Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A07106g31030515540.0
AEL226W3242867152e-93
Sklu_1927.13453036503e-83
Kwal_55.199263122885849e-74
Scas_617.63302975242e-64
YOR026W (BUB3)3413314799e-58
CAGL0H08217g3253184771e-57
Kwal_27.107853672642152e-19
CAGL0G03399g3693021977e-17
AGL301C3612601968e-17
KLLA0E20779g3712651942e-16
Scas_510.53622601932e-16
YER107C (GLE2)3652641834e-15
Sklu_2332.73672651773e-14
Scas_512.353444890.004
ACR166W388179860.009
Sklu_2172.6263106840.013
CAGL0M04279g940106780.096
Kwal_56.23920937125770.12
AAL157C47971760.14
YPR178W (PRP4)46577750.19
YNL006W (LST8)303101750.20
Scas_659.947574750.21
Scas_705.4649058740.29
KLLA0D04840g303101730.29
KLLA0A04928g861117740.34
YLL011W (SOF1)48951730.35
KLLA0F15598g47854720.48
KLLA0E23529g82633720.52
CAGL0K09284g911275720.56
Scas_592.4*318207710.56
YML102W (CAC2)46830710.59
Sklu_2423.194443720.61
CAGL0M09845g93643710.68
Scas_660.7*603112700.85
Kwal_55.22076128697700.89
KLLA0E07073g45268690.94
CAGL0B01529g36957690.97
Scas_713.5098350691.2
YCR057C (PWP2)923278691.2
KLLA0F05159g123188691.2
Scas_721.115*318207681.4
KLLA0E11143g49347671.8
Kwal_23.4118939100672.3
Sklu_1963.231456662.3
KLLA0D13222g736145662.6
AER081C102346662.6
Kwal_33.1513647374662.7
AGL190W37057662.7
KLLA0F13750g620110662.9
Scas_695.1532786653.1
Scas_721.732559653.3
CAGL0J07854g43289653.6
YLR129W (DIP2)943113653.7
Kwal_23.386941481643.8
CAGL0K07920g47519643.9
Kwal_26.773650759644.2
AAR057W92229644.9
KLLA0E07942g39072635.0
Kwal_27.1223931656635.2
KLLA0B11924g141264637.0
Scas_702.16816112627.5
Kwal_23.6240913278629.7
YMR116C (ASC1)31970619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A07106g
         (305 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A07106g complement(640536..641468) similar to sp|P26449 Sac...   603   0.0  
AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH] complement(...   280   2e-93
Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement          254   3e-83
Kwal_55.19926                                                         229   9e-74
Scas_617.6                                                            206   2e-64
YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein ...   189   9e-58
CAGL0H08217g complement(806660..807637) similar to sp|P26449 Sac...   188   1e-57
Kwal_27.10785                                                          87   2e-19
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    80   7e-17
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    80   8e-17
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    79   2e-16
Scas_510.5                                                             79   2e-16
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    75   4e-15
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       73   3e-14
Scas_512.3                                                             39   0.004
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    38   0.009
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       37   0.013
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    35   0.096
Kwal_56.23920                                                          34   0.12 
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    34   0.14 
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    33   0.19 
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    33   0.20 
Scas_659.9                                                             33   0.21 
Scas_705.46                                                            33   0.29 
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    33   0.29 
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    33   0.34 
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    33   0.35 
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    32   0.48 
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    32   0.52 
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    32   0.56 
Scas_592.4*                                                            32   0.56 
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    32   0.59 
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             32   0.61 
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    32   0.68 
Scas_660.7*                                                            32   0.85 
Kwal_55.22076                                                          32   0.89 
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    31   0.94 
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    31   0.97 
Scas_713.50                                                            31   1.2  
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    31   1.2  
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    31   1.2  
Scas_721.115*                                                          31   1.4  
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    30   1.8  
Kwal_23.4118                                                           30   2.3  
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         30   2.3  
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    30   2.6  
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    30   2.6  
Kwal_33.15136                                                          30   2.7  
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    30   2.7  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    30   2.9  
Scas_695.15                                                            30   3.1  
Scas_721.7                                                             30   3.3  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    30   3.6  
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    30   3.7  
Kwal_23.3869                                                           29   3.8  
CAGL0K07920g complement(786086..787513) weakly similar to tr|Q06...    29   3.9  
Kwal_26.7736                                                           29   4.2  
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    29   4.9  
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    29   5.0  
Kwal_27.12239                                                          29   5.2  
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    29   7.0  
Scas_702.16                                                            28   7.5  
Kwal_23.6240                                                           28   9.7  
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    28   9.9  

>KLLA0A07106g complement(640536..641468) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3 cell cycle arrest
           protein, start by similarity
          Length = 310

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/305 (96%), Positives = 293/305 (96%)

Query: 1   MNGYAKLQGVPKXXXXXXXXXXXXNRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCH 60
           MNGYAKLQGVPK            NRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCH
Sbjct: 1   MNGYAKLQGVPKDYISDIRIISSDNRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCH 60

Query: 61  VSKDGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVL 120
           VSKDGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVL
Sbjct: 61  VSKDGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVL 120

Query: 121 DYLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPSWDITETESGLKYQCRSC 180
           DYLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPSWDITETESGLKYQCRSC
Sbjct: 121 DYLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPSWDITETESGLKYQCRSC 180

Query: 181 TLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNL 240
           TLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNL
Sbjct: 181 TLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNL 240

Query: 241 FTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQDIEL 300
           FTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQDIEL
Sbjct: 241 FTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQDIEL 300

Query: 301 HPSAI 305
           HPSAI
Sbjct: 301 HPSAI 305

>AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH]
           complement(204812..205786) [975 bp, 324 aa]
          Length = 324

 Score =  280 bits (715), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 185/286 (64%), Gaps = 8/286 (2%)

Query: 25  NRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCHV-SKDGRIWAGSVQGEVLEADWES 83
           ++++VS WDG+ SL+D  + + + +L H WPLTS  V +   R + GS QGEVLE DWES
Sbjct: 37  SQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTSVAVCAGTRRAYVGSAQGEVLELDWES 96

Query: 84  ERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLCAS 143
           ER++    +   LG+S + S   F++  SWDGSL V+D  RN +    +   KI  L   
Sbjct: 97  ERMVALQGVQCGLGISAMGSYGQFVVVGSWDGSLAVVDTRRNTVRHIRRLTGKILSLDCG 156

Query: 144 EVRVMCSLSSGKVKLIQFPSWDI----TETESGLKYQCRSCTLIPNNRGFVQGSVDGRVS 199
             RV+C  + G   +  F + DI       ESGLKYQ R   L+P+  G+VQ SVDGRV+
Sbjct: 157 AARVVCMTTDG---VYVFRTSDIDAAPERRESGLKYQSRCVRLVPDEEGYVQSSVDGRVA 213

Query: 200 VEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKK 259
           VE+F D+  KFAFRCHRMNL+D Q+VFPV AL F P +  L+TGG+DG++ +WNL TRKK
Sbjct: 214 VEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHPKTALLYTGGSDGRVFAWNLTTRKK 273

