Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A04906g48047325680.0
Kwal_47.1746249248513880.0
AGR167W51247512521e-169
CAGL0G01254g50449210491e-138
Sklu_2253.249848410431e-138
Kwal_47.1898249649010241e-135
YGL202W (ARO8)50048310221e-135
Scas_712.4849748310061e-132
KLLA0F10021g4974929841e-129
AFR548C4974769371e-122
Kwal_33.145825253874805e-54
KLLA0D11110g5304874702e-52
Sklu_2392.15304764641e-51
Scas_697.115103964585e-51
YHR137W (ARO9)5134464542e-50
CAGL0G06028g5374334431e-48
AGR141C4382271371e-08
CAGL0I06578g4362371352e-08
YER152C4432031211e-06
CAGL0J05126g4473011201e-06
YJL060W (BNA3)4442331093e-05
Scas_555.74461081093e-05
Sklu_2389.74472311093e-05
Kwal_8.5854462751093e-05
Kwal_14.25744432721022e-04
KLLA0E00935g4452211022e-04
CAGL0L12254g5741241013e-04
KLLA0F01617g444231987e-04
Kwal_56.23791518166970.001
Scas_711.52445235950.001
YLR089C592124950.001
AGR085W521139940.002
YDR111C507129880.010
AEL170C458222880.011
KLLA0F19162g528124860.021
Scas_681.2568125770.21
Scas_693.9497122770.25
Scas_693.17104946674.4
AFR004W38339655.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04906g
         (473 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04906g 437523..438965 similar to sp|P53090 Saccharomyces c...   993   0.0  
Kwal_47.17462                                                         539   0.0  
AGR167W [4478] [Homologous to ScYGL202W (ARO8) - NSH] complement...   486   e-169
CAGL0G01254g 119281..120795 highly similar to sp|P53090 Saccharo...   408   e-138
Sklu_2253.2 YGL202W, Contig c2253 1349-2845                           406   e-138
Kwal_47.18982                                                         399   e-135
YGL202W (ARO8) [1793] chr7 (116061..117563) Aromatic amino acid ...   398   e-135
Scas_712.48                                                           392   e-132
KLLA0F10021g 926569..928062 similar to sp|P53090 Saccharomyces c...   383   e-129
AFR548C [3740] [Homologous to ScYGL202W (ARO8) - SH] (1421841..1...   365   e-122
Kwal_33.14582                                                         189   5e-54
KLLA0D11110g 948248..949840 similar to sp|P38840 Saccharomyces c...   185   2e-52
Sklu_2392.1 YHR137W, Contig c2392 2001-3593                           183   1e-51
Scas_697.11                                                           181   5e-51
YHR137W (ARO9) [2424] chr8 (375710..377251) Aromatic amino acid ...   179   2e-50
CAGL0G06028g complement(579261..580874) similar to sp|P38840 Sac...   175   1e-48
AGR141C [4452] [Homologous to ScYER152C - SH] (1013962..1015278)...    57   1e-08
CAGL0I06578g 637311..638621 similar to sp|P10356 Saccharomyces c...    57   2e-08
YER152C (YER152C) [1581] chr5 complement(472652..473983) Protein...    51   1e-06
CAGL0J05126g complement(484849..486150) highly similar to sp|P47...    51   1e-06
YJL060W (BNA3) [2851] chr10 (323302..324636) Protein predicted t...    47   3e-05
Scas_555.7                                                             47   3e-05
Sklu_2389.7 YJL060W, Contig c2389 13116-14459 reverse complement       47   3e-05
Kwal_8.585                                                             47   3e-05
Kwal_14.2574                                                           44   2e-04
KLLA0E00935g 101430..102767 similar to sp|P10356 Saccharomyces c...    44   2e-04
CAGL0L12254g complement(1324815..1326539) similar to sp|P52893 S...    44   3e-04
KLLA0F01617g complement(154025..155359) highly similar to sp|P47...    42   7e-04
Kwal_56.23791                                                          42   0.001
Scas_711.52                                                            41   0.001
YLR089C (YLR089C) [3504] chr12 complement(318238..320016) Putati...    41   0.001
AGR085W [4395] [Homologous to ScYLR089C - SH; ScYDR111C - SH] co...    41   0.002
YDR111C (YDR111C) [960] chr4 complement(678235..679758) Protein ...    39   0.010
AEL170C [2336] [Homologous to ScYJL060W - SH] (318032..319408) [...    39   0.011
KLLA0F19162g complement(1775240..1776826) similar to sp|P52893 S...    38   0.021
Scas_681.2                                                             34   0.21 
Scas_693.9                                                             34   0.25 
Scas_693.17                                                            30   4.4  
AFR004W [3196] [Homologous to ScYLR321C (SFH1) - SH] complement(...    30   5.9  

