbjct: 961  MFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEE 1020

Query: 1021 LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG 1080
            LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG
Sbjct: 1021 LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG 1080

Query: 1081 HGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFDEAKRL 1140
            HGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFDEAKRL
Sbjct: 1081 HGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFDEAKRL 1140

Query: 1141 ITKYESGSEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1185
            ITKYESGSEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL
Sbjct: 1141 ITKYESGSEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1185

>Scas_707.47
          Length = 1200

 Score = 2215 bits (5740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1043/1192 (87%), Positives = 1121/1192 (94%), Gaps = 16/1192 (1%)

Query: 1    MSSVILPPQAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEG 60
            MS VI PP        RTA FRTLERESRFINPPKDKSAYP L +AV+PH+GSFNALTEG
Sbjct: 1    MSKVIKPPSNA-----RTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEG 55

Query: 61   PDGGLLNLGAKDIGSKVIFDGK------GSDTNPNYLGNKLSLSIEQVSISKPTSNDGVS 114
            PDGGLLN G KDIG KVIFDGK      G D+   YLGNKLS+S+EQVSI+KPTSNDGVS
Sbjct: 56   PDGGLLNQGVKDIGEKVIFDGKTGAVQTGKDS---YLGNKLSISVEQVSIAKPTSNDGVS 112

Query: 115  SAVERKVFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNK 174
            SAVERKVFPSESRQRL SY+GK++LKLKWSVNDGEETFTEVRDCGGLP+MLQSNRCHLNK
Sbjct: 113  SAVERKVFPSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNK 172

Query: 175  MSPYELVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGI 234
            +SPYELV+H+EESDE GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF NRGA+Y+Q+GI
Sbjct: 173  LSPYELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGI 232

Query: 235  QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVG 294
            Q+RSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYL+PVVMIL+ALCDT+DREIFD ++G
Sbjct: 233  QLRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIG 292

Query: 295  GDTSNSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELL 354
             D  +SFLTDRLELLLRGFKKRYPTLQNR Q LQ+LGDKFRVVFQASPD +D +VGQE+L
Sbjct: 293  SDLHDSFLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVL 352

Query: 355  NRIVLVHLGE-NNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVK 413
            +RIVLVHLG+ NN+DKF MLLFMIRKLYSLVAGECSPDNPDA QHQE+LLGGFLYGMI+K
Sbjct: 353  DRIVLVHLGKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIK 412

Query: 414  EKIEEYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQS 473
            EKI+EYLQNI  QI+TD NRGLAINFKD+KYM++VLMRVNENIGSKLQYFLSTGNLVSQS
Sbjct: 413  EKIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQS 472

Query: 474  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTP 533
            GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTP
Sbjct: 473  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTP 532

Query: 534  DGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIG 593
            DGSPCGLLNH +HKCKIST+QSDVS+IP +LY LGV+PA+H IAAGPS CCVQ+DGKIIG
Sbjct: 533  DGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIG 592

Query: 594  WCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVR 653
            W SHEQGK++ADTLRFWKVEGK PGLP+DLE+GYVPP+T GQYPGL++FGGHSRMMRPVR
Sbjct: 593  WVSHEQGKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVR 652

Query: 654  YLPLDKEDIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPR 713
            YLPLDKEDIVGPFEQVYMN+AVTP+EIENNVH+HVEF+PTNILSILANLTPFSDFNQSPR
Sbjct: 653  YLPLDKEDIVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPR 712

Query: 714  NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVA 773
            NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNGTNAVVA
Sbjct: 713  NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVA 772

Query: 774  VISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPK 833
            VISYTGYDMDDAMIINKSADERGFGYGTMYKVEKV+LS+NRSRGDPITQHFGFG DEWPK
Sbjct: 773  VISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPK 832

Query: 834  EWLEKLDDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSK 893
            EWL+KLDDDGLP IGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDES+K
Sbjct: 833  EWLDKLDDDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNK 892

Query: 894  FQELQAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAF 953
            FQELQ ++IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPDVIINPHAF
Sbjct: 893  FQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAF 952

Query: 954  PSRMTIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMY 1013
            PSRMTIGMFVESLAGK+GALHG+AQD+TPW FNE DTPADYFGDQL KAGYNYHGNEPMY
Sbjct: 953  PSRMTIGMFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMY 1012

Query: 1014 SGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM 1073
            SGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM
Sbjct: 1013 SGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM 1072

Query: 1074 ERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALK 1133
            ERDALIGHGTSFLLQDRLLNCSDYTQT+VCR+CG+ILTTQ SVP+IGS+STV CRRCA++
Sbjct: 1073 ERDALIGHGTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVR 1132

Query: 1134 FDEAKRLITKYESGSEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1185
            FDEAK ++ K E  S  V I DSEIWEDGQGNKFVGG +TTTVAIPFVLKYL
Sbjct: 1133 FDEAKSMLAKDEETSN-VFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYL 1183

>Kwal_14.1492
          Length = 1197

 Score = 2206 bits (5716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1023/1186 (86%), Positives = 1120/1186 (94%), Gaps = 8/1186 (0%)

Query: 1    MSSVI-LPPQAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTE 59
            MS V+ LP  A      RTA FRT+ERE+RF+NPPKDKSA+P L +AV+PHIGSFNALTE
Sbjct: 1    MSKVVKLPANA------RTAHFRTVERENRFVNPPKDKSAFPLLREAVEPHIGSFNALTE 54

Query: 60   GPDGGLLNLGAKDIGSKVIFDGKGSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVER 119
            GP+GGLLN   KDIG K++FDG+ S+ N NYLGNKL+LS+EQVSISKP SNDGV+SAVER
Sbjct: 55   GPEGGLLNQAVKDIGGKIVFDGRSSEENSNYLGNKLTLSVEQVSISKPVSNDGVTSAVER 114

Query: 120  KVFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYE 179
            K++P+ESRQRL+SYRGK+LLKLKWSVNDGEE+FTE++DCGGLP+MLQSNRCHLN +SP E
Sbjct: 115  KIYPAESRQRLSSYRGKLLLKLKWSVNDGEESFTEIKDCGGLPVMLQSNRCHLNNLSPNE 174

Query: 180  LVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV 239
            LV+++EESDE GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF+NRGASYSQYGIQIRSV
Sbjct: 175  LVKNKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFSNRGASYSQYGIQIRSV 234

Query: 240  RPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSN 299
            RPDQTSQTNVLHYLNDG+VTFRFSWRKNEYLIPVVMIL+ALC+ NDREIFD +VG DTSN
Sbjct: 235  RPDQTSQTNVLHYLNDGEVTFRFSWRKNEYLIPVVMILKALCELNDREIFDGIVGSDTSN 294

Query: 300  SFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVL 359
            SFLTDRLELLLRG KK+Y  LQNR+Q LQYLGDKFRVV QASPD TD QVG+ELL+RIVL
Sbjct: 295  SFLTDRLELLLRGHKKKYGQLQNRRQVLQYLGDKFRVVLQASPDATDFQVGEELLSRIVL 354

Query: 360  VHLGENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEY 419
            VHLG NN+DK  MLLFMIRKLYSLVAGEC+PDNPDA QHQE+LLGGFLYGMI+KEKIEEY
Sbjct: 355  VHLGGNNEDKSRMLLFMIRKLYSLVAGECAPDNPDATQHQEVLLGGFLYGMIIKEKIEEY 414

Query: 420  LQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQ 479
            LQNIRLQIQ+D+NRGLA+NFK++KYMN+VLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQ
Sbjct: 415  LQNIRLQIQSDVNRGLAVNFKERKYMNRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQ 474

Query: 480  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCG 539
            VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTPDGSPCG
Sbjct: 475  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 534

Query: 540  LLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIGWCSHEQ 599
            LLNH +HKCKIST QSDVS+IP++LYSLGV PA+H +AAGP+ CCVQLDGKI+GWCSHEQ
Sbjct: 535  LLNHFAHKCKISTTQSDVSRIPALLYSLGVAPASHTVAAGPTACCVQLDGKIVGWCSHEQ 594

Query: 600  GKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPLDK 659
            GK++ADTLRFWKVEG+T GLP+DLE+GYVPP++ GQYPGL+LFGGHSRMMRPV+YLPL K
Sbjct: 595  GKIIADTLRFWKVEGETAGLPLDLEIGYVPPSSRGQYPGLYLFGGHSRMMRPVKYLPLGK 654

Query: 660  EDIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQ 719
            EDIVGPFEQVYMNIAVTP+EI+NN+H+HVEF+PTNILSILANLTPFSDFNQSPRNMYQCQ
Sbjct: 655  EDIVGPFEQVYMNIAVTPQEIQNNIHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 714

Query: 720  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 779
            MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNG NAVVAVISYTG
Sbjct: 715  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGMNAVVAVISYTG 774

Query: 780  YDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLEKL 839
            YDMDDAMIINKSADERGFGYGTMYKVEK++LSMNRSRGDPITQHFGFG DEWPK WLEKL
Sbjct: 775  YDMDDAMIINKSADERGFGYGTMYKVEKIDLSMNRSRGDPITQHFGFGDDEWPKGWLEKL 834

Query: 840  DDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQELQA 899
            DDDGLP+IGTYVEEGDPICA+FDDTLNKTKIKTYHSSEPAYIEEV LIGDESSKFQELQ 
Sbjct: 835  DDDGLPIIGTYVEEGDPICAFFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESSKFQELQT 894

Query: 900  ITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTI 959
            I+IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSE+G+QPD+IINPHAFPSRMTI
Sbjct: 895  ISIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSESGMQPDIIINPHAFPSRMTI 954

Query: 960  GMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGE 1019
            GMFVESLAGKAGALHG+A D+TPWTF+E DTPA+YFGDQL  AGYNYHGNEPMYSGATGE
Sbjct: 955  GMFVESLAGKAGALHGMAHDATPWTFSEKDTPANYFGDQLLSAGYNYHGNEPMYSGATGE 1014

Query: 1020 ELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1079
            ELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI
Sbjct: 1015 ELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1074

Query: 1080 GHGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFDEAKR 1139
            GHGTSFLLQDRLLNCSDYTQ+AVCR+CG++LTT  SVP+IGS++TVRCRRCA+KFDEAK+
Sbjct: 1075 GHGTSFLLQDRLLNCSDYTQSAVCRECGSLLTTHYSVPRIGSLATVRCRRCAVKFDEAKK 1134

Query: 1140 LITKYESGSEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1185
            ++ KY+ G + + I DS IWEDGQGNKFVGGG TTTVAIPFVLKYL
Sbjct: 1135 IVAKYQ-GEDQIFIDDSHIWEDGQGNKFVGGGQTTTVAIPFVLKYL 1179

>YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA
            polymerase I second largest subunit [3612 bp, 1203 aa]
          Length = 1203

 Score = 2205 bits (5714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1040/1192 (87%), Positives = 1121/1192 (94%), Gaps = 14/1192 (1%)

Query: 1    MSSVILPP-QAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTE 59
            MS VI PP QA      RTA FRTLERESRFINPPKDKSA+P L +AVQPHIGSFNALTE
Sbjct: 1    MSKVIKPPGQA------RTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTE 54

Query: 60   GPDGGLLNLGAKDIGSKVIFDGKGSDT-----NPNYLGNKLSLSIEQVSISKPTSNDGVS 114
            GPDGGLLNLG KDIG KVIFDGK  ++     N  YLGNKLS+S+EQVSI+KP SNDGVS
Sbjct: 55   GPDGGLLNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVS 114

Query: 115  SAVERKVFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNK 174
            SAVERKV+PSESRQRLTSYRGK+LLKLKWSVN+GEE   EVRDCGGLP+MLQSNRCHLNK
Sbjct: 115  SAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNK 174

Query: 175  MSPYELVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGI 234
            MSPYELV+H+EESDE GGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYS YGI
Sbjct: 175  MSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGI 234