Query: 260 QEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQDIELHPSAI 305
            EE  K++D+++KLCC    LVIA SDDSFKT AV +DI L  S +
Sbjct: 274 AEELPKVEDSVVKLCCNRRALVIAASDDSFKTSAVVEDIALQRSRV 319

>Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement
          Length = 345

 Score =  254 bits (650), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 129/303 (42%), Positives = 185/303 (61%), Gaps = 2/303 (0%)

Query: 4   YAKLQGVPKXXXXXXXXXXXXNRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCHVSK 63
           + KLQ V K            + +V + WDGS+S++D      L  L+H +PL S  V  
Sbjct: 39  FHKLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGVVH 98

Query: 64  DGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVLDYL 123
           +G+I+ GSVQGE+LE D ESE+     + S  LG+S I   D  +IA SWDGSL ++D  
Sbjct: 99  NGKIYVGSVQGEMLEVDLESEKF-GTVSESAELGISSICIQDASVIAGSWDGSLRIVDSR 157

Query: 124 RNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPSWDI-TETESGLKYQCRSCTL 182
            N    +     K+  +   E ++  SL++G+VK+            ++GLK+Q R   +
Sbjct: 158 NNDTQFETALGHKVLSMDCHENKLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQARDIKI 217

Query: 183 IPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFT 242
           +P+  G+VQ S+DGRV+VE+FD +  KFAFRCHRM+L+D Q VFPV  + F+P+S  LFT
Sbjct: 218 MPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSSTLFT 277

Query: 243 GGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQDIELHP 302
           GG+DG+I +WNL TRKK +E  KLD +++K+ C +  +V A SDDSFKT A  +D+ L P
Sbjct: 278 GGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACNDRVVVAATSDDSFKTSATVEDLPLQP 337

Query: 303 SAI 305
           S I
Sbjct: 338 SDI 340

>Kwal_55.19926
          Length = 312

 Score =  229 bits (584), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 178/288 (61%), Gaps = 15/288 (5%)

Query: 27  VVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCHVSKDG-RIWAGSVQGEVLEADWESER 85
           V V+ WDG+LSL++     L+++++++  LTSC  S+ G +I+ GSV GEVLE D+ESER
Sbjct: 26  VNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGSKIFVGSVSGEVLEVDFESER 85

Query: 86  --LIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEE----KIFQ 139
             LI        LG+S +    + IIA SWDGSL ++D   ++   +W  E     KI  
Sbjct: 86  FNLISEPA---ELGISALCCSQNNIIAGSWDGSLQIVD---SRSGDRWFRERLDNCKILG 139

Query: 140 L-CASEVRVMCSLSSGKVKLIQFPSWDITET-ESGLKYQCRSCTLIPNNRGFVQGSVDGR 197
           + CA   +++ SL+ GKV +    +    +  ESGLK+Q R   L+P   G+VQ S+DGR
Sbjct: 140 MDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQSSLDGR 199

Query: 198 VSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTR 257
           V+VE+FD +S +FAFRCHRMNL D Q VFPV +L F  N   L+TGG+DG++  WNL TR
Sbjct: 200 VAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTR 259

Query: 258 KKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQDIELHPSAI 305
           KK  EF K +D+I+KL    D L +A  DDSFKT    +  E+ P  +
Sbjct: 260 KKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTVEGAEIQPGKV 307

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 63/130 (48%), Gaps = 14/130 (10%)

Query: 88  PNDTMSFSLGVSGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLCASEV-- 145
           PND +S  L + GIT     +  ++WDG+L + +Y  N +V + ++ + +     SEV  
Sbjct: 10  PNDYIS-GLVIKGITP---HVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGS 65

Query: 146 RVMCSLSSGKVKLIQFPS--WDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFF 203
           ++     SG+V  + F S  +++    + L      C+   NN   + GS DG  S++  
Sbjct: 66  KIFVGSVSGEVLEVDFESERFNLISEPAELGISALCCS--QNN--IIAGSWDG--SLQIV 119

Query: 204 DDQSPKFAFR 213
           D +S    FR
Sbjct: 120 DSRSGDRWFR 129

>Scas_617.6
          Length = 330

 Score =  206 bits (524), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/297 (40%), Positives = 174/297 (58%), Gaps = 17/297 (5%)

Query: 26  RVVVSCWDGSLSLFDITQQQLLMKLQ----HSWPLTSC---HVSKDGRIWAGSVQGEVLE 78
           + +V+ WDGSLS F+       +KL     H + L  C    V    R++ G+VQGE+  
Sbjct: 28  QFLVTAWDGSLSQFEYNPNLKKVKLIKKVVHEYALLCCCYAFVLGKLRVYVGTVQGEIFL 87

Query: 79  ADWESERLIPNDTMSFSLGVSGITSIDHF-IIASSWDGSLIVLDYLRNQIVKQWKFEE-- 135
            D+E+    P    S  LGVS + ++ ++  IASSWDG L  +D   N +++  K E   
Sbjct: 88  VDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGILQEIDMQDNAVIRTTKLENNT 147

Query: 136 KIFQLCASEVRVMCSLSSGKVKLIQFP-----SWDITETESGLKYQCRSCTLIPNNRGFV 190
           K+  +      ++ +L+  K++ +  P       ++TE E+GLKYQ R   L     G+V
Sbjct: 148 KVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLKYQVRDIKLTLEGDGYV 207

Query: 191 QGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFTGGADGKIV 250
             S+DGRV+VE+F+D S  FAFRCHRMNL D+Q VFPV +LAF P S  LFTGG+DG + 
Sbjct: 208 TSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFSPASHLLFTGGSDGCVS 267

Query: 251 SWNLVTRKKQEEFHKLD-DTIMKLCCTEDYLVIAVSDDSFKTCA-VPQDIELHPSAI 305
            WNL T KK ++F K + ++++KL C ED LV+  SDDSFKT A V + +EL  S +
Sbjct: 268 LWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSFKTNAVVAEPLELQSSRL 324

>YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein
           required for cell cycle arrest in response to loss of
           microtubule function [1026 bp, 341 aa]
          Length = 341

 Score =  189 bits (479), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 190/331 (57%), Gaps = 33/331 (9%)

Query: 6   KLQGVPKXXXXXXXXXXXXNRVVVSCWDGSLSL--FDITQQQ--LLMKLQHSWPLTSCHV 61
           +++  PK            + ++++ WDGSL++  FDI  +   LL  L++  PL  C+ 
Sbjct: 5   QIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNF 64

Query: 62  --SKDGRIWAGSVQGEVLEADW---ESERLIPNDTMSFSLGVSGITSI-DHFIIASSWDG 115
             + D +I+ G+VQGE+L+ D     S + + N+  +  LG+  I    D  +IA+SWDG
Sbjct: 65  IDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEAN--LGICRICKYGDDKLIAASWDG 122

Query: 116 SLIVLD---------YLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFP---S 163
            + V+D          ++N      K + KIF +  +  R++  +++ +V+  + P    
Sbjct: 123 LIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCED 182

Query: 164 WDITETESGLKYQCRSCTLIPNNR-GFVQGSVDGRVSVEFFDDQ------SPKFAFRCHR 216
            + T  ESGLKYQ R   L+P  + G+   S+DGRV+VEFFDDQ      S +FAFRCHR
Sbjct: 183 DNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHR 242