>KLLA0A04906g 437523..438965 similar to sp|P53090 Saccharomyces
           cerevisiae YGL202w ARO8 aromatic amino acid
           aminotransferase I, start by similarity
          Length = 480

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/473 (100%), Positives = 473/473 (100%)

Query: 1   MTVKDMGCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISF 60
           MTVKDMGCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISF
Sbjct: 1   MTVKDMGCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISF 60

Query: 61  KSVSLDDVNGTGAVEGCIHRDKSDLEICQDVPLGVALQYGNSRGQPELISFLKEHTSIFH 120
           KSVSLDDVNGTGAVEGCIHRDKSDLEICQDVPLGVALQYGNSRGQPELISFLKEHTSIFH
Sbjct: 61  KSVSLDDVNGTGAVEGCIHRDKSDLEICQDVPLGVALQYGNSRGQPELISFLKEHTSIFH 120

Query: 121 NISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMD 180
           NISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMD
Sbjct: 121 NISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMD 180

Query: 181 KDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFI 240
           KDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFI
Sbjct: 181 KDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFI 240

Query: 241 IIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVS 300
           IIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVS
Sbjct: 241 IIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVS 300

Query: 301 KTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWLLRL 360
           KTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWLLRL
Sbjct: 301 KTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWLLRL 360

Query: 361 RNSYSMKRDHCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFEREFKSKVDLLEE 420
           RNSYSMKRDHCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFEREFKSKVDLLEE
Sbjct: 361 RNSYSMKRDHCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFEREFKSKVDLLEE 420

Query: 421 HLYNSFVQNGMLLACSSWFRVDPNHNKILAFRGSYASVDAEKMQNGIIMLGNV 473
           HLYNSFVQNGMLLACSSWFRVDPNHNKILAFRGSYASVDAEKMQNGIIMLGNV
Sbjct: 421 HLYNSFVQNGMLLACSSWFRVDPNHNKILAFRGSYASVDAEKMQNGIIMLGNV 473

>Kwal_47.17462
          Length = 492

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/485 (54%), Positives = 339/485 (69%), Gaps = 13/485 (2%)

Query: 1   MTVKDMGCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISF 60
           MT +  G   +  HL S+EA  RK SPIKTTM YF DPNIVFLGAGMP   +FP +S+S 
Sbjct: 1   MTGEAAGKARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSL 60

Query: 61  KSVSLDDVNGTG----AVEGCIHRDKSDLEICQDVPLGVALQYGNSRGQPELISFLKEHT 116
           +      V+G G     ++  I +++ DL    DVPL  ALQYGNSRGQ EL+++LKEHT
Sbjct: 61  ELPKPPFVDGIGECKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHT 120

Query: 117 SIFHNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVA 176
           S+FH I   DWD+ITT GSTQ WDA LR+FCN+G+TVL+EEYTYSSS+EAA AQGLNC+ 
Sbjct: 121 SLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIP 180

Query: 177 MKMDKDGIKVDKLSEMLRDW-DVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLAS 235
           M +D +GI  +KL EML +W D+    P PKLLYTIP G NPTGCTL + RKP +  LA 
Sbjct: 181 MPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQ 240

Query: 236 QYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIR 295
           +YD IIIED+PYYFLQM+++   E  +    +      E F+  LG+S LE D  GR++R
Sbjct: 241 KYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAE-FIGSLGKSFLELDVEGRVVR 299