Query: 235  QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVG 294
            QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYL+PVVMIL+ALC T+DREIFD ++G
Sbjct: 235  QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIG 294

Query: 295  GDTSNSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELL 354
             D  +SFLTDRLELLLRGFKKRYP LQNR Q LQYLGDKFRVVFQASPD +DL+VGQE+L
Sbjct: 295  NDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVL 354

Query: 355  NRIVLVHLGEN-NKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVK 413
            +RIVLVHLG++ ++DKF MLLFMIRKLYSLVAGECSPDNPDA QHQE+LLGGFLYGMI+K
Sbjct: 355  DRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILK 414

Query: 414  EKIEEYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQS 473
            EKI+EYLQNI  Q++ DINRG+AINFKD++YM++VLMRVNENIGSK+QYFLSTGNLVSQS
Sbjct: 415  EKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQS 474

Query: 474  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTP 533
            GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTP
Sbjct: 475  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTP 534

Query: 534  DGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIG 593
            DGSPCGLLNH +HKC+IST+QSDVS+IPSILYSLGV PA+H  AAGPS+CCVQ+DGKIIG
Sbjct: 535  DGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIG 594

Query: 594  WCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVR 653
            W SHEQGK++ADTLR+WKVEGKTPGLP+DLE+GYVPP+T GQYPGL+LFGGHSRM+RPVR
Sbjct: 595  WVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVR 654

Query: 654  YLPLDKEDIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPR 713
            YLPLDKEDIVGPFEQVYMNIAVTP+EI+NNVH+HVEF+PTNILSILANLTPFSDFNQSPR
Sbjct: 655  YLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPR 714

Query: 714  NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVA 773
            NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNG NAVVA
Sbjct: 715  NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVA 774

Query: 774  VISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPK 833
            VISYTGYDMDDAMIINKSADERGFGYGTMYK EKV+L++NR+RGDPITQHFGFG DEWPK
Sbjct: 775  VISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPK 834

Query: 834  EWLEKLDDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSK 893
            EWLEKLD+DGLP IGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDES+K
Sbjct: 835  EWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNK 894

Query: 894  FQELQAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAF 953
            FQELQ ++IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPD+IINPHAF
Sbjct: 895  FQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAF 954

Query: 954  PSRMTIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMY 1013
            PSRMTIGMFVESLAGKAGALHGIAQDSTPW FNE DTPADYFG+QLAKAGYNYHGNEPMY
Sbjct: 955  PSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMY 1014

Query: 1014 SGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM 1073
            SGATGEELRADIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM
Sbjct: 1015 SGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM 1074

Query: 1074 ERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALK 1133
            ERDALIGHGTSFLLQDRLLN SDYTQ +VCR+CG+ILTTQ SVP+IGSISTV CRRC+++
Sbjct: 1075 ERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMR 1134

Query: 1134 FDEAKRLITKYESGSEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1185
            F++AK+L+TK E G E + I DS+IWEDGQGNKFVGG  TTTVAIPFVLKYL
Sbjct: 1135 FEDAKKLLTKSEDG-EKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYL 1185

>CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharomyces
            cerevisiae YPR010c RPA135, start by similarity
          Length = 1202

 Score = 2176 bits (5639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1021/1189 (85%), Positives = 1109/1189 (93%), Gaps = 9/1189 (0%)

Query: 1    MSSVILPPQAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEG 60
            MS VI PP        RTA FRTLERE+RF NPPKDKSAYP L +AVQPH+GSFNALTEG
Sbjct: 1    MSKVIKPPSNA-----RTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEG 55

Query: 61   PDGGLLNLGAKDIGSKVIFDGK--GSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVE 118
            PDGGLL    +DIG KVIFDGK  GSD   +YLGNKLS+S+EQVSI+KPT+NDGV  A E
Sbjct: 56   PDGGLLQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKPTANDGVMGAAE 115

Query: 119  RKVFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPY 178
            R V+PSE+RQRLTSYRGKILLKLKWSVNDGE  F+EVRDCGGLPIMLQSNRCHLNKMSP+
Sbjct: 116  RPVYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPH 175

Query: 179  ELVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRS 238
            ELV+H+EESDE GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRS
Sbjct: 176  ELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRS 235

Query: 239  VRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTS 298
            VRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMI++AL DT+DREIFD ++G +T+
Sbjct: 236  VRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTN 295

Query: 299  NSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIV 358
            NSFLTDRLELLLRGFKKRYP L+NR Q LQYLGDKFR+VFQASPD +D +VGQE+LNRIV
Sbjct: 296  NSFLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIV 355

Query: 359  LVHLGEN-NKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIE 417
            LVHLG N N DKF MLLFM+RKLYSLVAGEC PDNPDA QHQE+LLGGFLYGMI+KEKI+
Sbjct: 356  LVHLGSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKID 415

Query: 418  EYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDL 477
            EYLQ I  Q++TDINRG+AINF ++KYM++VLMRVN+NIGSK+QYFLSTGNLVSQSGLDL
Sbjct: 416  EYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDL 475

Query: 478  QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSP 537
            QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTPDGSP
Sbjct: 476  QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSP 535

Query: 538  CGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIGWCSH 597
            CGLLNH +HKC+IST QSDVSK+P +LYSLGVTPA+H  AAGPS+CCVQLDGKIIGW SH
Sbjct: 536  CGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSH 595

Query: 598  EQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPL 657
            EQG+V+ADTLRFWKVEG+TPGLP DLE+GYVPP++ GQYPGL++FGGHSRMMRPVRYLPL
Sbjct: 596  EQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPL 655

Query: 658  DKEDIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQ 717
            DKEDIVGPFEQVYMNIAVTP+EI+NN+H+HVEFSPTNILSILANLTPFSDFNQSPRNMYQ
Sbjct: 656  DKEDIVGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQ 715

Query: 718  CQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISY 777
            CQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISY
Sbjct: 716  CQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISY 775

Query: 778  TGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLE 837
            TGYDMDDAMIINKSADERGFGYGTMYKVEKV+LS+NRSRGDP+TQHFGFGTDEWPKEWL+
Sbjct: 776  TGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLD 835

Query: 838  KLDDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQEL 897
            KLD+DGLP IGTYVEEGDPICAYFDDT+ KTKIKTYHSSEPAYIEEV LIGDES+KFQEL
Sbjct: 836  KLDEDGLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQEL 895

Query: 898  QAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRM 957
            Q ++IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRM
Sbjct: 896  QTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRM 955

Query: 958  TIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGAT 1017
            TIGMFVESLAGKAGALHGIAQDSTPW FNE DTPADYFG+QL KAGYNYHGNEPMYSGAT
Sbjct: 956  TIGMFVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGAT 1015

Query: 1018 GEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDA 1077
            GEELR DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDA
Sbjct: 1016 GEELRCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDA 1075

Query: 1078 LIGHGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFDEA 1137
            LIGHGTSFLLQDRLLN SDYTQ A+CR+CG+ILTTQ +VP+IG++S+V CRRCA+KF++A
Sbjct: 1076 LIGHGTSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDA 1135

Query: 1138 KRLITKYESGS-EPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1185
            K+ + ++E  + E + I DS+IWEDGQG KFVGG +TTTVAIPFVLKYL
Sbjct: 1136 KKTLFEHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYL 1184

>ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH]
            complement(450645..454241) [3597 bp, 1198 aa]
          Length = 1198

 Score = 2102 bits (5446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 997/1178 (84%), Positives = 1085/1178 (92%), Gaps = 15/1178 (1%)

Query: 16   NRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEGPDGGLLNLGAKDIGS 75
            NRTA FRTLERE+RF++PPKDKSAYP L +AV+PH+GSFNALTEGP GGLLNLGA+DIG+
Sbjct: 10   NRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLLNLGARDIGA 69

Query: 76   KVIFDGKGSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRG 135
            KV+FDGK SD NPNYLGNKL+LS+ QVS++KP SNDGV++A ER VFP+E+R+RLT+YRG
Sbjct: 70   KVVFDGKASDENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAEARKRLTTYRG 129

Query: 136  KILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYELVEHREESDEFGGYFI 195
            K+LLKL WSVNDGEETF+EVRDCG LP+MLQSNRCHL+KMSP ELVEH+EESDE GGYFI
Sbjct: 130  KLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKEESDELGGYFI 189

Query: 196  VNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQTSQTNVLHYLND 255
            VNGIEKLIRMLIVQRRNHPMAIIRPSFANRG SYS YG+QIR VRPDQTSQTNVLHYLND
Sbjct: 190  VNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTSQTNVLHYLND 249

Query: 256  GQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNSFLTDRLELLLRGFKK 315
            GQVTFRFSWRKNEYL+PVV+IL+AL D +DREIFD +VG DTSNSFLTDRLELLLRGFKK
Sbjct: 250  GQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDRLELLLRGFKK 309

Query: 316  RYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVHLGENNKDKFNMLLF 375
            R+P L NR+Q LQYLGDKFRVV QASPDM+D  VGQELL RIVLVHLG+ N DK NML+F
Sbjct: 310  RFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGDENTDKSNMLMF 369

Query: 376  MIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEYLQNIRLQIQTDINRGL 435
            MIRKLYSLVAGEC PDNPDA QHQE+LLGGFLYGMIVKEKIEEYLQNI+LQIQ D+NRG+
Sbjct: 370  MIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIKLQIQADVNRGM 429

Query: 436  AINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRF 495
             ++FKD+KYM +VL R+NENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRF
Sbjct: 430  PVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRF 489

Query: 496  ISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGLLNHLSHKCKISTEQS 555
            ISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTPDGSPCGLLNH +HKCKIST QS
Sbjct: 490  ISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCKISTTQS 549

Query: 556  DVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIGWCSHEQGKVVADTLRFWKVEGK 615
            DVSKIP++LYSLGV+PAAHV AAGPS+CCVQLDGKI+GWCSHEQG++VADTLR+WKVEGK
Sbjct: 550  DVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVADTLRYWKVEGK 609

Query: 616  TPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAV 675
            T GLP+DLE+GYVP +  GQYPGL+LFGGHSRMMRPVRYLPLDK+DIVGPFEQVYM+IAV
Sbjct: 610  TDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVGPFEQVYMDIAV 669

Query: 676  TPEE-------IENNVHSHVEFSPTNILSILANLTPF-SDFNQSPRNMYQCQMGKQTMGT 727
            TPEE       +  N H  +      ILSILANLTPF       P+     QMGKQTMGT
Sbjct: 670  TPEENPLITSILMLNFHQQI------ILSILANLTPFLLTLTNLPKICTNYQMGKQTMGT 723

Query: 728  PGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMI 787
            PGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMI
Sbjct: 724  PGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMI 783

Query: 788  INKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLEKLDDDGLPLI 847
            INKSADERGF YGT+YK EK++LS++R RGDP+TQHFGFGTDEWPKEWLEKLD+DGLP+I
Sbjct: 784  INKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLDEDGLPII 843

Query: 848  GTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIR 907
            G+YVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDES+KFQELQ ITIKYRIR
Sbjct: 844  GSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYITIKYRIR 903

Query: 908  RTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLA 967
            R PQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPDVIINPHAFPSRMTIGMFVESLA
Sbjct: 904  RVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLA 963

Query: 968  GKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYI 1027
            GKAGALHGIAQD+TPWTF+E DTPADYFGDQL KAGYNYHGNEPMYSGATGEELRADIYI
Sbjct: 964  GKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRADIYI 1023

Query: 1028 GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLL 1087
            GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLL
Sbjct: 1024 GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLL 1083

Query: 1088 QDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFDEAKRLITKYESG 1147
            QDRLLN SDYTQ+AVCR+CG+ILTTQSSVPKIGS+ T+RCRRCA+ FDEAK++IT+ +S 
Sbjct: 1084 QDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKIITQQDS- 1142