Query: 217 MNLEDVQMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLD-DTIMKLCC 275
           +NL+D  + +PV ++ F P    L+T G+DG I  WNL TRKK + F K + D+++K+ C
Sbjct: 243 LNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIAC 302

Query: 276 TEDYLVIAVSDDSFKT-CAVPQDIELHPSAI 305
           +++ L +A SDD+FKT  A+ Q IEL+ S+I
Sbjct: 303 SDNILCLATSDDTFKTNAAIDQTIELNASSI 333

>CAGL0H08217g complement(806660..807637) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3, hypothetical
           start
          Length = 325

 Score =  188 bits (477), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 181/318 (56%), Gaps = 19/318 (5%)

Query: 5   AKLQGVPKXXXXXXXXXXXXNRVVVSCWDGSLSLF----DITQQQLLMKLQHSWPLTS-C 59
            +++ VP+            N++++  +DG+LS++    ++ Q  L ++LQ+   LTS  
Sbjct: 3   VEIKDVPREYISGIEIISEQNQIIIVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVA 62

Query: 60  HVSKDGR--IWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSL 117
            ++  GR  I+AGSV G++L  D E+   +  D +  S G+S I      +IA SWDGS+
Sbjct: 63  QLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSI 122

Query: 118 IVLDYLRNQIVKQWKFE-----EKIFQLCASEVRVMCSLSSGKVKLIQFPSWDITET--- 169
            V++   N +  ++  E     +K F+L     +++ S    K+ + + P    T+    
Sbjct: 123 YVVNPKSNSL--EFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHIL 180

Query: 170 ESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVT 229
           +SG  +Q R   L P   GFV   +DGRVSVE+FDD S +FAFRCH+ +L+D  M +P+ 
Sbjct: 181 DSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPIN 240

Query: 230 ALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKL-DDTIMKLCCTEDYLVIAVSDDS 288
           A+ F PN+   +TGG+DG + +W+L  + K ++  K  ++++++L C E+ L +A SDDS
Sbjct: 241 AIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDS 300

Query: 289 FKTCAV-PQDIELHPSAI 305
           FKT AV   ++EL PS I
Sbjct: 301 FKTNAVIDSNLELEPSRI 318

>Kwal_27.10785
          Length = 367

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 119/264 (45%), Gaps = 22/264 (8%)

Query: 29  VSCWDGSLSLFDIT--QQQLLMKLQHSWPLTSCHVSKDG-RIWAGSVQGEVLEAD---WE 82
           VS WD  + ++D+   Q Q   + QH  P+ +   S DG +I +G     V+  D    +
Sbjct: 53  VSSWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRWSTDGTKIASGGCDNAVMVFDVSSGQ 112

Query: 83  SERLIPNDTMSFSLG-VSGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLC 141
           S+++  +D    SL  V    S    ++  SWD ++   D  + Q V      E+++ + 
Sbjct: 113 SQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWDLRQPQPVSTLAMPERVYTMD 172

Query: 142 ASEVRVMCSLSSGKVKLIQF--PSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVS 199
           + +  ++   +   + +I    P+     T S LK+Q RS +      G+  GS++GR +
Sbjct: 173 SKQKLLVVGTAERHIVVIDLNNPAAIFKTTTSPLKWQTRSVSCYIEGNGYAVGSIEGRCA 232

Query: 200 VEFFDDQSPK---FAFRCHRMNLEDV----------QMVFPVTALAFQPNSLNLFTGGAD 246
           +++ DDQ  +   F+F+CHR+  +              V+PV ++ F P      T G D
Sbjct: 233 IQYVDDQEQRKSGFSFKCHRVQQQSTGAAGGRSSTESQVYPVNSIVFHPIYGTFATAGGD 292

Query: 247 GKIVSWNLVTRKKQEEFHKLDDTI 270
           G    W+   R + + F  L  TI
Sbjct: 293 GSFHFWDKNLRHRLKGFPSLKATI 316

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 80.5 bits (197), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 131/302 (43%), Gaps = 28/302 (9%)

Query: 29  VSCWDGSLSLFDITQ--QQLLMKLQHSWPLTSCHVSKDG-RIWAGSVQGEVLEAD---WE 82
           VS WDG + ++D      Q   + +H+ P+     S DG RI +G     V   D    +
Sbjct: 53  VSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASGGCDNTVKLYDVASGQ 112

Query: 83  SERLIPNDTMSFSLGV--SGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQL 140
           S+++  ++    SL     G T+ +  ++  SWD ++   D  + Q +      E+++ +
Sbjct: 113 SQQIGSHNDAVKSLRFVQCGPTNTE-CLVTGSWDKTIKFWDTRQPQPITTIAMPERVYTM 171

Query: 141 CASEVRVMCSLSSGKVKLIQF--PSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRV 198
              +  ++   +   + +I    P+     ++S LK+Q R         G+  GSV+GR 
Sbjct: 172 DNKQQLLVVGTAERHIAIINLANPTTIFKSSQSPLKWQTRVVACYNEGDGYAIGSVEGRC 231

Query: 199 SVEFFDDQSPK---FAFRCHRMNLEDV-------QMVFPVTALAFQPNSLNLFTGGADGK 248
           ++++ DD++ K   F+F+CHR    +         +V+PV ++AF P      T G DG 
Sbjct: 232 AIKYVDDEAQKKSGFSFKCHRQTQPNRAAGSSSQSLVYPVNSIAFHPIYGTFVTAGGDGS 291

Query: 249 IVSWNLVTRKKQEEFHKLDDTIM--KLCCTEDYLVIAVSDDSFKTCA-----VPQDIELH 301
              W+   R + + F  +  +I           L  AVS D  +         P  I LH
Sbjct: 292 FHFWDKNQRHRLKGFPSMQGSIPVCNFNRNGSILAYAVSYDWHQGHMGNRPDYPNVIRLH 351

Query: 302 PS 303
           P+
Sbjct: 352 PT 353

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 80.1 bits (196), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 117/260 (45%), Gaps = 18/260 (6%)

Query: 29  VSCWDGSLSLFDITQ--QQLLMKLQHSWPLTSCHVSKDGRIWAGSVQGEVLE----ADWE 82
           V+ WD ++ ++D+     Q   + +H  P+ +   S DG   A      +L+    A  +
Sbjct: 51  VAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQ 110

Query: 83  SERLIPNDTMSFSLG-VSGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLC 141
           ++++  +D+   +L  V    S    I+  SWD ++   D  + Q +      E+++ L 
Sbjct: 111 AQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMRQPQPISTVAMPERVYALD 170

Query: 142 ASEVRVMCSLSSGKVKLIQF--PSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVS 199
           + +  ++   +   + +I    P+     + S LK+Q R+        GF  GSV+GR +
Sbjct: 171 SKQKLLVVGTAERHIVVIDLNNPAQVFRTSMSPLKWQTRTVACYIEGNGFAIGSVEGRCA 230