Query: 296 LESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMK 355
           L+SVSKTFAPGCR+GW +G ++LLD+ WN HEVS+QSTCGFAQ+++ G+  RWGQ GY+ 
Sbjct: 300 LDSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYID 359

Query: 356 WLLRLRNSYSMKRDHCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFEREFKSKV 415
           WL+ +R  Y++KR+ CL  C+KYLP +V ++    +GMFFM+YID  KHP F   F    
Sbjct: 360 WLIGIRQEYTVKRNTCLDLCRKYLPAQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNGDY 419

Query: 416 DLLEEHLYNSFVQNGMLLACSSWFRV-DPNHN------KILAFRGSYASVDAEKMQNGII 468
            L+E+H+Y   V  G+L+ CSSWF+V DP+ +      K LAFRG+YASV  E M NG+ 
Sbjct: 420 LLMEQHIYRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLE 479

Query: 469 MLGNV 473
           +LGNV
Sbjct: 480 ILGNV 484

>AGR167W [4478] [Homologous to ScYGL202W (ARO8) - NSH]
           complement(1059796..1061334) [1539 bp, 512 aa]
          Length = 512

 Score =  486 bits (1252), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 240/475 (50%), Positives = 314/475 (66%), Gaps = 11/475 (2%)

Query: 1   MTVKDMGCRTNVL-HLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESIS 59
           MT +D   +   L HLLS EA  R+ SPIKTTM YF +  +VFLGAGMP   +FP  ++S
Sbjct: 1   MTQEDQQNKAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVS 60

Query: 60  FKSVSLDDVNGTGAVEGCIHRDKSDLEICQDVPLGVALQYGNSRGQPELISFLKEHTSIF 119
            + V +   +G   V G I +   + E  +DVPL  ALQYGNSRGQ EL+ FL++HT  F
Sbjct: 61  VE-VPVPGEDGQTLV-GRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKF 118

Query: 120 HNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKM 179
           H +   DWD++ TAGSTQAWDA +RLFCN G++V+ME +TYSSS+EAA AQGL CV M++
Sbjct: 119 HKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEV 178

Query: 180 DKDGIKVDKLSEMLRDWDVAVQG-PFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYD 238
           D +GI  ++L+E+L +WD    G   P++LYTIP G NP G TL + RK ++ RLA QYD
Sbjct: 179 DSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYD 238

Query: 239 FIIIEDDPYYFLQMNEFGAPELN----VPGDVNEMQWFKENFVNKLGRSLLEWDDVGRII 294
            +I+EDDPYYFLQM+ + A          G    ++     F + L RS L+WD  GR++
Sbjct: 239 MLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVV 298

Query: 295 RLESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYM 354
           RLES SK FAPGCR GW +G R LLD  W   EVS+QSTCGFAQ +++GM  RWGQ  Y 
Sbjct: 299 RLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYT 358

Query: 355 KWLLRLRNSYSMKRDHCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFEREFKSK 414
            WL+ LR  Y+ +RDHCL  C KYLP+ V  +  P +GMFFM+ +D   HP F  +F S 
Sbjct: 359 NWLIDLRLEYTARRDHCLDCCHKYLPDFV-HVEPPQAGMFFMLVLDAALHPGFASDFSSS 417

Query: 415 VDLLEEHLYNSFVQNGMLLACSSWFRVD--PNHNKILAFRGSYASVDAEKMQNGI 467
              LE HLY++F++NG+LLAC SWF V+  P+    + FRG+YA+VD   M+ GI
Sbjct: 418 PQRLETHLYDTFIKNGVLLACGSWFAVNRSPSKGTSIYFRGTYAAVDPASMEAGI 472

>CAGL0G01254g 119281..120795 highly similar to sp|P53090
           Saccharomyces cerevisiae YGL202w ARO8, start by
           similarity
          Length = 504

 Score =  408 bits (1049), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 202/492 (41%), Positives = 300/492 (60%), Gaps = 34/492 (6%)