Query: 1148 SEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1185
             + + I DS IWEDGQGNKFVGGGNTTTVAIPFVLKYL
Sbjct: 1143 EDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFVLKYL 1180

>Scas_70.1
          Length = 259

 Score =  432 bits (1111), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 210/234 (89%), Positives = 221/234 (94%)

Query: 296 DTSNSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLN 355
           DTSNSFLTDRLELLLRGFKK+YP LQNR+Q LQYLGDKFRVVFQASPDMTD QVG+E+L 
Sbjct: 12  DTSNSFLTDRLELLLRGFKKKYPQLQNRRQVLQYLGDKFRVVFQASPDMTDYQVGEEVLR 71

Query: 356 RIVLVHLGENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEK 415
           RIVLVHLGE+ KDKF+MLLFMIRKLYSLVAGECSPDNPDA QHQE+LLGGFLYGMIVKEK
Sbjct: 72  RIVLVHLGEDGKDKFHMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIVKEK 131

Query: 416 IEEYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGL 475
           IEEYLQNIRLQIQ D+NRGLA+NFKD+KYM +VLMRVNENIGSKLQYFLSTGNLVSQSGL
Sbjct: 132 IEEYLQNIRLQIQADVNRGLAVNFKDRKYMTRVLMRVNENIGSKLQYFLSTGNLVSQSGL 191

Query: 476 DLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCP 529
           DLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPE  G   P
Sbjct: 192 DLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPEILGVPMP 245

>Kwal_26.8553
          Length = 1171

 Score =  405 bits (1042), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 339/1175 (28%), Positives = 547/1175 (46%), Gaps = 161/1175 (13%)

Query: 8    PQAPVERLNRTASFRTL-------ERESRFINPPKDK----SAYPFLADAVQPHIGSFNA 56
            P  P + + +  +F  L       ++ +  IN  +DK     A+  +   V+ H+ SFN 
Sbjct: 33   PDTPHDHIEKDTAFEQLLKPIYKGKKLTDEINTAEDKWHLLPAFLKVKGLVKQHLDSFNY 92

Query: 57   LTEGPDGGLLNLGAKDIGSKVIFDGKGSDTNPNYLGNKLSLSIEQVSISKPTSNDGVSSA 116
              +      ++L      +++I     SD +P +    + + +   S          SS+
Sbjct: 93   FVD------VDLKKIIKANQLIL----SDVDPEFYLKYVDIRVGHRS---------TSSS 133

Query: 117  VERKVFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMS 176
             +  V P E R R  +Y   I + ++++         +V + G +PIML+SN+C LN  S
Sbjct: 134  KDYIVPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHRDV-EIGRMPIMLRSNKCILNGAS 192

Query: 177  PYELVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQI 236
              ++    E   + GGYFIVNG EK+I   +VQ +     II  +   +    +     +
Sbjct: 193  EKDMARINECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKAIVQAS----V 245

Query: 237  RSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGD 296
             S   ++ S+T V+    +G++  + +    E  +P+V++L+A    +D EI   V G D
Sbjct: 246  TSSTHERKSKTYVI--TKNGKIYLKHNSIAEE--VPIVLVLKASGIVSDLEIMQLVCGND 301

Query: 297  TSNSFLTDRLELLLRGFKKRYPT-LQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLN 355
            +S        ++    F++     +  ++Q L+Y+G K + V +    +T LQ G E + 
Sbjct: 302  SSYQ------DIFAVNFEEVAKMKIYTQQQALEYIGSKVKTVRRQK--LTTLQEGIEAIA 353

Query: 356  RIVLVHL---GENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIV 412
              V+ HL     + ++K   +  M R++   +      D+ D   ++ + L G L  ++ 
Sbjct: 354  TTVIAHLTVEALDFREKALYIAVMTRRVVMAIHNPKMVDDRDYVGNKRLELAGQLMSLL- 412

Query: 413  KEKIEEYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVN---ENIGSKLQYFLSTGNL 469
                E+  +      + +I++ L    +  +Y    L+ +N    NI S L   +STGN 
Sbjct: 413  ---FEDLFKKFNNDFKANIDKVLKKPNRAMEY--DALLSINVHSNNITSGLNRAISTGNW 467

Query: 470  VSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFF 527
             S     +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G  
Sbjct: 468  -SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGML 522

Query: 528  CPVHTPDGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSM-CCVQ 586
            C   TP+G  CGL+ +L+    I+T+  +   I  + Y LGV     V +       CV 
Sbjct: 523  CTSDTPEGEACGLVKNLALMTHITTDDEE-EPIKKLCYLLGVEDITVVDSDSLHFNYCVY 581

Query: 587  LDGKIIGWCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHS 646
            L+G I+G        V     R  +  GK           ++   T+     + +     
Sbjct: 582  LNGTIVGVVRFPTKFV--SQFRNLRRSGKVSE--------FISIYTNSHQKAVHIATDGG 631

Query: 647  RMMRPVRY--------------------LPLDKEDIVGPFEQVYMN------IAVTPEEI 680
            R+ RP+                      L  D    +G  E + +N      IA+   ++
Sbjct: 632  RICRPLIIVTDGKSLVTAQHLRQLLDGQLQFDDFLKLGLVEYLDVNEENDSFIALYERDL 691

Query: 681  ENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKL 740
            E ++ +H+E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R D  L
Sbjct: 692  EPSI-THMEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLL 750

Query: 741  YRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYG 800
            Y +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NK++ +RGFG  
Sbjct: 751  YLMIYPQQPMVKTKTIELIDYDKIPAGQNATVAVMSYSGYDIEDALVLNKASIDRGFGRC 810

Query: 801  TMYKVEKVNLSMNR---------------SRGDPITQHFGFGTDEWPKEWLEKLDDDGLP 845
               +  K+   + R                 G+PI QH   G D             GL 
Sbjct: 811  ETRR--KLTTVLKRYPNHTQDMVGGMRVDENGEPIWQHKALGPD-------------GLG 855

Query: 846  LIGTYVEEGD-------PICAYFDDTLNKTKIK------TYHSSEPAYIEEVKLIGDESS 892
             +G  VE G        P  A  D  L +T+ +       Y + EP++I++V +   E+ 
Sbjct: 856  EVGMKVESGQIYVNKSVPTNAS-DSVLTQTQAQYRETPVVYRAPEPSHIDQVMMSVSEND 914

Query: 893  KFQELQAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHA 952
            +      I +  R  R P++GDKFSSRHGQKGVC       D+PF++ G+ PD+I+NPH 
Sbjct: 915  Q----ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVNQEDLPFNDQGVVPDIIMNPHG 970

Query: 953  FPSRMTIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPM 1012
            FPSRMT+G  +E ++GKAG L+G  +  T +      +  +     L   G+NY G + +
Sbjct: 971  FPSRMTVGKMIELISGKAGVLNGTLEYGTCF----GGSKLEDMSQILMNNGFNYSGKDML 1026

Query: 1013 YSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGE 1072
            YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GE
Sbjct: 1027 YSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGE 1086

Query: 1073 MERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDCG 1107
            MERD +I +G S LL +RL+  SD  +  VC  CG
Sbjct: 1087 MERDCVIAYGASQLLLERLMISSDAFEVDVCDKCG 1121

>YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polymerase
            III, second-largest subunit (C128) [3450 bp, 1149 aa]
          Length = 1149

 Score =  402 bits (1032), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 341/1141 (29%), Positives = 540/1141 (47%), Gaps = 143/1141 (12%)

Query: 31   INPPKDK----SAYPFLADAVQPHIGSFNALTEGPDGGLLNLGAKDIGSKVIFDGKGSDT 86
            IN  +DK     A+  +   V+ H+ SFN   +     ++        +++I     SD 
Sbjct: 38   INTAQDKWHLLPAFLKVKGLVKQHLDSFNYFVDTDLKKIIK------ANQLIL----SDV 87

Query: 87   NPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRGKILLKLKWSVN 146
            +P +      L    + + K +S    SS  +    P E R R  +Y   I + ++++  
Sbjct: 88   DPEFY-----LKYVDIRVGKKSS----SSTKDYLTPPHECRLRDMTYSAPIYVDIEYTRG 138

Query: 147  DGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYELVEHREESDEFGGYFIVNGIEKLIRML 206
                   +V + G +PIML+SN+C L      ++ +  E   + GGYFIVNG EK+I   
Sbjct: 139  RNIIMHKDV-EIGRMPIMLRSNKCILYDADESKMAKLNECPLDPGGYFIVNGTEKVI--- 194

Query: 207  IVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRK 266
            +VQ +     II  +   +G   +     + S   ++ S+T V+    +G++  + +   
Sbjct: 195  LVQEQLSKNRIIVEADEKKGIVQAS----VTSSTHERKSKTYVI--TKNGKIYLKHNSIA 248

Query: 267  NEYLIPVVMILRALCDTNDREIFDHVVGGDTSNSFLTDRLELLLRGFKKRYPTLQNRKQT 326
             E  IP+ ++L+A    +D EI   V G D+S     D   + L    K    +  ++Q 
Sbjct: 249  EE--IPIAIVLKACGILSDLEIMQLVCGNDSS---YQDIFAVNLEESSKL--DIYTQQQA 301

Query: 327  LQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVHL---GENNKDKFNMLLFMIRKLYSL 383
            L+Y+G K + + +    +T LQ G E +   V+ HL     + ++K   +  M R++   
Sbjct: 302  LEYIGAKVKTMRRQK--LTILQEGIEAIATTVIAHLTVEALDFREKALYIAMMTRRVVMA 359

Query: 384  VAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEYLQNIRLQIQTDI---NRGLAINFK 440
            +      D+ D   ++ + L G L  ++ ++  +++  + +L I   +   NR +  +  
Sbjct: 360  MYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFKLSIDKVLKKPNRAMEYD-- 417

Query: 441  DQKYMNKVLMRVN---ENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFIS 497
                    L+ +N    NI S L   +STGN  S     +++ +G T V  ++++   IS
Sbjct: 418  -------ALLSINVHSNNITSGLNRAISTGNW-SLKRFKMER-AGVTHVLSRLSY---IS 465

Query: 498  HFRMVHRGS--FFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGLLNHLSHKCKISTEQS 555
               M+ R S  F    K +  R L P  +G  C   TP+G  CGL+ +L+    I+T+  
Sbjct: 466  ALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDE 525

Query: 556  DVSKIPSILYSLGVTPAAHVIAAGPSM-CCVQLDGKIIGWCSHEQGKVVADTLRFWKVEG 614
            +   I  + Y LGV     + +A   +   V L+G +IG        V     R  +  G
Sbjct: 526  E-EPIKKLCYVLGVEDITLIDSASLHLNYGVYLNGTLIGSIRFPTKFVTQ--FRHLRRTG 582

Query: 615  KTPGL----PVDLEVGYVPPTTSGQY--PGLFLFGGHSRM----MRPVRYLPLDKEDIV- 663
            K            ++     T  G+   P + +  G SR+    +R +    LD +D + 
Sbjct: 583  KVSEFISIYSNSHQMAVHIATDGGRICRPLIIVSDGQSRVKDIHLRKLLDGELDFDDFLK 642

Query: 664  -GPFEQVYMN------IAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMY 716
             G  E + +N      IA+  ++I  ++ +H+E  P  IL  +A L P+   NQSPRN Y
Sbjct: 643  LGLVEYLDVNEENDSYIALYEKDIVPSM-THLEIEPFTILGAVAGLIPYPHHNQSPRNTY 701

Query: 717  QCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVIS 776
            QC MGKQ +G        R D  LY +   Q P+VK    +    D  P G NA VAV+S
Sbjct: 702  QCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQPMVKTKTIELIDYDKLPAGQNATVAVMS 761

Query: 777  YTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNR---------------SRGDPIT 821
            Y+GYD++DA+++NKS+ +RGFG     +  K    + R                 GDPI 
Sbjct: 762  YSGYDIEDALVLNKSSIDRGFGRCETRR--KTTTVLKRYANHTQDIIGGMRVDENGDPIW 819