Query: 200 VEFFDDQSPK---FAFRCHRM------NLEDVQMVFPVTALAFQPNSLNLFTGGADGKIV 250
           +++ D+Q  +   F+F+CHR             +V+PV ++ F P      T G DG   
Sbjct: 231 IQYVDEQEQRKNGFSFKCHRQQQPASGRASSESLVYPVNSIVFHPQYGTFATAGGDGSCN 290

Query: 251 SWNLVTRKKQEEFHKLDDTI 270
            W+   R + + F  ++ +I
Sbjct: 291 FWDKNQRHRLKGFPSMNASI 310

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 121/265 (45%), Gaps = 24/265 (9%)

Query: 29  VSCWDGSLSLFDITQ--QQLLMKLQHSWPLTSCHVSKDGRIWAGSVQGEVLE----ADWE 82
           VS WD  + ++D+     Q   +  H  P+ +   S DG   A      VL+       +
Sbjct: 53  VSSWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSIDGTKVASGGCDNVLKVFDVTTGQ 112

Query: 83  SERLIPNDTMSFSLGVSGITSIDHFIIAS-SWDGSLIVLDYLRNQIVKQWKFEEKIFQLC 141
           ++++  +++   SL        +   IA+ SWD ++   D    Q +   +  E+++ + 
Sbjct: 113 AQQIGQHNSAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLRSPQPIMTLQMPERVYCMD 172

Query: 142 ASEVRVMCSLSSGKVKLIQF--PSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVS 199
           AS+  ++  ++   + +I    P      + S LK+Q RS +      GF  GS++GR +
Sbjct: 173 ASQKLMVVGMAERHIAVIDLNNPGQIFKTSLSPLKWQTRSISCYNEGNGFAIGSIEGRCA 232

Query: 200 VEFFDDQSPK---FAFRCHRMNLE-----------DVQMVFPVTALAFQPNSLNLFTGGA 245
           V++ D+Q  +   F+F+CHR  ++           +VQ V+PV ++ F P      T G 
Sbjct: 233 VQYIDEQEQRKDGFSFKCHRQQVQNNGAAGGRTSTEVQ-VYPVNSIVFHPIHGTFATAGG 291

Query: 246 DGKIVSWNLVTRKKQEEFHKLDDTI 270
           DG    W+   R + + F KL+ +I
Sbjct: 292 DGSFHFWDKNHRHRLKGFPKLNYSI 316

>Scas_510.5
          Length = 362

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 118/260 (45%), Gaps = 18/260 (6%)

Query: 29  VSCWDGSLSLFDITQ--QQLLMKLQHSWPLTSCHVSKDGRIWAGSVQGEVLE----ADWE 82
           VS WDG + ++D+     Q   + +H+ P+ S   S DG   A      +++    A  +
Sbjct: 52  VSSWDGKVRIWDVQGGVAQGRSQYEHAGPVLSTRWSNDGSKVASGGCDNIVKLFDVASGQ 111

Query: 83  SERLIPNDTMSFSLG-VSGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLC 141
           S+++  +D    ++  V+   S    ++  SWD S+   D  + Q +      ++++ + 
Sbjct: 112 SQQIGMHDAPVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMRQPQAISTVIMPDRVYTMD 171

Query: 142 ASEVRVMCSLSSGKVKLIQF--PSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVS 199
           + +  ++   +   + +I    P      T S LK+Q R  +      G+  GS++GR +
Sbjct: 172 SKQQLLVVGTAERHIAIINLNNPGSIFKTTLSPLKWQTRVVSCYNEGDGYAIGSIEGRCA 231

Query: 200 VEFFDDQSPK---FAFRCHRMNLEDV------QMVFPVTALAFQPNSLNLFTGGADGKIV 250
           + + DD+  K   F+F+CHR N  +        +V+PV ++AF P      T G DG   
Sbjct: 232 IRYVDDEMQKKSGFSFKCHRQNNPNRTAGSQQSLVYPVNSIAFHPIYGTFATAGGDGCFH 291

Query: 251 SWNLVTRKKQEEFHKLDDTI 270
            W+   R + + F  L  +I
Sbjct: 292 FWDKNHRHRLKAFPSLRSSI 311

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 109/264 (41%), Gaps = 25/264 (9%)

Query: 29  VSCWDGSLSLFDITQQQLLMKLQH--SWPLTSCHVSKDG-RIWAGSVQGEVLEADWESER 85
            S WDG + ++D+       + QH  S P+     S DG ++ +G     +   D  S +
Sbjct: 54  ASSWDGKVRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQ 113

Query: 86  L-------IPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIF 138
                    P   + F   V    S    I+  SWD ++   D  + Q V      E+++
Sbjct: 114 TQQIGMHSAPIKVLRF---VQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVY 170

Query: 139 QLCASEVRVMCSLSSGKVKLIQF--PSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDG 196
            +   +  ++ + +   + +I    P+     T S LK+Q R         G+  GSV+G
Sbjct: 171 SMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEG 230

Query: 197 RVSVEFFDDQSPK---FAFRCHRMNLEDV-------QMVFPVTALAFQPNSLNLFTGGAD 246
           R S+ + DD   K   F+F+CHR    +         +V+PV ++AF P      T G D
Sbjct: 231 RCSIRYIDDGMQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGD 290

Query: 247 GKIVSWNLVTRKKQEEFHKLDDTI 270
           G    W+   R + + +  L  +I
Sbjct: 291 GTFNFWDKNQRHRLKGYPTLQASI 314

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 118/265 (44%), Gaps = 24/265 (9%)

Query: 29  VSCWDGSLSLFDIT--QQQLLMKLQHSWPLTSCHVSKDG-RIWAGSVQGEVLEADWES-- 83
           VS WD  + ++D+     Q   + +H  P+ +   S DG ++ +G     V   D +S  
Sbjct: 53  VSSWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQSGQ 112

Query: 84  -ERLIPNDTMSFSLGV--SGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQL 140
            +++  +D+    L     G T+ +  ++  SWD ++   D  + Q V      ++++ +
Sbjct: 113 AQQVGAHDSAIRHLRFIQCGPTNTE-CLVTGSWDKTIKYWDMRQPQPVSTLMMPDRVYAM 171

Query: 141 CASEVRVMCSLSSGKVKLIQF--PSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRV 198
            + +  ++ + +   + +I    P+       S LK+Q RS +      G+  GS++GR 
Sbjct: 172 DSKQKLLVVATAERHIAIIDLNNPATIFKTATSPLKWQTRSVSCYIEGNGYAIGSIEGRC 231

Query: 199 SVEFFDDQSPK---FAFRCHRMNLEDV----------QMVFPVTALAFQPNSLNLFTGGA 245
           ++++ D+Q  +   F+F+CHR   +              V+PV ++ F P      T G 
Sbjct: 232 AIQYVDEQEQRKSGFSFKCHRQQQQSTGTAGGRSNTESHVYPVNSIVFHPVYGTFATAGG 291

Query: 246 DGKIVSWNLVTRKKQEEFHKLDDTI 270
           DG    W+   R + + F  +  +I
Sbjct: 292 DGSFHFWDKNQRHRLKGFPSMKASI 316

>Scas_512.3
          Length = 534

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 227 PVTALAFQPNSLN---LFTGGADGKIVSWNLVTRKKQEEFHKLD 267
           PV +L FQPNS N   L T G D KI SWNL   K   +   +D
Sbjct: 15  PVYSLCFQPNSPNKKKLLTAGGDNKIRSWNLNLVKDTNKIDTID 58