Query: 11  NVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISFKSVSLDDVNG 70
           +  +  S+E K RK SP+KT ++YFSDPN++FLG G+P    FP+++++  +      NG
Sbjct: 8   DFTYFFSEETKARKPSPLKTCIQYFSDPNMIFLGGGLPMSAYFPWDNLAADTPLPPFTNG 67

Query: 71  TGAVEGCIHRDKSDLEICQ-------DVPLGVALQYGNSRGQPELISFLKEHTSIFHNIS 123
            GA       D S   + +       D+PL  +LQYG S GQPEL  FLKEHT + H++ 
Sbjct: 68  IGATITGSQEDTSKFSVKKESKVHEGDIPLARSLQYGKSMGQPELTDFLKEHTKMIHDMK 127

Query: 124 INDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMDKDG 183
            +DWD++ T G+T AW++ LR+FCNRG+ +L E +++SSSL +A AQG+    + +D  G
Sbjct: 128 YSDWDVVATTGNTNAWESTLRVFCNRGDVILAEAHSFSSSLASAEAQGIITFPVPIDAHG 187

Query: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243
           I  +KL  +L +W      P PKLLYTIP G NPTG +L+ ERK E+ R+A ++DF+IIE
Sbjct: 188 IIPEKLEALLDNWTEG--APKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIE 245

Query: 244 DDPYYFLQMNEFGAPELNVPGDVNE--MQWFKENFVNKLGRSLLEWDDVGRIIRLESVSK 301
           D+PYYFLQ+ E+ + +L+   +V +       E+F+  L  + L  D  GR+IR++S SK
Sbjct: 246 DEPYYFLQVGEYIS-DLSKRAEVAQKNANISHEDFLKSLALTFLSVDTDGRVIRMDSFSK 304

Query: 302 TFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWLLRLR 361
             APG RLGW  G   LL    + HE+++QS  GF+Q+L++G   RWGQ GY+ WL+ LR
Sbjct: 305 VLAPGTRLGWITGSSKLLQAYLSLHEMTIQSPSGFSQSLVSGTLNRWGQKGYIDWLIGLR 364

Query: 362 NSYSMKRDHCLTQCQKYLPNE-------VCSINLPISGMFFMVYIDPHKHPKFEREFKSK 414
           + Y+ KRDHC+    K++P +       + +IN PI+GMFF V +D   HP+F   ++S 
Sbjct: 365 HEYTAKRDHCIDSLYKFIPKDNNKEGKPIFTINPPIAGMFFTVDMDASAHPEFATTYESD 424

Query: 415 VDLLEEHLYNSFVQNGMLLACSSWFRVD--------------PNHNKILAFRGSYASVDA 460
              +EE LY   +++G+L+    WF+ D              PN N+I  FRG+YA+V+ 
Sbjct: 425 PTKVEEALYQKVIKSGVLVVPGIWFKADGETTPAQPASSKENPNPNQIF-FRGTYAAVEP 483

Query: 461 EKMQNGIIMLGN 472
            K+  G+  LG 
Sbjct: 484 SKLDEGLKRLGQ 495

>Sklu_2253.2 YGL202W, Contig c2253 1349-2845
          Length = 498

 Score =  406 bits (1043), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/484 (41%), Positives = 295/484 (60%), Gaps = 29/484 (5%)

Query: 14  HLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISFKSVSLDDVNGTGA 73
           HL SDE   RK SP+KT +  F DPNI+FLG G+P  + FP++ ++ +S      NG GA
Sbjct: 11  HLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPMSDYFPWDKVTAESPLPPFANGIGA 70

Query: 74  VEGCIHRDKSDLEI----------CQDVPLGVALQYGNSRGQPELISFLKEHTSIFHNIS 123
           V      D   L I           +D+ L  ALQYG S+GQPEL+ F+++HTS+ H+I 
Sbjct: 71  VPSGGDEDTCHLTIRKNEITKAGDSKDIHLARALQYGFSQGQPELMEFVRKHTSLVHDIK 130