Query: 822  QHFGFGTDEWPKEWLEKLDDDGLPLIGTYVEEGD-------PICAYFDDTLNKTKIKT-- 872
            QH   G D             GL  +G  V+ G        P  +      N   ++T  
Sbjct: 820  QHQSLGPD-------------GLGEVGMKVQSGQIYINKSVPTNSADAPNPNNVNVQTQY 866

Query: 873  ------YHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHGQKGVC 926
                  Y   EP++I++V +    S    +   I +  R  R P++GDKFSSRHGQKGVC
Sbjct: 867  REAPVIYRGPEPSHIDQVMM----SVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVC 922

Query: 927  SRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWTFN 986
                   DMPF++ GI PD+I+NPH FPSRMT+G  +E ++GKAG L+G  +  T +  +
Sbjct: 923  GIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCFGGS 982

Query: 987  ESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVR 1046
            + +  +    DQ    G+NY G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R
Sbjct: 983  KLEDMSKILVDQ----GFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHAR 1038

Query: 1047 STGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDC 1106
            + GP   LT QP +GR R GG+R+GEMERD +I +G S LL +RL+  SD  +  VC  C
Sbjct: 1039 ARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKC 1098

Query: 1107 G 1107
            G
Sbjct: 1099 G 1099

>Scas_605.14
          Length = 1150

 Score =  399 bits (1026), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 335/1145 (29%), Positives = 533/1145 (46%), Gaps = 153/1145 (13%)

Query: 31   INPPKDK----SAYPFLADAVQPHIGSFNALTEGPDGGLLNLGAKDIGSKVIFDGKGSDT 86
            IN  +DK     A+  +   V+ H+ SFN   +      ++L      ++VI     SD 
Sbjct: 40   INTAEDKWNLLPAFLKVKGLVKQHLDSFNYFVD------VDLKKIIKANQVIL----SDV 89

Query: 87   NPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRGKILLKLKWSVN 146
            +P +    + + + + S          SSA +    P E R R  +Y   I + ++++  
Sbjct: 90   DPEFYLKYVDIRVGKRS---------TSSAKDYLTPPHECRLRDMTYSAPIYVDIEYTRG 140

Query: 147  DGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYELVEHREESDEFGGYFIVNGIEKLIRML 206
                   +V + G +PIML+SN+C L  +   E+ +  E   + GGYFIVNG EK+I   
Sbjct: 141  RNIIMHKDV-ELGRMPIMLRSNKCTLYGIDEKEMAKLNECPLDPGGYFIVNGTEKVI--- 196

Query: 207  IVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRK 266
            +VQ +     II  +   +G   +     + S   ++ S+T V+    + ++  + +   
Sbjct: 197  LVQEQLSKNRIIVEADEKKGIVQAS----VTSSTHERRSKTYVI--TKNDKIYLKHNSIT 250

Query: 267  NEYLIPVVMILRALCDTNDREIFDHVVGGDTS-NSFLTDRLELLLRGFKKRYPTLQNRKQ 325
             E  IP+V++L+A    +D EI   V G D+S        LE   R        +  ++Q
Sbjct: 251  EE--IPIVIVLKACGVVSDLEIMQLVCGNDSSYQDIFAVNLEEASR------LNIYTQQQ 302

Query: 326  TLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVHL---GENNKDKFNMLLFMIRKLYS 382
             L+++G K + + +    ++ LQ G E +   V+ HL     + ++K   +  M R++  
Sbjct: 303  ALEFIGTKVKTMRRQK--LSVLQEGIEAIATTVVAHLTVEALDFREKALYMAMMTRRVVM 360

Query: 383  LVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEYLQNIRLQIQTDINRGLAINFKDQ 442
             +      D+ D   ++ + L G L  ++     E+  +      +  I++ L    +  
Sbjct: 361  AIQNPKMVDDRDYVGNKRLELAGQLISLL----FEDLFKKFNSDFKATIDKVLKKPNRAM 416

Query: 443  KYMNKVLMRVN---ENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHF 499
            +Y    L+ +N    NI S L   +STGN  S     +++ +G T V  ++++   IS  
Sbjct: 417  EY--DALLSINVHSNNITSGLNRAISTGNW-SLKRFKMER-AGVTHVLSRLSY---ISAL 469

Query: 500  RMVHRGS--FFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGLLNHLSHKCKISTEQSDV 557
             M+ R S  F    K +  R L P  +G  C   TP+G  CGL+ +L+    I+T+  + 
Sbjct: 470  GMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEE- 528

Query: 558  SKIPSILYSLGVTPAAHVIAAGPSM-CCVQLDGKIIGWCSHEQGKVVADTLRFWKVEGKT 616
              I  + Y LGV   + + +A   +   V L+G +IG        V     R  +  GK 
Sbjct: 529  EPIKRLCYILGVEDVSLIDSASLHLNFGVYLNGTLIGTTRFPIKFV--SQFRHLRRTGKI 586

Query: 617  PGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPLDKEDI-------------- 662
                      ++    +     + +     R+ RP+  +   K  +              
Sbjct: 587  SE--------FISIYANSHQKAVHIATDGGRICRPLIIVTKGKSHVTADHLRRLLNGELV 638

Query: 663  ------VGPFEQVYMN------IAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQ 710
                  +G  E + +N      IA+  ++IE+   +H+E  P  IL  +A L P+   NQ
Sbjct: 639  FDDFLKLGLVEYLDVNEENDSFIALYEKDIES-ASTHLEIEPFTILGAVAGLIPYPHHNQ 697

Query: 711  SPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNA 770
            SPRN YQC MGKQ +G        R D  LY +   Q P+VK    +    D  P G NA
Sbjct: 698  SPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQNA 757

Query: 771  VVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNR---------------S 815
             VAV+SY+GYD++DA+++NK++ +RGFG     +  K    + R                
Sbjct: 758  TVAVMSYSGYDIEDALVLNKASIDRGFGRCETRR--KTTTVLKRYPNHTQDIIGGMRVDE 815

Query: 816  RGDPITQHFGFGTDEWPKEWLEKLDDDGLPLIGTYVEEGD-------PICAYFDDTLNKT 868
             G+PI QH   G D             GL  +G  VE G        P     D T    
Sbjct: 816  NGEPIWQHKALGAD-------------GLGEVGMKVESGQIYINKSVPTNQSNDMTTQAQ 862

Query: 869  KIK------TYHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHGQ 922
            + +       Y + EP++I++V +    S    +   I +  R  R P++GDKFSSRHGQ
Sbjct: 863  QAQYRETPVIYRAPEPSHIDQVMM----SVSDNDQALIKVLLRQNRRPELGDKFSSRHGQ 918

Query: 923  KGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTP 982
            KGVC       DMPF++ GI PD+I+NPH FPSRMT+G  +E ++GKAG L+G  +  T 
Sbjct: 919  KGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGTC 978

Query: 983  WTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDK 1042
            +  ++ +  +    DQ    G+NY G + +YSG TGE L+A I+ G +YYQ+L+HMV DK
Sbjct: 979  FGGSKLEDMSKILVDQ----GFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDK 1034

Query: 1043 FQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTAV 1102
               R+ GP   LT QP +GR R GG+R+GEMERD +I +G S LL +RL+  SD  +  V
Sbjct: 1035 MHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDV 1094

Query: 1103 CRDCG 1107
            C  CG
Sbjct: 1095 CDKCG 1099

>ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..222530)
            [3426 bp, 1141 aa]
          Length = 1141

 Score =  399 bits (1025), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 315/1044 (30%), Positives = 503/1044 (48%), Gaps = 121/1044 (11%)

Query: 123  PSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYELVE 182
            P E R R  +Y   I + ++++         +V + G +PIML+SN+C LN  S   + +
Sbjct: 110  PHECRLRDMTYSAPIFVDIEYTRGRSIVLHKDV-EIGKMPIMLRSNKCILNGASEEVMAK 168

Query: 183  HREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPD 242
              E   + GGYFIVNG EK+I   +VQ +     II  +   +    +     + S   +
Sbjct: 169  LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKAIVQAS----VTSSTHE 221

Query: 243  QTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNSFL 302
            + S+T V+    + ++  + +    E  +P+V++L+A    +D EI   V G D+S    
Sbjct: 222  RKSKTYVV--TKNDKIYLKHNSIAEE--VPIVIVLKACGIVSDLEIMQLVCGNDSSYQ-- 275

Query: 303  TDRLELLLRGFKKRYP-TLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVH 361
                ++    F++     +  ++Q L+Y+G K + + +    +T LQ G E +   V+ H
Sbjct: 276  ----DIFAINFEEASKMNIYTQQQALEYIGTKVKTIRRQK--LTVLQEGIEAIATTVIAH 329

Query: 362  L---GENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEE 418
            L     + ++K   +  M R++   +      D+ D   ++ + L G L  ++ ++  ++
Sbjct: 330  LTVEALDFREKALYVAMMTRRVIMAIHNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKK 389

Query: 419  YLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVN---ENIGSKLQYFLSTGNLVSQSGL 475
            +  + +  I   + +       ++  M   L+ +N    NI S L   +STGN  S    
Sbjct: 390  FNNDFKASIDKVLKK------PNRAEMYDALLSINVHSNNITSGLNRAISTGNW-SLKRF 442

Query: 476  DLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFFCPVHTP 533
             +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G  C   TP
Sbjct: 443  KMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTP 498

Query: 534  DGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSM-CCVQLDGKII 592
            +G  CGL+ +L+    I+T+  +   I ++ Y LGV     + +A   +   V L+G II
Sbjct: 499  EGEACGLVKNLALMTHITTDDEE-EPIKNLCYLLGVEDITLLDSASIHLNYGVYLNGTII 557

Query: 593  GWCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPV 652
            G        V  +  R  +  GK           ++   T+     + +     R+ RP+
Sbjct: 558  GTTRFPARFV--NQFRLLRRTGKVSE--------FISIYTNSHQKAVHIATDGGRICRPL 607

Query: 653  RY--------------------LPLDKEDIVGPFEQVYMN------IAVTPEEIENNVHS 686
                                  L  D    +G  E + +N      IA+  ++IE    +
Sbjct: 608  IIVRNGKSMVTAGHLRRLLEGELQFDDFLKLGLVEYLDVNEENDSYIALYEKDIEEGT-T 666

Query: 687  HVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTG 746
            H+E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   
Sbjct: 667  HLEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYP 726

Query: 747  QTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVE 806
            Q P+VK+   +    D  P G NA VAV+SY+GYD++DA++INKS+ +RGFG     K  
Sbjct: 727  QQPMVKSKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVINKSSIDRGFGRCETRK-- 784

Query: 807  KVNLSMNR---------------SRGDPITQHFGFGTDEWPKEWLEKLDDDGLPLIG--T 849
            K    + R                 G+PI QH   G D         L + G+ +     
Sbjct: 785  KTTTILKRYPNHTQDIIGGMRVDENGEPIWQHQSLGPD--------GLGEVGMKVTSGQI 836

Query: 850  YVEEGDPICAYFDDTLNKTKIK------TYHSSEPAYIEEVKLIGDESSKFQELQAITIK 903
            Y+ +  P  A  D  LN+ + +       Y + EP++I++V +    S    +   I + 
Sbjct: 837  YINKSIPTNAS-DSVLNQVQSQYREAPIIYRAPEPSHIDQVMM----SVSDNDQALIKVL 891

Query: 904  YRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFV 963
             R  R P++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPSRMT+G  +
Sbjct: 892  LRQNRRPELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGICPDIIMNPHGFPSRMTVGKML 951

Query: 964  ESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRA 1023
            E ++GKAG L+G  +  T +  ++    AD   + L   G+NY G + +Y G TGE L+A
Sbjct: 952  ELVSGKAGVLNGTLEYGTCFGGSQL---AD-MSEILVNNGFNYSGKDMLYFGITGECLQA 1007