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 70/179 (39%), Gaps = 47/179 (26%)

Query: 136 KIFQLCASEVRVMCSLSSGKVKLIQFPSWDITETESGLKYQCRSCTLIPNNRGFVQGSV- 194
           K+    A+  +V   +S+G   ++      I E E    Y C          G   GS+ 
Sbjct: 199 KVLIYNAATAKVHHEISTGNKTIMHMEVEHIDEKE----YICV---------GLSTGSIQ 245

Query: 195 --DGRVSVEFFDDQ---SPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLN--LFTGGADG 247
             D     E  +DQ    P F+ + H   ++D +         F  NS+   L + G+DG
Sbjct: 246 FYDAEKLYEESEDQKAAEPAFSLQGHTNRVKDFR---------FYKNSMGHYLVSAGSDG 296

Query: 248 KIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDS-------FKTCAVPQDIE 299
           KIV W++V   KQE+    D       C E    +AV D+S        K  A   DIE
Sbjct: 297 KIVVWDIV---KQEQLAVYD-------CGERLNCLAVCDESVEKYDTVLKRTAATADIE 345

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 38/106 (35%), Gaps = 9/106 (8%)

Query: 184 PNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFTG 243
           P       G  DG + +     ++    F  H+           +T L F P    L +G
Sbjct: 85  PETNLLAVGYADGVIKIWDLISKTVLINFNGHKS---------AITVLRFDPTGTRLISG 135

Query: 244 GADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSF 289
             D  I+ W+LV      +     D+I  + C  +  +I+ S D  
Sbjct: 136 SKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGL 181

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 34.7 bits (78), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 38/106 (35%), Gaps = 9/106 (8%)

Query: 184 PNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFTG 243
           P       G  DG + +     ++   +F  H+           +T LAF      L + 
Sbjct: 89  PETNLLAAGYADGVIKIWDLISKTVLISFNGHKS---------AITVLAFDTTGTRLISA 139

Query: 244 GADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSF 289
             D  I+ W+LV      +     D I  L C ++  +I+ S D  
Sbjct: 140 SKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGL 185

>Kwal_56.23920
          Length = 937

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 46/125 (36%), Gaps = 12/125 (9%)

Query: 184 PNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFTG 243
           P  R    G  DG + +     +S   +F  H+           +T L F      L +G
Sbjct: 85  PETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKS---------AITILTFDQTGTRLISG 135

Query: 244 GADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTC---AVPQDIEL 300
             D  I+ W+LV      +     D+I  L C  +  +I+ S D         V Q +E 
Sbjct: 136 SRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQCVET 195

Query: 301 HPSAI 305
           H + +
Sbjct: 196 HVAHV 200

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 43/117 (36%), Gaps = 19/117 (16%)

Query: 184 PNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFTG 243
           P+NR      +D  V V F D      +   H++         PV ++    +S  L T 
Sbjct: 535 PDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKL---------PVLSIDISFDSKLLITS 585

Query: 244 GADGKIVSWNLVTRKKQEEFHKLDDTIMKLC----------CTEDYLVIAVSDDSFK 290
            AD  I  W L            +D+IMK+           C++D LV     D F+
Sbjct: 586 SADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFE 642

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 231 LAFQPNSLN-LFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSF 289
           LA   N LN L +G ADG +  WN+ TR++   F      +  LC T  +L     D   
Sbjct: 73  LAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSPTKKDSFM 132

Query: 290 KTCAVPQDIEL 300
            +C   + I+L
Sbjct: 133 LSCGDDKTIKL 143

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 14/77 (18%)

Query: 227 PVTALAFQPNSLNLFTGGADGKIVSWNLVTRKK--------------QEEFHKLDDTIMK 272
           P+  +A+ PN   + TGG DG I  W++  R +              Q  F K D     
Sbjct: 351 PIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKL 410

Query: 273 LCCTEDYLVIAVSDDSF 289
           + C  D L+   S D++
Sbjct: 411 VSCGYDNLINVYSSDTW 427

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 42/101 (41%), Gaps = 10/101 (9%)

Query: 172 GLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTAL 231
           G +    S +   +NR  V  S DG + V  +D +SP    R ++ N        PV  +
Sbjct: 73  GHRGNVTSVSFQQDNRWMVTSSEDGTIKV--WDVRSPSIP-RNYKHNA-------PVNEV 122

Query: 232 AFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMK 272
              PN   L +   DG I  W+L   +   +    DDT ++
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQ 163

>Scas_659.9
          Length = 475

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 228 VTALAFQPNSLN-LFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSD 286
           V  +A    +LN L TG ADG +  WN+ TR++   F      I  LC T ++L    ++
Sbjct: 70  VYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLSKQKNE 129

Query: 287 DSFKTCAVPQDIEL 300
           +   +C+  + ++L
Sbjct: 130 NFMLSCSDDKTVKL 143

>Scas_705.46
          Length = 490

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 8/58 (13%)

Query: 208 PKFAFRCHRMNLEDVQMVFPV--TALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEF 263
           PK+  R H   +  + + +P   T + +      L +  A GKIV W+L+TR+    F
Sbjct: 8   PKYTLRNHTDPISALALYYPARDTVVPY------LISADASGKIVIWDLITRRPVHTF 59

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 41/101 (40%), Gaps = 10/101 (9%)

Query: 172 GLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTAL 231
           G K    S      NR  V  S DG + V  +D +SP    R ++ N        PV  +
Sbjct: 73  GHKGNVTSIAFQQENRWMVSSSEDGTIKV--WDVRSPSVQ-RNYKHNA-------PVNEV 122

Query: 232 AFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMK 272
           A  PN   L +   DG I  W+L   +   +    D+T ++
Sbjct: 123 AIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQ 163

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 12/117 (10%)

Query: 156 VKLIQFPSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCH 215
           +KL++ P W +   E    Y+  +C + P+++    G +DG++ +    D   KFA   +
Sbjct: 1   MKLLKLP-W-LQHREEHKSYEVYTCDVSPDSQRLATGGLDGKIRIWSIPDIL-KFASNPN 57

Query: 216 RMNLEDVQM---------VFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEF 263
               +D+ M            VT + F P+   L +G  D  ++ W L     Q  F
Sbjct: 58  ASTDKDILMKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMF 114

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 228 VTALAFQPNSLN-LFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTE 277
           V A+A    SLN L TG ADG I  WN+ TR++   F      +  LC T+
Sbjct: 70  VYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ 120

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 228 VTALAFQPNSLN-LFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYL 280
           V  +A   N LN L T   DG I  WN+ TR++   F      +  LC T  YL
Sbjct: 70  VYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYL 123

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 227 PVTALAFQPNSLNLFTGGADGKIVSWNLVTRKK 259
           PVTAL   P+   L TG  DG I+ W++ T K+
Sbjct: 681 PVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKR 713

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 113/275 (41%), Gaps = 28/275 (10%)