Query: 124 INDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMDKDG 183
             DWD++ TAG+T AW++ LR+FCNRG+T+L E Y++SSSL AA AQG+N   + +D+ G
Sbjct: 131 YADWDVLATAGNTNAWESTLRVFCNRGDTILAEAYSFSSSLYAAEAQGVNVFPVPLDEFG 190

Query: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243
           I  +KL  ++ +W+   + P PKLLYTIP G NPTG +L ++RK ++ R+A +++FIIIE
Sbjct: 191 IIPEKLESIMDNWN--PETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIE 248

Query: 244 DDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTF 303
           D+PYYFLQM  +     +      +     + F+  L +S +  D  GR++RL+S SK  
Sbjct: 249 DEPYYFLQMEPYVK---DASAREKKTYSSHDEFIQSLAKSFISLDTDGRVVRLDSFSKVL 305

Query: 304 APGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWLLRLRNS 363
           APG RLGW +G + +L+     HE+++Q+  GF Q+L+ G   RWGQ GY+ WL+ LR+ 
Sbjct: 306 APGTRLGWIVGSKKILEPYLRLHEMTIQAPSGFTQSLVAGTLNRWGQDGYVDWLIGLRHE 365

Query: 364 YSMKRDHCLTQCQKYLPN-EVCSINLPISGMFFMVYIDPHKHPKFEREFKSKVDLLEEHL 422
           Y+ KRD  +    KYLP      IN PI+GMFF + ID   HP+F   ++S  +L+E+ +
Sbjct: 366 YTHKRDVAIDALYKYLPKGSFIKINPPIAGMFFTINIDSSAHPEFSTTYQSNPELVEKAI 425

Query: 423 YNSFVQNGMLLACSSWFRVD-------PNHNKILA------FRGSYASVDAEKMQNGIIM 469
           Y   V  G+L+    WF+ D       P  +K++       FRG+YA+V  EK+  G+  
Sbjct: 426 YEKVVSQGVLVVPGIWFKTDGETQPPQPKESKVVLKPNEIFFRGTYAAVPLEKLVQGVKR 485

Query: 470 LGNV 473
           LG+ 
Sbjct: 486 LGDA 489

>Kwal_47.18982
          Length = 496

 Score =  399 bits (1024), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 197/490 (40%), Positives = 296/490 (60%), Gaps = 29/490 (5%)

Query: 6   MGCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISFKSVSL 65
           +G   +  HL S+E K RK+SP+KT +  F DPNIVFLG G+P    FP++++  +S   
Sbjct: 3   VGESRDFSHLYSEETKARKSSPLKTCIHLFQDPNIVFLGGGLPQSKYFPWDNLQAESPLP 62

Query: 66  DDVNGTGAVEGCIHRDKSDLEI----------CQDVPLGVALQYGNSRGQPELISFLKEH 115
             VNG G        D   + I            D+PL  ALQYG S GQPE +SF++EH
Sbjct: 63  PFVNGIGETPSGDASDTCHIAIKKDGVSKAGSSTDIPLSRALQYGFSMGQPEFLSFVREH 122

Query: 116 TSIFHNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCV 175
           T + H +  +DW+++ T G+T +W++ LR+FCNRG+T+L E+YT+SSS+ AA AQG+N  
Sbjct: 123 TQLVHKMKYSDWNVLATTGNTGSWESTLRIFCNRGDTILAEQYTFSSSVYAAEAQGINVF 182

Query: 176 AMKMDKDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLAS 235
            + +D DG+  ++L  +L +W+       PKLLYTIP G NPTG +L ++RK E+ R+A 
Sbjct: 183 PVPLDADGLIPERLEAILDNWNPDTAK--PKLLYTIPTGQNPTGSSLSDDRKVEIYRIAK 240

Query: 236 QYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIR 295
           ++D +IIED+PYYFLQM+ +   + +V          +E+FVN L +S +  D  GR++R
Sbjct: 241 KHDLLIIEDEPYYFLQMDAY---QKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLR 297