Query: 1024 DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGT 1083
             ++ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G 
Sbjct: 1008 YVFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGA 1067

Query: 1084 SFLLQDRLLNCSDYTQTAVCRDCG 1107
            S LL +RL+  SD  +  VC  CG
Sbjct: 1068 SQLLLERLMLSSDAFEVDVCNKCG 1091

>CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, hypothetical start
          Length = 1133

 Score =  398 bits (1022), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 330/1132 (29%), Positives = 539/1132 (47%), Gaps = 129/1132 (11%)

Query: 31   INPPKDK----SAYPFLADAVQPHIGSFNALTEGPDGGLLNLGAKDIGSKVIFDGKGSDT 86
            +N   DK     A+  +   V+ H+ SFN   +      ++L      +++I     SD 
Sbjct: 26   VNTADDKWNLLPAFLKVKGLVKQHLDSFNYFVD------VDLKKIIKANQLIL----SDV 75

Query: 87   NPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRGKILLKLKWSVN 146
            +P +    + + + Q S S            ++ V P E R R  +Y   I + ++++  
Sbjct: 76   DPEFYLKYVDIRVGQRSGSPHK---------DQLVPPHECRLRDMTYSAPIYVDIEYTRG 126

Query: 147  DGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYELVEHREESDEFGGYFIVNGIEKLIRML 206
                    V + G +PIML+SN+C L+      +    E   + GGYFIVNG EK+I   
Sbjct: 127  RNIIMHKNV-EIGRMPIMLRSNKCILHGADEKMMARLSECPLDPGGYFIVNGTEKVI--- 182

Query: 207  IVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRK 266
            +VQ +     II  +   +    +     + S   ++ S+T V+    +G++  + +   
Sbjct: 183  LVQEQLSKNRIIVEADEKKDIVQAS----VTSSTHERKSKTYVV--TKNGKIYLKHNSIA 236

Query: 267  NEYLIPVVMILRALCDTNDREIFDHVVGGDTSNSFLTDRLELLLRGFKKRYPTLQNRKQT 326
             E  +P+V++L+A    +D EI   V G D+S     D   + L    K    +  ++Q 
Sbjct: 237  EE--VPIVIVLKAAGIISDLEIMQLVCGNDSS---YQDIFSVNLEEAAKL--NICTQQQA 289

Query: 327  LQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVHLGENNKDKFNMLLFMIRKLYSLVAG 386
            L+Y+G K + + +    +T LQ G E +   ++ HL     D     L++      +V  
Sbjct: 290  LEYIGAKVKTMRRQK--LTILQEGIEAIATTIIAHLTVEALDFREKALYIATMTRRVVMA 347

Query: 387  ECSP---DNPDAAQHQEILLGGFLYGMIVKEKIEEYLQNIRLQIQTDI---NRGLAINFK 440
              +P   D+ D   ++ + L G L  ++ ++  +++  + +L I   +   NR +  +  
Sbjct: 348  MHNPKMVDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFKLSIDKVLKKPNRAMEYD-- 405

Query: 441  DQKYMNKVLMRVN---ENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFIS 497
                    L+ +N    NI S L   +STGN  S     +++ +G T V  ++++   IS
Sbjct: 406  -------ALLSINVHSNNITSGLNRAISTGNW-SLKRFKMER-AGVTHVLSRLSY---IS 453

Query: 498  HFRMVHRGS--FFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGLLNHLSHKCKISTEQS 555
               M+ R S  F    K +  R L P  +G  C   TP+G  CGL+ +L+    I+T+  
Sbjct: 454  ALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDE 513

Query: 556  DVSKIPSILYSLGVTPAAHVIAAGPSM-CCVQLDGKIIGWCSHEQGKVVADTLRFWKVEG 614
            +   I  + Y LGV P + + +A   +   V L+G +IG        V     RF +  G
Sbjct: 514  E-EPIRKLCYVLGVEPISLLDSASLHLNYGVYLNGTLIGTTKFPSNFV--SRFRFLRRTG 570

Query: 615  KTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVRYLPLDKEDI------------ 662
            K           ++   T+  +  + +     R+ RP+  +   K  +            
Sbjct: 571  KVSE--------FISIYTNDHHNAVHIATDGGRICRPLIIVKDGKSMVEAEHLKRLLSGE 622

Query: 663  --------VGPFEQVYMN------IAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDF 708
                    +G  E + +N      IA+  ++I +++ +H+E  P  +L  +A L P+   
Sbjct: 623  LVFDDFLKLGLVEYLDVNEENDSYIALYEKDITHDI-THLEIEPFTVLGAVAGLIPYPHH 681

Query: 709  NQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGT 768
            NQSPRN YQC MGKQ +G        R D  LY +   Q P+VK    +    D  P G 
Sbjct: 682  NQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQ 741

Query: 769  NAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGT 828
            NA VAV+SY+GYD++DA+++NKS+ +RGFG     +  K    + +          G   
Sbjct: 742  NATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRR--KTTTVLKKYPNHTKDALCGMRV 799

Query: 829  DEWPKE-WL-EKLDDDGLPLIG-------TYVEEGDPICAYFDDTLNKTKIK----TYHS 875
            DE  +  W  E L  DGL  +G        Y+ +  P+ +     +N+ + +     Y +
Sbjct: 800  DENGEAIWQHESLGPDGLGEVGLKIRSGQIYINKSVPVQSSDAMAVNQAQYRETPVIYRA 859

Query: 876  SEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDM 935
             E + I++V +    S+   +   I +  R  R P++GDKFSSRHGQKGVC       DM
Sbjct: 860  PELSIIDQVMM----STSDNDQDLIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVQQEDM 915

Query: 936  PFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYF 995
            PF++ GI PD+I+NPH FPSRMT+G  +E ++GKAG L+G  +  T +  ++ +  +   
Sbjct: 916  PFNDQGICPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGTCFGGSKLEDMSKIL 975

Query: 996  GDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLT 1055
             DQ    G+NY G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT
Sbjct: 976  VDQ----GFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLT 1031

Query: 1056 MQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDCG 1107
             QP +GR R GG+R+GEMERD +I +G S LL +RL+  SD  +  VC +CG
Sbjct: 1032 RQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCSNCG 1083

>KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, 130 KD subunit, hypothetical start
          Length = 1142

 Score =  390 bits (1001), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 324/1122 (28%), Positives = 535/1122 (47%), Gaps = 109/1122 (9%)

Query: 31   INPPKDK----SAYPFLADAVQPHIGSFNALTEGPDGGLLNLGAKDIGSKVIFDGKGSDT 86
            IN  +DK     A+  +   V+ H+ SFN   +      ++L      ++VI     SD 
Sbjct: 35   INTAEDKWNLLPAFLKVKGLVKQHLDSFNYFVD------VDLKKIIKANEVIL----SDV 84

Query: 87   NPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRGKILLKLKWSVN 146
            +P +    + + +      K   N  + +       P E R R  +Y   I + ++++  
Sbjct: 85   DPEFYLKYIDIRVGY----KHNGNKAIMTP------PHECRLRDMTYSTPIFVDIEYTRG 134

Query: 147  DGEETFTEVRDCGGLPIMLQSNRCHLNKMSPYELVEHREESDEFGGYFIVNGIEKLIRML 206
                   +V + G +PIML+SN+C L+  +  ++ +  E   + GGYFIVNG EK+I   
Sbjct: 135  RSIVLHRDV-EIGRMPIMLRSNKCILDGAAENDMAKLNECPLDPGGYFIVNGTEKVI--- 190

Query: 207  IVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRK 266
            +VQ +     II  +   +    +     + S   ++ S+T V+    + ++  + +   
Sbjct: 191  LVQEQLSKNRIIVEADEKKNIVQAS----VTSSTHERKSKTYVV--TKNDKIYLKHNSIA 244

Query: 267  NEYLIPVVMILRALCDTNDREIFDHVVGGDTS-NSFLTDRLELLLRGFKKRYPTLQNRKQ 325
             E  +P+V++L+A    +D EI   V G D+S        LE      +     +  ++Q
Sbjct: 245  EE--VPIVVVLKACGVVSDLEIMQLVCGNDSSYQDIFAVNLE------EAAELKIYTQQQ 296

Query: 326  TLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVHL---GENNKDKFNMLLFMIRKLYS 382
             L+++G K + V +    ++ LQ G E +   V+ HL     + ++K   +  M R++  
Sbjct: 297  ALEFIGTKVKTVRRQK--LSILQEGIEAIATTVIAHLTVEALDFREKALYIAMMTRRVVM 354

Query: 383  LVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEYLQNIRLQIQTDINRGLAINFKDQ 442
             +      D+ D   ++ + L G L  ++ ++  +++  + +  I   + +       ++
Sbjct: 355  AIDNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKFNNDFKANIDKVLKK------PNR 408

Query: 443  KYMNKVLMRVN---ENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHF 499
              M   L+ +N    NI + +   +STGN  S     +++ +G T V  ++++   IS  
Sbjct: 409  AEMYDALLTINVHSNNITTGMNRAISTGNW-SLKRFKMER-AGVTHVLSRLSY---ISAL 463

Query: 500  RMVHRGS--FFAQLKTTTVRKLLPESWGFFCPVHTPDGSPCGLLNHLSHKCKISTEQSDV 557
             M+ R S  F    K +  R L P  +G  C   TP+G  CGL+ +L+    I+T+  + 
Sbjct: 464  GMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPEGEACGLVKNLALMTHITTDDEE- 522

Query: 558  SKIPSILYSLGVTPAAHVIAAGPSM-CCVQLDGKIIGWCSHEQGKVVADTLRFWKVEGKT 616
              I  I Y LGV   + + +A   +   V L+G IIG        V     R  +  G+ 
Sbjct: 523  EPIKRICYLLGVEDISLIDSASIHLNYGVYLNGTIIGTTRFPTKFV--SQFRCLRRTGRA 580

Query: 617  P---GLPVDLEVGYVPPTTSGQY---PGLFLFGGHSRM----MRPVRYLPLDKEDIV--G 664
                 +  +     V   T G     P + +  G S +    +R +    L  +D +  G
Sbjct: 581  SEFISIYTNTHQKAVHIATDGGRICRPLIIVSNGQSSVTADHLRSLLAGKLQFDDFLKLG 640

Query: 665  PFEQVYMN------IAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPRNMYQC 718
              E + +N      IA+  +++  N+ +H+E     +L  +A L P+   NQSPRN YQC
Sbjct: 641  LVEYLDVNEENDSFIALYEKDLSENI-THLEIESFTVLGAVAGLIPYPHHNQSPRNTYQC 699

Query: 719  QMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYT 778
             MGKQ +G        R D  LY +   Q P+VK    +    D  P G NA VAV+SY+
Sbjct: 700  AMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYS 759

Query: 779  GYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPKEWLEK 838
            GYD++DA+++NK++ +RGFG     +     L    +    I        +  P    + 
Sbjct: 760  GYDIEDALVLNKASIDRGFGRCETRRKNTTVLKRYPNHTQDIIGGMRVDENGEPIWQHQA 819

Query: 839  LDDDGLPLIGTYVEEGD-------PICAYFDDTLNKTKIK------TYHSSEPAYIEEVK 885
            L  DGL  +G  VE G        P  A  D  L +T+ +       Y + EP++I++V 
Sbjct: 820  LGPDGLGEVGMKVESGQIYVNKSVPTNAS-DSILTQTQAQYKETPVVYRAPEPSHIDQVM 878

Query: 886  LIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPD 945
            +    S    +   I +  R  R P++GDKFSSRHGQKGVC       D+PF++ G+ PD
Sbjct: 879  M----SVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDLPFNDQGVVPD 934