Query: 25  NRVVVSCWDGSLSLFDITQQQLLMKLQHSW-PLTSCHVSKDGR--IWAGSVQGEVLEADW 81
           N ++V   +G   L+++ +  ++ +L     P+ +  V+  G    +  S  G++L  +W
Sbjct: 269 NLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFGSSKLGQLLVYEW 328

Query: 82  ESERLIPNDTMSFSLGVSGITSID-HFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQL 140
           +SE  I      F    S   S D   ++ ++ DG + V D      +    FEE    +
Sbjct: 329 QSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLA--TFEEHTSAV 386

Query: 141 CASEV----RVMCSLS-SGKVK---LIQFPSWDITETESGLKYQCRSCTLIPNNRGFVQG 192
            A +     +V+ S S  G V+   LI++ ++ +      +++ C +    P+      G
Sbjct: 387 TAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVE--PSGEVVSAG 444

Query: 193 SVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVF--PVTALAFQPNSLNLFTGGADGKIV 250
           S D       FD     F +      L D       PV+ LAF   +  L +   D  I 
Sbjct: 445 STDS------FD----VFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIR 494

Query: 251 SWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVS 285
            W++  R +Q E  ++   I+ +  T D   +AVS
Sbjct: 495 IWSIFGRSQQVEPLEVFADILAITITPDGKHVAVS 529

>Scas_592.4*
          Length = 318

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 82/207 (39%), Gaps = 21/207 (10%)

Query: 107 FIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPSWDI 166
           + +++SWD +L + D    +  +++   +      A + +    +S  + K I+   W I
Sbjct: 79  YALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV--WTI 136

Query: 167 TETESGLKYQCRSCTLIPNNRGFVQGSV------DGRVSVEFFDDQSPKFAFRCHRMNLE 220
                  K QC + TL+ +N    Q  +      D  V+V    +     A+  ++  +E
Sbjct: 137 -------KGQCLA-TLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIE 188

Query: 221 D--VQMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTED 278
              V     V A+   P+   + + G DG+I+ WNL  +K        D+          
Sbjct: 189 ADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPNR 248

Query: 279 YLVIAVSDDSFKT-CAVPQDI--ELHP 302
           Y + A +    K  C  PQ +  +L P
Sbjct: 249 YWLAAATASGIKIFCLDPQSLIDDLRP 275

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 2/30 (6%)

Query: 227 PVTALAFQPNSLN--LFTGGADGKIVSWNL 254
           PV +L FQ NS N  LFT G D K+  W L
Sbjct: 15  PVYSLTFQKNSANDKLFTAGGDNKVRIWKL 44

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 32.3 bits (72), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 25  NRVVVSC-WDGSLSLFDITQQQLLMKLQHSWPLTSC--HVSKD 64
           NR +VSC  DG +  +D T+   L KLQ   P+TS   H S D
Sbjct: 520 NRKMVSCGLDGLIGFYDFTKSAFLGKLQLDAPVTSMVYHRSSD 562

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 25  NRVVVSC-WDGSLSLFDITQQQLLMKLQHSWPLTSC--HVSKD 64
           NR +VSC  DG +  +D  + + L KLQ   P+TS   H S D
Sbjct: 512 NRKMVSCGLDGIIGFYDFNESKYLGKLQMDAPITSMVYHRSSD 554

>Scas_660.7*
          Length = 603

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 57/112 (50%), Gaps = 11/112 (9%)

Query: 25  NRVVVSCWDGSLSLFDITQQQLLMKLQ-HSWPLTSCHVSKDGRIWAGSVQGEVLEADWES 83
            R+V    DG+L++F + Q  ++  ++ HS  +T+  V+    +  GS  G+++  DW +
Sbjct: 300 GRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALAVNP---LITGSYDGKIM--DWSN 354

Query: 84  ERLIP---NDTMSFSLGVSGITSIDHFIIASSWDGSLIVLDYLRNQIVKQWK 132
           +  +    ++ +  S+ V   T     I + SWD +L++ D ++ Q   Q K
Sbjct: 355 KPEVAHTKHNNLIVSIDVQ--TGKADQISSVSWDDTLMINDEIKYQFEHQPK 404

>Kwal_55.22076
          Length = 1286

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 40/97 (41%), Gaps = 17/97 (17%)

Query: 161 FPSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLE 220
            P++D +  E G           P+NRG    S+     +  +D + P  A +  R+N  
Sbjct: 270 MPTYDFSPEEQG-----------PSNRGHRFASIHDSGLLLTYDLRQPSQAEK--RINAH 316

Query: 221 DVQMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTR 257
                 P   L + P +  + TGG DGK   WN  +R
Sbjct: 317 S----GPGLCLCWHPTADYIMTGGRDGKCCLWNTGSR 349

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 31.2 bits (69), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)

Query: 28  VVSCWDGSLSLFDITQQQLLMKLQHSWP------LTSCHVSKDGRIWAGSVQGEVLEADW 81
            V C+DGS+  FD++Q+    K  H+ P      +TS   S  G I A + +   +    
Sbjct: 309 TVGCYDGSIKHFDLSQENQPNKPTHNIPYAHEKCVTSLAYSPIGHIMASASKDRTIRFWT 368

Query: 82  ESERLIPN 89
            S  + PN
Sbjct: 369 RSRAVDPN 376

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 31.2 bits (69), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 8/57 (14%)

Query: 25  NRVVVSCWDGSLSLFDITQQQLLMKL--QHSWPLTSCH---VSKDGRI---WAGSVQ 73
           N+VVV+  DGSL LFD T Q+  + +  +HS  + SC+   VSK   +   W G V+
Sbjct: 74  NQVVVAQGDGSLRLFDTTLQKFPIAMFHEHSKEVYSCNWNLVSKSNFVSSSWDGQVK 130

>Scas_713.50
          Length = 983

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 228 VTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTE 277
           +TAL F  +   L +G  D  I+ W+LV+     +     D I  + C E
Sbjct: 151 ITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNE 200

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 61/278 (21%), Positives = 111/278 (39%), Gaps = 38/278 (13%)

Query: 27  VVVSCWDGSLSLFDITQQQLLMKLQHSW-PLTSCHVSKDGR--IWAGSVQGEVLEADWES 83
           + V    G   L+D+    L+ +L     P+ +  V++ G    +  S  G++L  +W+S
Sbjct: 275 LAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQS 334

Query: 84  ERLIPNDTMSFSLGVSGITSID-HFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLCA 142
           E  I      F    S   S D   ++ +S DG + V D      +    FEE    + A
Sbjct: 335 ESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLAT--FEEHTSSVTA 392

Query: 143 SEV----RVMCSLS-SGKVK---LIQFPSWDITETESGLKYQCRSCTLIPNNRGFVQGSV 194
            +     +VM S S  G V+   LI++ ++        +++ C    + P+      GS+
Sbjct: 393 VQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNC--LAVDPSGEVVCAGSL 450

Query: 195 DGRVSVEFFDDQSPKFAFRCHRMNLEDVQMV-------FPVTALAFQPNSLNLFTGGADG 247
           D                F  H  +++  Q++        PV+ L+F   +  L +   D 
Sbjct: 451 DN---------------FDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDK 495