Query: 296 LESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMK 355
           L+S SK   PG RLGW +G + +L      HE+++Q+  GF+Q ++ G   RWGQ G++ 
Sbjct: 298 LDSFSKVLGPGTRLGWIVGSKKILQKYTQLHEMTIQNPSGFSQAIVAGTLNRWGQDGFLD 357

Query: 356 WLLRLRNSYSMKRDHCLTQCQKYLP-NEVCSINLPISGMFFMVYIDPHKHPKFEREFKSK 414
           WL+ LR  Y+ KRD  +    KYLP     +IN PI+GMFF V  D   HP+F  +++SK
Sbjct: 358 WLVGLRREYNEKRDVAIDALYKYLPETPAFTINPPIAGMFFTVNTDASAHPEFATKYQSK 417

Query: 415 VDLLEEHLYNSFVQNGMLLACSSWFRV-------DPNHNKI------LAFRGSYASVDAE 461
            +L+E+ +Y   + +G+L+    WF+         P  +K+      + FRG+YA+V  +
Sbjct: 418 PELVEQAIYEKVIASGVLVVPGVWFKATGDTNPPQPAESKLELDPNGIFFRGTYAAVPLD 477

Query: 462 KMQNGIIMLG 471
           K+Q GI   G
Sbjct: 478 KLQEGIQRFG 487

>YGL202W (ARO8) [1793] chr7 (116061..117563) Aromatic amino acid
           aminotransferase I [1503 bp, 500 aa]
          Length = 500

 Score =  398 bits (1022), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 198/483 (40%), Positives = 296/483 (61%), Gaps = 25/483 (5%)

Query: 14  HLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISFKSVSLDDVNGTGA 73
           +L SDE   RK SP+KT +  F DPNI+FLG G+P  + FP++++S  S       G GA
Sbjct: 11  YLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLKDYFPWDNLSVDSPKPPFPQGIGA 70

Query: 74  -------VEGCIHRDKSDLEI--CQDVPLGVALQYGNSRGQPELISFLKEHTSIFHNISI 124
                  ++  +++D +D       D+PL  ALQYG S GQPEL++F+++HT I H++  
Sbjct: 71  PIDEQNCIKYTVNKDYADKSANPSNDIPLSRALQYGFSAGQPELLNFIRDHTKIIHDLKY 130

Query: 125 NDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGI 184
            DWD++ TAG+T AW++ LR+FCNRG+ +L+E +++SSSL +A AQG+    + +D DGI
Sbjct: 131 KDWDVLATAGNTNAWESTLRVFCNRGDVILVEAHSFSSSLASAEAQGVITFPVPIDADGI 190

Query: 185 KVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIED 244
             +KL++++ +W      P PKLLYTIP G NPTG ++ + RK  + ++A +YDF+I+ED
Sbjct: 191 IPEKLAKVMENWTPG--APKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVED 248

Query: 245 DPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFA 304
           +PYYFLQMN +           +  +   + F+  L  + L  D  GR+IR++S SK  A
Sbjct: 249 EPYYFLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTEGRVIRMDSFSKVLA 308

Query: 305 PGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWLLRLRNSY 364
           PG RLGW  G   +L    + HE+++Q+  GF Q L+N    RWGQ GY+ WLL LR+ Y
Sbjct: 309 PGTRLGWITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLSRWGQKGYLDWLLGLRHEY 368

Query: 365 SMKRDHCLTQCQKYLP-NEVCSINLPISGMFFMVYIDPHKHPKFEREFKSKVDLLEEHLY 423
           ++KRD  +    KYLP ++   IN PI+GMFF V ID   HP+F+ ++ S    LE+ LY
Sbjct: 369 TLKRDCAIDALYKYLPQSDAFVINPPIAGMFFTVNIDASVHPEFKTKYNSDPYQLEQSLY 428

Query: 424 NSFVQNGMLLACSSWFRVD-------PNHNK------ILAFRGSYASVDAEKMQNGIIML 470
           +  V+ G+L+   SWF+ +       P  +K      I+ FRG+YA+V  EK+  G+  L
Sbjct: 429 HKVVERGVLVVPGSWFKSEGETEPPQPAESKEVSNPNIIFFRGTYAAVSPEKLTEGLKRL 488