Query: 946  VIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYN 1005
            +I+NPH FPSRMT+G  +E ++GKAG L+G  +  T +  ++ +  +    D     G+N
Sbjct: 935  IIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCFGGSKLEDMSKILVDN----GFN 990

Query: 1006 YHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRH 1065
            Y G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R 
Sbjct: 991  YSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRD 1050

Query: 1066 GGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDCG 1107
            GG+R+GEMERD +I +G S LL +RL+  SD  +  VC  CG
Sbjct: 1051 GGLRLGEMERDCVIAYGASQLLLERLMLSSDAFEVDVCEKCG 1092

>Kwal_47.18783
          Length = 1220

 Score =  388 bits (997), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 337/1167 (28%), Positives = 514/1167 (44%), Gaps = 172/1167 (14%)

Query: 86   TNPNYLGNKLSLSIEQVSISKP--TSNDGVSSAVERKVFPSESRQRLTSYRGKILLK--- 140
            T  + +  K  +S  ++ ++KP  T +DGVS A+    +P E+R R  +Y   + ++   
Sbjct: 75   TETDNISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFVEIRK 130

Query: 141  ------------LKWSVNDGEETFTEVRDC--GGLPIMLQSNRCHLNKMSPYELVEHREE 186
                        LK+ V D E   ++      G +PIML+S  C L++++  +L + +E 
Sbjct: 131  RTYEAVDIPGRDLKYEVIDEESEMSDENKIFIGRVPIMLRSKYCLLDELTESDLYKLKEC 190

Query: 187  SDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV-----RP 241
              + GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS      R 
Sbjct: 191  PFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRF 245

Query: 242  DQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNSF 301
              T Q  +     +   T + +    +  IP+V+I RAL    D EI +H+         
Sbjct: 246  ISTLQVKLYGREGNTNRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQM 305

Query: 302  LTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVH 361
            L      +  GF      +Q+R+  L ++G +   +         +Q  +++L +  L H
Sbjct: 306  LELLKPCVEEGF-----VIQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFLPH 358

Query: 362  L----GENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIE 417
            +    G  ++  F  L +MI +L          D+ D    + + L G L   + K    
Sbjct: 359  ITQLEGFESRKAF-FLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFK---- 413

Query: 418  EYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDL 477
                 +  ++  DI R +  + ++ K  N  L      I + L+Y L+TGN   Q    +
Sbjct: 414  ----TLFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWGEQKKA-M 468

Query: 478  QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSP 537
               +G + V  +  +   +SH R  +        K    R+L    WG  CP  TP+G  
Sbjct: 469  TSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQA 527

Query: 538  CGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAA-HVIAAGPSMCCVQLDGKIIGWCS 596
            CGL+ +LS    IS   +D   I + L   G+ P   +V    P    V ++G   G   
Sbjct: 528  CGLVKNLSLMSCISV-GTDPLPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHGI-- 584

Query: 597  HEQGKVVADTLRFWKVEGK-TPGLPVDLEVG------------------YVPPTTSGQYP 637
            H     + DT+R  + +G  TP + +  ++                    V    S    
Sbjct: 585  HRNPAKLVDTIRKLRRKGDVTPEVSIVRDIREKELKIFTDAGRVYRPLFIVDENESTGVK 644

Query: 638  GLFLFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMN------------------------I 673
             L L  GH R +    Y     +DI G FE+  +N                        I
Sbjct: 645  ELKLRKGHVRKLMMTEY-----QDIEGGFEEEDINYTWTSLLNEGLVEYIDAEEEETILI 699

Query: 674  AVTPEEIE-----------------------NNVHSHVEFSPTNILSILANLTPFSDFNQ 710
            A+  E+++                       +N  +H E  P+ IL + A++ PF D NQ
Sbjct: 700  AMQHEDLDPSFEADDPEGELDPAKRIKAIHHSNTFTHCEIHPSMILGVAASIIPFPDHNQ 759

Query: 711  SPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNA 770
            SPRN YQ  MGKQ MG        R D     L   Q P+      +       P G NA
Sbjct: 760  SPRNTYQSAMGKQAMGVFLTNYSVRMDTMANILYYPQKPLGTTRSMEYLKFRELPAGQNA 819

Query: 771  VVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVNLSMNRSRGDPI---TQ 822
            +VA+  Y+GY+ +D+MI+N+S+ +RG     F    M + +++ +S+  S   P    T 
Sbjct: 820  IVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFEKPQRTNTL 879

Query: 823  HFGFGTDEWPKEWLEKLDDDGLPLIGTYVEEGD-------PICAYFDDTLNKTKIKT--- 872
                GT        +KLDDDGL   G  V   D       PI    ++   +T   +   
Sbjct: 880  RMKHGT-------YDKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAFHSKRD 932

Query: 873  ----YHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHGQKGVCSR 928
                  S+E   +++V +  ++      L+ + ++ R  + PQIGDKF+SRHGQKG    
Sbjct: 933  ASTPLRSTENGIVDQVLITTNQEG----LKFVKVRVRTTKVPQIGDKFASRHGQKGTIGI 988

Query: 929  KWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWTFNES 988
             +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   D++P+T    
Sbjct: 989  TYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT---- 1044

Query: 989  DTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRST 1048
            D   D     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ 
Sbjct: 1045 DITVDGISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARAR 1104

Query: 1049 GPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDCGA 1108
            GPV  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+  SD  +  +C  CG 
Sbjct: 1105 GPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGVCGL 1164

Query: 1109 ILTTQSSVPKIGSISTVRCRRCALKFD 1135
            +    + V K+   +   CR C  K D
Sbjct: 1165 M----TVVAKLKH-NQFECRGCKNKID 1186

>AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH]
            (1162949..1166617) [3669 bp, 1222 aa]
          Length = 1222

 Score =  382 bits (981), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 338/1172 (28%), Positives = 512/1172 (43%), Gaps = 180/1172 (15%)

Query: 86   TNPNYLGNKLSLSIEQVSISKP--TSNDGVSSAVERKVFPSESRQRLTSYRGKILLK--- 140
            T  + +  K  +S  ++ ++KP  T +DGVS A+    +P E+R R  +Y   + ++   
Sbjct: 75   TEADNISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFVEIKK 130

Query: 141  ------------LKWSVNDGEETFTEVRDC--GGLPIMLQSNRCHLNKMSPYELVEHREE 186
                        LK+ +   E   TE      G +PIML+S  C L+ +S  +L   +E 
Sbjct: 131  RTYEAVDIPGRDLKYEIIQEESEDTEEGKIFIGRVPIMLRSKYCLLDDLSESDLYRLKEC 190

Query: 187  SDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQT-- 244
              + GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS     +  
Sbjct: 191  PFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRF 245

Query: 245  -SQTNVLHYLNDGQV--TFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNSF 301
             S   V  Y  +G    T + +    +  IP+V+I RAL    D EI +H+         
Sbjct: 246  ISTLQVKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDQNDWQM 305

Query: 302  LTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVH 361
            L      +  GF      +Q+R+  L ++G +   +         +Q  +++L +  L H
Sbjct: 306  LEMLKPCVEEGF-----VIQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFLPH 358

Query: 362  L----GENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIE 417
            +    G  ++  F  L +MI +L          D+ D    + + L G L   + K    
Sbjct: 359  ITQLEGFESRKAF-FLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFK---- 413

Query: 418  EYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDL 477
                 +  ++  DI R +  + ++ K  N  L      I + L+Y L+TGN   Q    +
Sbjct: 414  ----TLFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWGEQKKA-M 468

Query: 478  QQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTPDGSP 537
               +G + V  +  +   +SH R  +        K    R+L    WG  CP  TP+G  
Sbjct: 469  SSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQA 527

Query: 538  CGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAA-HVIAAGPSMCCVQLDGKIIGWCS 596
            CGL+ +LS    IS   +D   I + L   G+ P   +V    P    V ++G   G   
Sbjct: 528  CGLVKNLSLMSCISV-GTDPVPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHGI-- 584

Query: 597  HEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRP----- 651
            H     + DT+R  + +G      +  EV  V      +   L +F    R+ RP     
Sbjct: 585  HRNPARLVDTIRKLRRKGD-----ITAEVSIVRDIREKE---LKIFTDAGRVYRPLFVVA 636

Query: 652  -----------------VRYLPLDK-EDIVGPFEQVYMN--------------------- 672
                             +R L L + +DI G FE   +N                     
Sbjct: 637  DTQHADGHKDLKVRKGHIRKLMLTEYQDIEGGFEDEDINYTWTSLLNDGIVEYIDAEEEE 696

Query: 673  ---IAVTPEEIE------------------------NNVHSHVEFSPTNILSILANLTPF 705
               IA+  E+++                        +N  +H E  P+ IL + A++ PF
Sbjct: 697  TILIAMQQEDLDPSVPQTVDPSDELDPARRIKAIHHSNTFTHCEIHPSMILGVAASVIPF 756

Query: 706  SDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFP 765
             D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +       P
Sbjct: 757  PDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELP 816

Query: 766  NGTNAVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVNLSMNRSRGDPI 820
             G NA+VA+  Y+GY+ +D+MI+N+S+ + G     F    M + +++ +S+  S   P 
Sbjct: 817  AGQNAIVAIACYSGYNQEDSMIMNQSSIDSGLFRSLFFRSYMDQEKRIGMSITESFEKPH 876

Query: 821  ---TQHFGFGTDEWPKEWLEKLDDDGLPLIGTYVEEGD-------PICAYFDDTLNKTKI 870
               T     GT        EKLDDDGL   G  V   D       PI    ++   +T  
Sbjct: 877  RTNTLRMKHGT-------YEKLDDDGLIAPGVRVSGDDIIIGKTTPIPPDAEELGQRTAF 929

Query: 871  KT-------YHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHGQK 923
             +         S+E   +++V +  ++      L+ + ++ R  + PQIGDKF+SRHGQK
Sbjct: 930  HSKRDASTPLRSTENGIVDQVLITTNQEG----LKFVKVRVRTTKVPQIGDKFASRHGQK 985

Query: 924  GVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPW 983
            G     +   DMPF+  G+ PD+IINPHA PSRMT+   +E L  K  AL G   D++P+
Sbjct: 986  GTIGITYRREDMPFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPF 1045

Query: 984  TFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKF 1043
            T    D   D     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK 
Sbjct: 1046 T----DITVDGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKI 1101

Query: 1044 QVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTAVC 1103
              R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+  SD  +  +C
Sbjct: 1102 HARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHIC 1161

Query: 1104 RDCGAILTTQSSVPKIGSISTVRCRRCALKFD 1135
              CG +    + V K+   +   CR C  K D
Sbjct: 1162 GICGLM----TVVAKLKH-NQFECRGCKNKID 1188

>YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polymerase
            II, second-largest subunit [3675 bp, 1224 aa]
          Length = 1224

 Score =  381 bits (978), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 333/1174 (28%), Positives = 513/1174 (43%), Gaps = 186/1174 (15%)

Query: 86   TNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRGKILLKLKWSV 145
            T  + +  K  +S  ++ ++KP  N+  S  V   ++P E+R R  +Y   + + +K   
Sbjct: 79   TESDNISRKYEISFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLFVDVKKRT 136

Query: 146  NDG----------EETFTEVRD--------CGGLPIMLQSNRCHLNKMSPYELVEHREES 187
             +           E    E  D         G LPIML+S  C+L++ +  +L + +E  
Sbjct: 137  YEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECP 196

Query: 188  DEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV-----RPD 242
             + GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS      R  
Sbjct: 197  FDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRFI 251

Query: 243  QTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNSFL 302
             T Q  +         T + +    +  IP+V+I RAL    D EI +H+   D ++  +
Sbjct: 252  STLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICY-DVNDWQM 310

Query: 303  TDRLELLLR-GFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVLVH 361
             + L+  +  GF      +Q+R+  L ++G +   +         +Q  +++L +  L H
Sbjct: 311  LEMLKPCVEDGF-----VIQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFLPH 363