Query: 248 KIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVS 285
            I  W++  R +Q E  ++   ++ L    D   +AVS
Sbjct: 496 TIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVS 533

>KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces
           cerevisiae YDL195w SEC31 component of the COPII coat of
           ER-golgi vesicles, start by similarity
          Length = 1231

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 7/88 (7%)

Query: 33  DGSLSLFDITQQQLLMKL-QHSWPLTSC--HVSKDGRIWAGSVQGEVLEADWESERLIPN 89
           +G +  FD    + + K+ +H  P+ +   +  ++  + +G  QGE+    W+S ++  +
Sbjct: 83  NGVVEFFDPKALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFV--WDSNKIGSS 140

Query: 90  DTMSFSLGVSGITSIDHFIIASSWDGSL 117
           D   FS G+S  T ID  + + SW+ SL
Sbjct: 141 DYSPFSAGISN-TPIDE-VSSLSWNQSL 166

>Scas_721.115*
          Length = 318

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 81/207 (39%), Gaps = 21/207 (10%)

Query: 107 FIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPSWDI 166
           + +++SWD +L + D    +  +++   +      A + +    +S  + K I+   W I
Sbjct: 79  YALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV--WTI 136

Query: 167 TETESGLKYQCRSCTLIPNNRGFVQGSV------DGRVSVEFFDDQSPKFAFRCHRMNLE 220
                  K QC + TL+ +N    Q  +      D  V+V    +     A+  ++  +E
Sbjct: 137 -------KGQCLA-TLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIE 188

Query: 221 D--VQMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTED 278
              V     V  +   P+   + + G DG+I+ WNL  +K        D+          
Sbjct: 189 ADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNR 248

Query: 279 YLVIAVSDDSFKT-CAVPQDI--ELHP 302
           Y + A +    K  C  PQ +  +L P
Sbjct: 249 YWLAAATASGIKIFCLDPQSLVDDLRP 275

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 227 PVTALAFQP------NSLNLFTGGADGKIVSWNLVTRKKQEEFHKLD 267
           P+ +L FQP      N+  LFT G D KI  W L   +   +   +D
Sbjct: 16  PIYSLCFQPLSETNQNTRRLFTSGGDNKIRVWQLNESENDGKIETID 62

>Kwal_23.4118
          Length = 939

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 25  NRVVVSC-WDGSLSLFDITQQQLLMKLQHSWPLTSCHVSKDGRIWAGSVQG-EVLEADWE 82
           NR +VSC  DG +  +D ++   L KLQ   P+TS    +   ++A ++    ++  D  
Sbjct: 515 NRKMVSCGLDGIVGFYDFSKSSYLGKLQLDAPVTSMVYHRSSDLFALALDDFSIVVVDAV 574

Query: 83  SERLI------PNDTMSFSLGVSGITSIDHFIIASSWDGS 116
           +++++       N   SF     G      +II++S DG+
Sbjct: 575 TQKVVRQLWGHSNRISSFDFSPDG-----RWIISTSLDGT 609

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 23/56 (41%)

Query: 225 VFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYL 280
           V P++ + F  N   L     DG +  W+ +       F   D T +K  C  D+L
Sbjct: 190 VVPISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTFKICDSTKLKYSCGMDFL 245

>KLLA0D13222g complement(1132067..1134277) similar to sgd|S0002732
           Saccharomyces cerevisiae YDR324c, start by similarity
          Length = 736

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 57/145 (39%), Gaps = 21/145 (14%)

Query: 141 CASEVRVMCSLSSGKVKLIQFPSWDITETESGLKYQ---CRSCTLIPNNRGFVQGSVDGR 197
           C +   V+ ++S GK          + E ES L  Q     S T   N+   V G  DGR
Sbjct: 136 CDNGSVVLINISGGK---------GVLEHESILTRQESRVLSLTWTANDESLVAGCSDGR 186

Query: 198 VSVEFFDDQSPKFAFRCHRMNLE----DVQMVFPVTALAFQPNSLNLFTGGADGKIVSWN 253
           + + +  +Q        H M ++    +  +V+ V  LA Q     + +G + G +  W+
Sbjct: 187 IRIWYTKEQDENKGRLLHTMKVDKSKKESTLVWSVLYLAKQN---QIVSGDSTGSVKFWD 243

Query: 254 LVTRKKQEEFHKLDDTIMKLCCTED 278
           L      + F   D  +  LC   D
Sbjct: 244 LNYATLTQSFKVHDADV--LCLATD 266

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 25  NRVVVSC-WDGSLSLFDITQQQLLMKLQHSWPLTSCHVSKDGRIWA 69
           NR +VSC  DG +  +D T    L KLQ   P+T     +   ++A
Sbjct: 602 NRKMVSCGLDGLVGFYDFTTNSFLGKLQLGAPITQLVYHRASELFA 647

>Kwal_33.15136
          Length = 473

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 228 VTALAFQPNSLN-LFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSD 286
           V  +A   + LN L T  ADG +  WN+ TR++   F      I  LC T  +L    ++
Sbjct: 70  VYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTPQHLSQNKNE 129

Query: 287 DSFKTCAVPQDIEL 300
           +   +C   + ++L
Sbjct: 130 NYMLSCGDDRTVKL 143

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 8/57 (14%)

Query: 25  NRVVVSCWDGSLSLFDITQQQLLMKL--QHSWPLTSCH---VSKDGRI---WAGSVQ 73
           N+V+ +  DGSL LFDIT QQ  + L  +H   + SC+   + KD  +   W G+V+
Sbjct: 74  NQVLAAQGDGSLRLFDITLQQYPIALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVK 130

>KLLA0F13750g complement(1274110..1275972) similar to sp|P46680
           Saccharomyces cerevisiae YMR092c AIP1 actin cytoskeleton
           component singleton, start by similarity
          Length = 620

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 49/110 (44%), Gaps = 15/110 (13%)

Query: 182 LIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLF 241
           ++  +   V  ++DG +S+   +D + KF    H  N         +T+LA  P    L 
Sbjct: 304 VVTKDNSIVTLTLDGTLSILSLNDHTIKF---IHGHNK-------GITSLAVNP----LV 349

Query: 242 TGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVS-DDSFK 290
           +G  DG++V+WN    +     H +   ++      D  V +VS D++ K
Sbjct: 350 SGSYDGRVVTWNSEGDEVNAISHDIHGNLVLAIDNSDNEVSSVSWDETLK 399

>Scas_695.15
          Length = 327

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 10/86 (11%)

Query: 169 TESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPV 228
           T  G K    S +   +N+  V  S DG + V  +D +SP    R ++ N        PV
Sbjct: 90  TFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKV--WDVRSPSVP-RNYKHNA-------PV 139

Query: 229 TALAFQPNSLNLFTGGADGKIVSWNL 254
             +   PN   L +   DG I  W+L
Sbjct: 140 NEVVIHPNQGELISCDRDGTIKIWDL 165

>Scas_721.7
          Length = 325

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 2/59 (3%)

Query: 225 VFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLD--DTIMKLCCTEDYLV 281
           V P++ + F PN   L     DG +  W+ V       F   D     +K CC  D+L 
Sbjct: 192 VVPISQVRFSPNGKFLLVSSFDGIVKIWDCVRGYVVRTFKPSDGESVALKHCCGIDFLA 250