Query: 471 GNV 473
           G+ 
Sbjct: 489 GDT 491

>Scas_712.48
          Length = 497

 Score =  392 bits (1006), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 199/483 (41%), Positives = 289/483 (59%), Gaps = 26/483 (5%)

Query: 14  HLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISFKSVSLDDVNGTGA 73
           HL SDE   RK SP+KT +  F DPNI+FLG G+P  + FP++++S  S +     G G 
Sbjct: 11  HLYSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLSDYFPWDNVSIDSPAPPFTKGIGH 70

Query: 74  V-------EGCIHRDKSDLEICQ-DVPLGVALQYGNSRGQPELISFLKEHTSIFHNISIN 125
                   E C    K D+++ + D+PL  +LQYG S+GQPEL+ F++EH  + H++   
Sbjct: 71  PISELSNDEVCKVDLKKDVKVHEGDIPLARSLQYGFSQGQPELLEFIREHNKLIHDMQYE 130

Query: 126 DWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGIK 185
           DWD++ TAG+T AW++ LR+FCNRG+ +L E +++SS L AA AQG+    + +D  GI 
Sbjct: 131 DWDVVATAGNTNAWESTLRVFCNRGDVILAEAHSFSSCLAAAQAQGITTFPVPIDDKGII 190

Query: 186 VDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDD 245
             KL  +L +W      P PKLLYTIP G NPTG +L +ERKPE+ R+A ++DF+IIED 
Sbjct: 191 PAKLEAILDNWTPG--APKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 246 PYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAP 305
           PYYFLQM+++            + +   ++F+  L ++ L  D  GR+IRL+S SK  AP
Sbjct: 249 PYYFLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFLSVDTDGRVIRLDSFSKVLAP 308

Query: 306 GCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWLLRLRNSYS 365
           G RLGW  G + +L    + HE+++Q+  GF Q++++    RWGQ GY+ WL  LR+ Y+
Sbjct: 309 GSRLGWITGSKKILKPFVSLHEMTIQAPAGFIQSVVSSTLHRWGQSGYLDWLQGLRHEYT 368

Query: 366 MKRDHCLTQCQKYLP-NEVCSINLPISGMFFMVYIDPHKHPKFEREFKSKVDLLEEHLYN 424
           +KRD  +    KY+P N+   IN PI+GMFF V ID   HP+F+ ++ S    +E  LY 
Sbjct: 369 LKRDCAIDALHKYIPENKAFVINPPIAGMFFTVNIDASTHPEFKTKYDSDPKKVEHALYE 428

Query: 425 SFVQNGMLLACSSWF-----RVDP---------NHNKILAFRGSYASVDAEKMQNGIIML 470
             +  G+L+    WF      V P         N N+I  FRG+YA+V  EK+  G+  L
Sbjct: 429 KVISRGVLVVPGDWFITEGDTVPPQPAASKERENPNEIF-FRGTYAAVSPEKLTEGLKRL 487

Query: 471 GNV 473
           G  
Sbjct: 488 GET 490

>KLLA0F10021g 926569..928062 similar to sp|P53090 Saccharomyces
           cerevisiae YGL202w ARO8 aromatic amino acid
           aminotransferase I, start by similarity
          Length = 497

 Score =  383 bits (984), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 194/492 (39%), Positives = 296/492 (60%), Gaps = 34/492 (6%)

Query: 7   GCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISFKSVSLD 66
           G   +  HL SDE K R  S +K+ + YF+DPN++FLG G+P  + FP+++++ +S    
Sbjct: 4   GVAKDFSHLYSDETKSRMPSQLKSIIHYFNDPNLIFLGGGLPMSDYFPWDNLTVESPLPP 63

Query: 67  DVNGTGA------VEGCIHRDKSDLEICQ---DVPLGVALQYGNSRGQPELISFLKEHTS 117
             NG GA       + C      +LE  Q   D+PL  +LQYG S+GQPE+  F KEH S
Sbjct: 64  FSNGIGAKPSGDDADTCQIHITKNLEESQKGVDIPLSRSLQYGYSQGQPEITKFFKEHHS 123