Query: 362  L----GENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEKIE 417
            +    G  ++  F  L +MI +L          D+ D    + + L G L   + K   +
Sbjct: 364  ITQLEGFESRKAF-FLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFK 422

Query: 418  EYLQNIRLQIQT------DINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVS 471
            +  ++I   +Q       D N  LAIN K               I S L+Y L+TGN   
Sbjct: 423  KLTKDIFRYMQRTVEEAHDFNMKLAINAK--------------TITSGLKYALATGNWGE 468

Query: 472  QSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVH 531
            Q    +   +G + V  +  +   +SH R  +        K    R+L    WG  CP  
Sbjct: 469  QKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAE 526

Query: 532  TPDGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAA-HVIAAGPSMCCVQLDGK 590
            TP+G  CGL+ +LS    IS   +D   I + L   G+ P   +V    P    V ++G 
Sbjct: 527  TPEGQACGLVKNLSLMSCISV-GTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGV 585

Query: 591  IIGWCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMR 650
              G   H     + +TLR  + +G      ++ EV  +      +   L +F    R+ R
Sbjct: 586  WHG--VHRNPARLMETLRTLRRKGD-----INPEVSMIRDIREKE---LKIFTDAGRVYR 635

Query: 651  PV----------------------RYLPLDKEDIVGPFEQV---------------YMN- 672
            P+                      + +  + +DI G FE V               Y++ 
Sbjct: 636  PLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDA 695

Query: 673  -------IAVTPEEIE-----------------------NNVHSHVEFSPTNILSILANL 702
                   IA+ PE++E                           +H E  P+ IL + A++
Sbjct: 696  EEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASI 755

Query: 703  TPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMD 762
             PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +     
Sbjct: 756  IPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFR 815

Query: 763  NFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQ 822
              P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      ++     +   +  G  IT+
Sbjct: 816  ELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRS---YMDQEKKYGMSITE 872

Query: 823  HFG----FGTDEWPKEWLEKLDDDGLPLIGTYVEEGD-------PICAYFDDTLNKTKIK 871
             F       T        +KLDDDGL   G  V   D       PI    ++   +T   
Sbjct: 873  TFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRT--- 929

Query: 872  TYHS----------SEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHG 921
             YHS          +E   +++V +  ++      L+ + ++ R  + PQIGDKF+SRHG
Sbjct: 930  AYHSKRDASTPLRSTENGIVDQVLVTTNQDG----LKFVKVRVRTTKIPQIGDKFASRHG 985

Query: 922  QKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDST 981
            QKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   D++
Sbjct: 986  QKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDAS 1045

Query: 982  PWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVND 1041
            P+T    D   +     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+D
Sbjct: 1046 PFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDD 1101

Query: 1042 KFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTA 1101
            K   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+  SD  +  
Sbjct: 1102 KIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVH 1161

Query: 1102 VCRDCGAILTTQSSVPKIGSISTVRCRRCALKFD 1135
            +C  CG +    + + K+   +   C+ C  K D
Sbjct: 1162 ICGICGLM----TVIAKLNH-NQFECKGCDNKID 1190

>Scas_714.41
          Length = 1224

 Score =  376 bits (966), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 333/1176 (28%), Positives = 513/1176 (43%), Gaps = 190/1176 (16%)

Query: 86   TNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRGKILLKLKWSV 145
            T  + +  K  +   ++ ++KP  N+  S  V   ++P E+R R  +Y   + + +K   
Sbjct: 79   TETDNVSRKYEIGFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLFVDVKKRT 136

Query: 146  ND-----GEETFTEVRD-------------CGGLPIMLQSNRCHLNKMSPYELVEHREES 187
             +     G E   E+                G LPIML+S  C+L+  +  +L + +E  
Sbjct: 137  YEAVDVPGRELKYELIAEESEEESESGKVFIGRLPIMLRSKNCYLSDATESDLYKLKECP 196

Query: 188  DEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPDQT--- 244
             + GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS     +   
Sbjct: 197  FDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRFI 251

Query: 245  SQTNVLHYLNDGQ----VTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGDTSNS 300
            S   V  Y  +G     +     + K +  IP+V+I RAL    D EI +H+   D ++ 
Sbjct: 252  STLQVKLYGREGSDARTINATLPYIKQD--IPIVIIFRALGIIPDGEILEHICY-DVNDW 308

Query: 301  FLTDRLELLLR-GFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNRIVL 359
             + + L+  +  GF      +Q+R+  L ++G +   +         +Q  +++L +  L
Sbjct: 309  QMLEMLKPCVEDGF-----VIQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFL 361

Query: 360  VHL----GENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVKEK 415
             H+    G  ++  F  L +MI +L          D+ D    + + L G L   + K  
Sbjct: 362  PHITQLEGFESRKAF-FLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLASLFKTL 420

Query: 416  IEEYLQNIRLQIQT------DINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNL 469
              +  ++I   +Q       D N  LAIN K               I S L+Y L+TGN 
Sbjct: 421  FRKLTKDIFRYMQRTVEEAHDFNMKLAINAK--------------TITSGLKYALATGNW 466

Query: 470  VSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCP 529
              Q    +   +G + V  +  +   +SH R  +        K    R+L    WG  CP
Sbjct: 467  GEQKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTNT-PIGRDGKLAKPRQLHNTHWGLVCP 524

Query: 530  VHTPDGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAA-HVIAAGPSMCCVQLD 588
              TP+G  CGL+ +LS    IS   +D   I + L   G+ P   +V    P    V ++
Sbjct: 525  AETPEGQACGLVKNLSLMSCISV-GTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVN 583

Query: 589  GKIIGWCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRM 648
            G   G   H     + DTLR  + +G      ++ EV  +      +   L +F    R+
Sbjct: 584  GVWHG--VHRNPARLMDTLRTLRRKGD-----INPEVSMIRDIREKE---LKIFTDAGRV 633

Query: 649  MRPV----------------------RYLPLDKEDIVGPFEQV---------------YM 671
             RP+                      + +  + +DI G FE                 Y+
Sbjct: 634  YRPLFIVEDDETLGHKELKVRKGHIAKLMATEYQDIEGGFEDAEEYTWTSLLNEGLVEYI 693

Query: 672  N--------IAVTPEEIE-----------------------NNVHSHVEFSPTNILSILA 700
            +        I++ PE++E                           +H E  P+ IL + A
Sbjct: 694  DAEEEETILISMQPEDLEPPMENEEVIDDMDPAKRIRATQHATTFTHCEIHPSMILGVAA 753

Query: 701  NLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYG 760
            ++ PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +   
Sbjct: 754  SIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRSMEYLK 813

Query: 761  MDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPI 820
                P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      ++     +   +  G  I
Sbjct: 814  FRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRS---YMDQEKKYGMSI 870

Query: 821  TQHFG----FGTDEWPKEWLEKLDDDGLPLIGTYVEEGD-------PICAYFDDTLNKTK 869
            T+ F       T        +KLDDDGL   G  V   D       PI    ++   +T 
Sbjct: 871  TETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDIIIGKTTPISPDEEELGQRT- 929

Query: 870  IKTYHS----------SEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSR 919
               YHS          +E   +++V +  ++      L+ + ++ R  + PQIGDKF+SR
Sbjct: 930  --AYHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKVPQIGDKFASR 983

Query: 920  HGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQD 979
            HGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   D
Sbjct: 984  HGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGD 1043

Query: 980  STPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMV 1039
            ++P+T    D   +     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV
Sbjct: 1044 ASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMV 1099

Query: 1040 NDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQ 1099
            +DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+  SD  +
Sbjct: 1100 DDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFR 1159

Query: 1100 TAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFD 1135
              +C +CG +    S + K+   +   C+ C  K D
Sbjct: 1160 VHICGNCGLM----SVIAKLNH-NQFECKGCDNKID 1190

>CAGL0L04246g complement(493026..496697) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, hypothetical start
          Length = 1223

 Score =  376 bits (965), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 336/1180 (28%), Positives = 508/1180 (43%), Gaps = 197/1180 (16%)

Query: 86   TNPNYLGNKLSLSIEQVSISKPTSNDGVSSAVERKVFPSESRQRLTSYRGKILLKLKWSV 145
            T  + +  K  +S  ++ ++KP  N+  S  V   ++P E+R R  +Y   +       V
Sbjct: 77   TEQDNISRKYEISFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLF------V 128

Query: 146  NDGEETFTEV----RD--------------------CGGLPIMLQSNRCHLNKMSPYELV 181
            +  + T+  V    RD                     G LPIML+S  C+L+  +  +L 
Sbjct: 129  DVTKRTYEAVDVPGRDLNYQLIAEESEEDSESGKVFIGRLPIMLRSKNCYLSDATESDLY 188

Query: 182  EHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV-- 239
            + +E   + GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS   
Sbjct: 189  KLKECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALE 243

Query: 240  ---RPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVGGD 296
               R   T Q  +    +    T + +    +  IP+V+I RAL    D EI +H+    
Sbjct: 244  KGSRFISTLQVKLYGRESSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDV 303

Query: 297  TSNSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELLNR 356
                 L      +  GF      +Q+R+  L ++G +   +         +Q  +++L +
Sbjct: 304  NDWQMLEMLKPCVEDGF-----VIQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQK 356

Query: 357  IVLVHL----GENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIV 412
              L H+    G  ++  F  L +MI +L          D+ D    + + L G L   + 
Sbjct: 357  EFLPHITQLEGFESRKAF-FLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLF 415

Query: 413  KEKIEEYLQNIRLQIQ------TDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLST 466
            K    +  ++I   +Q       D N  LAIN K               I S L+Y L+T
Sbjct: 416  KTLFRKLTKDIFRYMQRTVEEANDFNMKLAINAK--------------TITSGLKYALAT 461

Query: 467  GNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF 526
            GN   Q    +   +G + V  +  +   +SH R  +        K    R+L    WG 
Sbjct: 462  GNWGEQKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGL 519

Query: 527  FCPVHTPDGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAA-HVIAAGPSMCCV 585
             CP  TP+G  CGL+ +LS    IS   +D   I + L   G+ P   +V    P    V
Sbjct: 520  VCPAETPEGQACGLVKNLSLMSCISV-GADPMPIITFLSEWGMEPLEDYVPHQSPDATRV 578

Query: 586  QLDGKIIGWCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGH 645
             ++G   G   H     + +TLR  + +G      ++ EV  +      +   L +F   
Sbjct: 579  FVNGVWHG--VHRNPARLMETLRTLRRKGD-----INPEVSMIRDIREQE---LKIFTDA 628

Query: 646  SRMMRPVRYLPLDKE----------------------DIVGPFEQV-------------- 669
             R+ RP+  +  D+E                      DI G FE                
Sbjct: 629  GRVYRPLFIVEDDEELGRKELKVRKGHVAKLMATEYQDIEGGFEDAEDYTWSSLLNEGLV 688

Query: 670  -YMN--------IAVTPEEIE----------NNVH--------------SHVEFSPTNIL 696
             Y++        IA+ PE++E           NV               +H E  P+ IL
Sbjct: 689  EYIDAEEEESILIAMQPEDLEPTAVEQDIPKENVDLAKRIKVTHHATTFTHCEIHPSMIL 748

Query: 697  SILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLY 756
             + A++ PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      
Sbjct: 749  GVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNFRMDTMANILYYPQKPLGTTRAM 808

Query: 757  DDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSR 816
            +       P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      ++     +   +  
Sbjct: 809  EYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRS---YMDQEKKY 865

Query: 817  GDPITQHFG----FGTDEWPKEWLEKLDDDGLPLIGTYVEEGD-------PICAYFDDTL 865
            G  IT+ F       T        +KLD+DGL   G  V   D       PI    ++  
Sbjct: 866  GMSITETFEKPQRTNTLRMKHGTYDKLDEDGLIAPGVRVSGEDIIIGKTTPIAPDEEELG 925