>CAGL0J07854g complement(765463..766761) similar to sp|P53851
           Saccharomyces cerevisiae YNL253w, hypothetical start
          Length = 432

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 2/89 (2%)

Query: 219 LEDVQMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTI--MKLCCT 276
           LE     F VT L   P    LF+G  DG    W L T    +E   L+  I  M +C  
Sbjct: 249 LEVTAHRFSVTCLKIDPLGRYLFSGSKDGSCSIWELRTLICIKEISGLESNILSMDICHL 308

Query: 277 EDYLVIAVSDDSFKTCAVPQDIELHPSAI 305
              L + + D+    C V     ++ S++
Sbjct: 309 GKMLGLCLEDERVCFCDVTTGKIIYESSL 337

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 40/113 (35%), Gaps = 12/113 (10%)

Query: 192 GSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLFTGGADGKIVS 251
           G  DG + V     ++    F  H+           +T L F      L +G  D  I+ 
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGHKA---------AITLLQFDGTGTRLISGSKDSNIIV 147

Query: 252 WNLVTRKKQEEFHKLDDTIMKLCCT-EDYLVIAVSDDSFK--TCAVPQDIELH 301
           W+LV      +     D+I    C  ED+L+    D   K       Q IE H
Sbjct: 148 WDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETH 200

>Kwal_23.3869
          Length = 414

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 223 QMVFPVTALAFQPNSLN--LFTGGADGKIVSWNLVTRKKQEEFH-KLDDTIMKLCCTEDY 279
           + +  VT+L   P      L +G + G I  WNL+TR+   EF       ++ +   + Y
Sbjct: 13  KHIAEVTSLKVVPREPYPILISGDSQGHIYLWNLITRRIFAEFELNSKAHVISVDFIDGY 72

Query: 280 LVIAVSDDSFKTCAVPQDIEL 300
           L +   D + +   + +D  L
Sbjct: 73  LTVLSKDHTLRFLRIEEDTSL 93

>CAGL0K07920g complement(786086..787513) weakly similar to tr|Q06822
           Saccharomyces cerevisiae YPR085c, hypothetical start
          Length = 475

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 10/19 (52%), Positives = 15/19 (78%)

Query: 240 LFTGGADGKIVSWNLVTRK 258
           LF+G  DG++  WNL+TR+
Sbjct: 35  LFSGDIDGEVTIWNLITRR 53

>Kwal_26.7736
          Length = 507

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 30/59 (50%)

Query: 228 VTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSD 286
           VT++AF PN  N F   +  ++  ++  TR+  + F +  D +      +D  ++A+ D
Sbjct: 42  VTSIAFNPNHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGD 100

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 228 VTALAFQPNSLNLFTGGADGKIVSWNLVT 256
           + ALA+ P+   + T   DGKI  W++V+
Sbjct: 359 LNALAYSPDGARIVTAAEDGKIKIWDIVS 387

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 16/72 (22%)

Query: 240 LFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTC-----AV 294
           L T G+DG+IV W++ TR          D +    C E    +AV D+S +         
Sbjct: 294 LVTIGSDGRIVVWDMKTR----------DQVAVYDCGERLNCVAVCDESIEKYDTVKKRA 343

Query: 295 PQDIEL-HPSAI 305
           P+++E+  PS +
Sbjct: 344 PEEVEVGEPSDV 355

>Kwal_27.12239
          Length = 316

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 24/56 (42%)

Query: 225 VFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYL 280
           V P++ + F  N   L     DG +  W+ V  K    F   + + ++  C  D+L
Sbjct: 192 VVPISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTFKSGESSSLRYSCGMDFL 247

>KLLA0B11924g complement(1043344..1047582) similar to sp|P22219
            Saccharomyces cerevisiae YBR097w VPS15 ser/thr protein
            kinase singleton, start by similarity
          Length = 1412

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 5/64 (7%)

Query: 227  PVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEF-----HKLDDTIMKLCCTEDYLV 281
            PVTA+A       + TG  DG +  W+L   +K   F     H+L  +I+ +    +Y V
Sbjct: 1037 PVTAVAANNYKPYIVTGSDDGFLKIWDLSKIEKGSTFKPVVNHELGSSIVDITFIANYDV 1096

Query: 282  IAVS 285
              VS
Sbjct: 1097 FVVS 1100

>Scas_702.16
          Length = 816

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 17/112 (15%)

Query: 156 VKLIQFPSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCH 215
           +KL++ P W ++  E    Y+  +  + P+ +    G +DG++ +   D  S K   +  
Sbjct: 1   MKLLKLP-W-LSHIEESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVD--SIKQIVKIL 56

Query: 216 RMNLE---DVQMVFP----------VTALAFQPNSLNLFTGGADGKIVSWNL 254
            +  E   D ++  P          VT L F PN   L +G  D  ++ W L
Sbjct: 57  SLKDEVPIDKELKKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTL 108

>Kwal_23.6240
          Length = 913

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 108/278 (38%), Gaps = 34/278 (12%)

Query: 25  NRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCHVSKDGRIW---AGSVQGEVLEADW 81
           N +VV   +G   L+++ +  L+ +L       +     D   W     S  G++L  +W
Sbjct: 269 NTLVVGFNNGEFRLYELPEFTLIQQLSMGQNAVNTVCVNDSGEWLAFGSSKLGQLLVYEW 328

Query: 82  ESERLIPNDTMSFSLGVSGITSID-HFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQL 140
           +SE  I      F    +   S D   ++ +S DG + + D +    +  ++        
Sbjct: 329 QSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSA 388

Query: 141 CASEVR--VMCSLS-SGKVK---LIQFPSWDITETESGLKYQCRSCTLIPNNRGFVQGSV 194
            A   R  V+ S S  G V+   L+++ ++        +++ C +    P+      GSV
Sbjct: 389 LAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAAD--PSGEVVCAGSV 446

Query: 195 DGRVSVEFFDDQSPKFAFRCHRMNLEDVQMV-------FPVTALAFQPNSLNLFTGGADG 247
           D               +F  H  +++  Q+V        PV+ L+F   +  L +   D 
Sbjct: 447 D---------------SFAVHVWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASASWDK 491

Query: 248 KIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVS 285
            I  W++  R +Q E  ++   ++ L    D   +A +
Sbjct: 492 TIRIWSIFGRSQQVEPLEVYADVLSLSVRPDGNEVAAA 529

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 28/70 (40%), Gaps = 1/70 (1%)

Query: 228 VTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDD 287
           +  L   P+   + + G DG+I+ WNL  +K        D+          Y + A +  
Sbjct: 199 INTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATAT 258

Query: 288 SFKTCAV-PQ 296
             K  ++ PQ
Sbjct: 259 GIKVFSLDPQ 268

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,752,552
Number of extensions: 400894
Number of successful extensions: 1341
Number of sequences better than 10.0: 77
Number of HSP's gapped: 1293
Number of HSP's successfully gapped: 84
Length of query: 305
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 204
Effective length of database: 13,099,691
Effective search space: 2672336964
Effective search space used: 2672336964
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)