Query: 866  NKTKIKTYHS----------SEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDK 915
             +T    YHS          +E   +++V +  ++      L+ + ++ R  + PQIGDK
Sbjct: 926  QRT---AYHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKVPQIGDK 978

Query: 916  FSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHG 975
            F+SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G
Sbjct: 979  FASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSG 1038

Query: 976  IAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRL 1035
               D++P+T    D   +     L + GY   G E MY+G TG++L A I+ G  YYQRL
Sbjct: 1039 NEGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRL 1094

Query: 1036 RHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCS 1095
            RHMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+  S
Sbjct: 1095 RHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEAS 1154

Query: 1096 DYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALKFD 1135
            D  +  +C  CG +    S + K+   +   C+ C  K D
Sbjct: 1155 DAFRVHICGICGLM----SVIAKLNH-NQFECKGCDNKID 1189

>KLLA0B05577g complement(501690..505355) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, 140 kDa chain, start by similarity
          Length = 1221

 Score =  365 bits (938), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 331/1171 (28%), Positives = 514/1171 (43%), Gaps = 177/1171 (15%)

Query: 86   TNPNYLGNKLSLSIEQVSISKP--TSNDGVSSAVERKVFPSESRQRLTSYRGKILLKLKW 143
            T  + +  K  +S  ++ ++KP  T +DGVS A+    +P E+R R  +Y   + ++++ 
Sbjct: 73   TETDNISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFVEIQ- 127

Query: 144  SVNDGEETFTEV----RD--------------------CGGLPIMLQSNRCHLNKMSPYE 179
                 + T+  +    RD                     G +PIML+S  C L+ ++  +
Sbjct: 128  -----KRTYQAIDIPGRDLKYEIITEESEENEENNKIFIGRVPIMLRSKYCLLDDLTESD 182

Query: 180  LVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSV 239
            L   +E   + GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS 
Sbjct: 183  LYRLKECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSA 237

Query: 240  RPDQT---SQTNVLHYLNDGQV--TFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVG 294
                +   S   V  Y  +G    T + +    +  IP+V+I RAL    D EI +H+  
Sbjct: 238  LEKGSRFISTLQVKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICY 297

Query: 295  GDTSNSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELL 354
                   L      +  GF      +Q+R+  L ++G +   +         +Q  +++L
Sbjct: 298  DVNDWQMLEMLKPCVEEGF-----VIQDRETALDFIGRRGTAL--GIKKEKRIQYAKDIL 350

Query: 355  NRIVLVHL----GENNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGM 410
             +  L H+    G  ++  F  L +MI +L          D+ D    + + L G L   
Sbjct: 351  QKEFLPHITQLEGFESRKAF-FLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQ 409

Query: 411  IVKEKIEEYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLV 470
            + K         +  ++  DI R +  + ++ K  N  L      I + L+Y L+TGN  
Sbjct: 410  LFK--------TLFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWG 461

Query: 471  SQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPV 530
             Q    +   +G + V  +  +   +SH R  +        K    R+L    WG  CP 
Sbjct: 462  EQKK-SMSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPA 519

Query: 531  HTPDGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIA-AGPSMCCVQLDG 589
             TP+G  CGL+ +LS    IS   +D   I + L   G+ P    I    P    V ++G
Sbjct: 520  ETPEGQACGLVKNLSLMSCISV-GTDPLPIITFLNEWGMEPLEDYIPHQSPDATRVFVNG 578

Query: 590  KIIGWCSHEQGKVVADTLRFWKVEGK-TPGLPVDLEVG-------------YVPPTTSGQ 635
               G   H     + DT+R  + +G  TP + +  ++              Y P     +
Sbjct: 579  VWHGI--HRNPAKLVDTIRKLRRKGDITPEVSIVRDIREKELKIFTDAGRVYRPLFIVDE 636

Query: 636  YP-----GLFLFGGHSRMMRPVRYLPL-----DKEDI---------------VGPFEQVY 670
             P      L +  GH R +    Y  +     D+E++               +   E+  
Sbjct: 637  NPETGRKELKVKKGHVRKLMLTEYQDIEGGFDDEEEMNYTWTSLLNEGLVEYIDAEEEET 696

Query: 671  MNIAVTPEEIE-------------------NNVHSHVEFSPTNI-----LSILANLTPFS 706
            + IA+  E+++                     +H+   F+   I     L + A++ PF 
Sbjct: 697  ILIAMQHEDLDPALLPVADSEDDLDPARRIRAIHNSNIFTHCEIHPSMILGVAASVIPFP 756

Query: 707  DFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPN 766
            D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +       P 
Sbjct: 757  DHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPA 816

Query: 767  GTNAVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVNLSMNRSRGDPI- 820
            G NA+VA+  Y+GY+ +D+MI+N+S+ +RG     F    M + +++ +S+  S   P  
Sbjct: 817  GQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFEKPHR 876

Query: 821  --TQHFGFGTDEWPKEWLEKLDDDGLPLIGTYVEEGD-------PICAYFDDTLNKTKIK 871
              T     GT        +KLDDDGL   G  V   D       PI    ++   +T   
Sbjct: 877  TNTLRMKHGT-------YDKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAFH 929

Query: 872  T-------YHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHGQKG 924
            +         S+E   +++V +  ++      L+ + ++ R  + PQIGDKF+SRHGQKG
Sbjct: 930  SKRDASTPLRSTENGIVDQVLITTNQEG----LKFVKVRVRTTKIPQIGDKFASRHGQKG 985

Query: 925  VCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWT 984
                 + T DMPF+  G+ PD+IINPHA PSRMT+   +E L  K  AL G   D++P+T
Sbjct: 986  TIGITYRTEDMPFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT 1045

Query: 985  FNESDTPADYFGDQLAKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQ 1044
                D   D     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK  
Sbjct: 1046 ----DITVDGISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIH 1101

Query: 1045 VRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTAVCR 1104
             R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+  SD  +  +C 
Sbjct: 1102 ARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICG 1161

Query: 1105 DCGAILTTQSSVPKIGSISTVRCRRCALKFD 1135
             CG +    S V K+   +   CR C  K D
Sbjct: 1162 ICGLM----SVVAKLKH-NQFECRSCKNKID 1187

>CAGL0J07942g 772758..776492 similar to sp|P38717 Saccharomyces
           cerevisiae YNL257c SIP3 SNF1P or sp|P38851 Saccharomyces
           cerevisiae YHR155w, hypothetical start
          Length = 1244

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 687 HVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTG 746
           ++EF+ +    I   +T F D  +S    Y+C   +  + + G         K++  QT 
Sbjct: 444 YIEFASSTTTKIDQQITTFDDTTESLFQKYKCAFSEYEVLSVG-------SEKIFNFQTI 496

Query: 747 QTPIVKANLYDDYGMDNFPNG---TNAVVAVISYTGYDMDDAMIIN 789
            TPI        +  DN   G   TNAVVA I  T Y  D ++I++
Sbjct: 497 ITPISTKMTNLAFLADNSVYGSYCTNAVVANIWGTTYWSDYSLILS 542

>YGL084C (GUP1) [1898] chr7 complement(350617..352299) Protein
           involved in active glycerol uptake, protein trafficking
           to the vacuole, maintenance of vacuolar morphology, and
           secretion [1683 bp, 560 aa]
          Length = 560

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 23/144 (15%)

Query: 362 LGENNKDKFNMLLFMIRKLYSLVAG--ECSPDNPDAAQHQEILLGGFLYGMIVKEKIEEY 419
           L +  + KF  + F++       AG    SP+NP+ A+++ +L  G+L+G  V     +Y
Sbjct: 36  LWKTTEFKFYYIAFLVVVPLMFYAGLQASSPENPNYARYERLLSQGWLFGRKVDNSDSQY 95

Query: 420 LQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQ 479
               R              F+D   +  VLM V+ +I   + Y  ST   +++   DL  
Sbjct: 96  ----RF-------------FRDNFALLSVLMLVHTSIKRIVLY--STN--ITKLRFDLIF 134

Query: 480 VSGYTVVAEKINFYRFISHFRMVH 503
              + V A  +N  R ++H  +++
Sbjct: 135 GLIFLVAAHGVNSIRILAHMLILY 158

>CAGL0E00847g <73766..79244 highly similar to sp|P11075
           Saccharomyces cerevisiae YDR170c component of
           non-clathrin vesicle coat, start by similarity
          Length = 1825

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 67/162 (41%), Gaps = 28/162 (17%)

Query: 816 RGDPITQHFGFGTDEWPK---EWLEKLDDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKT 872
           R  P+    GF  DE P+   +WL + D   L ++G Y+ EGD           +  I  
Sbjct: 697 RAIPLLLQNGFINDESPESIAKWLLETDGLDLAMVGDYLGEGD-----------EKNIAV 745

Query: 873 YHSSEPAYIEEVKLIGDESSKFQELQAITIKYRIRRTPQIGDKFSSRHGQK------GVC 926
            H    A++++    G   S    L+    K+R+    Q  D+F  +  ++      GV 
Sbjct: 746 MH----AFVDQFDFTG--QSIVDALRDFLQKFRLPGEGQKIDRFMLKFAERFVDQNPGVF 799

Query: 927 SRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAG 968
           S+      + +S   +  D  ++     ++MT+  F+E+  G
Sbjct: 800 SKADTAYVLSYSLIMLNTD--LHSSQIKNKMTLQEFLENNEG 839

>Scas_682.17
          Length = 1923

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 82/200 (41%), Gaps = 35/200 (17%)

Query: 779 GYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNR-SRGDPITQHFGFGTDEWPKE--- 834
           G +MDD M   ++  +R     +      +NL  N+  +  P+    GF  D+ P E   
Sbjct: 750 GLEMDDPMQF-ENLKQRKTELSSC-----INLFNNKPKKAIPVLIEKGFLKDDSPIEIAK 803

Query: 835 WLEKLDDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSKF 894
           WL + D   L  +G Y+ EGD           +  I   H    A+++E+   G   S  
Sbjct: 804 WLLQQDGLNLATVGDYLGEGD-----------EKNIAVMH----AFVDELDFAG--LSIV 846

Query: 895 QELQAITIKYRIRRTPQIGDKFSSRHGQK------GVCSRKWPTIDMPFSETGIQPDVII 948
             L+    K+R+    Q  D+F  +  ++      G+ S+      + +S   +  D  +
Sbjct: 847 DALREFLQKFRLPGEGQKIDRFMLKFAERFVEQNPGIFSKADTAYVLSYSLIMLNTD--L 904

Query: 949 NPHAFPSRMTIGMFVESLAG 968
           +     +RMT+  F+E+  G
Sbjct: 905 HSAQVKNRMTLNDFLENNEG 924

>Sklu_2406.8 YOR215C, Contig c2406 12868-13425
          Length = 185

 Score = 30.4 bits (67), Expect = 5.3,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 413 KEKIEEYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQ 472
           K+ I E+ +N R  +  +  R + +    Q+Y+ K+ +  NE I +K+  FL+ G   +Q
Sbjct: 89  KDSIAEFTKNSREDLVDNEKREMGV---IQEYLGKLPVASNEEIDAKVLEFLN-GLKETQ 144

Query: 473 SGLDLQQVSG 482
             L L+Q+ G
Sbjct: 145 GALQLKQIFG 154

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 767 GTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRS 815
           G N  + V    GYD+++A    K   E GFGY T    +K NL +N S
Sbjct: 506 GNNIFLIVPPIFGYDIENA---GKVRIEHGFGYDTFGSTKKANLEVNGS 551

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 40,805,715
Number of extensions: 1898306
Number of successful extensions: 4328
Number of sequences better than 10.0: 28
Number of HSP's gapped: 4381
Number of HSP's successfully gapped: 40
Length of query: 1185
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1072
Effective length of database: 12,684,275
Effective search space: 13597542800
Effective search space used: 13597542800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)