Query: 118 IFHNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAM 177
           + H++   +WD++ T G+T AW++ LR+FCNRG+T+L E++ +SSS+ AA AQG+N   +
Sbjct: 124 LIHDMKYENWDVLATIGNTGAWESVLRIFCNRGDTILAEQFAFSSSISAAEAQGVNVFPI 183

Query: 178 KMDKDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQY 237
            +D+ GI   KL  +L +W        PKLLYT+P G NPTG +L  +RK E+ R+A ++
Sbjct: 184 PLDEHGIIPSKLETILDNWTEGAAK--PKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKH 241

Query: 238 DFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLE 297
           DFIIIED+PYYFLQM ++   E +    V +     + F+  L +S +  D  GR++RL+
Sbjct: 242 DFIIIEDEPYYFLQMEKY---EKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLD 298

Query: 298 SVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWL 357
           S+SK  APG R GW +G + +L  + +  E+++Q+  GF Q++I G   RWGQ GY+ WL
Sbjct: 299 SLSKVLAPGTRFGWIVGAKDILARILSLQEMTIQAPAGFTQSIIAGTMNRWGQEGYLDWL 358

Query: 358 LRLRNSYSMKRDHCLTQCQKYLPN-EVCSINLPISGMFFMVYIDPHKHPKFEREFKSKVD 416
           + LR+ Y+ KRD C+    KYLP  +   IN PI+GMFF V ID  KHP+F  ++ S  +
Sbjct: 359 IGLRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFATKYGSDPE 418

Query: 417 LLEEHLYNSFVQNGMLLACSSWFRVD----------------PNHNKILAFRGSYASVDA 460
            +E+ +++  + +G+L+   +WF+                  PN    + FRG+YA+V  
Sbjct: 419 KVEKAIFDRSIASGVLVVPGNWFKSQGQTTPPQPEASFKSEKPNE---IFFRGTYAAVPL 475

Query: 461 EKMQNGIIMLGN 472
           +KM  G+   G+
Sbjct: 476 DKMTVGLHRFGD 487

>AFR548C [3740] [Homologous to ScYGL202W (ARO8) - SH]
           (1421841..1423334) [1494 bp, 497 aa]
          Length = 497

 Score =  365 bits (937), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 191/476 (40%), Positives = 289/476 (60%), Gaps = 23/476 (4%)

Query: 16  LSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISFKSVSLDDVNGT-GAV 74
            S+E K R  SP+KT ++Y++DP+I+FLG G+P   +FP++S+S    +     GT G +
Sbjct: 15  FSEETKARIPSPLKTCLRYYNDPDIIFLGGGLPRSELFPWDSVSASCAAPPFKTGTAGGM 74

Query: 75  EGCIHRDKSD------LEICQDVPLGVALQYGNSRGQPELISFLKEHTSIFHNISINDWD 128
           +  +H  KS       +   +DVPL  ALQYG S+GQPEL+ F++EHT   H +   DWD
Sbjct: 75  Q--LHVAKSGQSANAVVSGARDVPLERALQYGFSQGQPELMDFVREHTRRLHRMQYADWD 132

Query: 129 LITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGIKVDK 188
           ++ T G+T AW++ LR+FCNRG+T+L EEYT+SSSL AA AQG+    + +D++G+  ++
Sbjct: 133 VLATVGNTSAWESTLRVFCNRGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDENGMVPER 192

Query: 189 LSEMLRDWDVAVQG-PFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPY 247
           L E+L +W+    G P PKLLYT+P G NPTG  L  +R+  + RLA Q+D +I+ED+PY
Sbjct: 193 LGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPY 252

Query: 248 YFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAPGC 307
           YFLQ++ +   E +       +    E FV  L RS L  D  GR++RL+S SK  APG 
Sbjct: 253 YFLQLDPY---EADAGRRAPRVFASHEEFVGSLVRSFLSLDTDGRVLRLDSFSKVLAPGT 309

Query: 308 RLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMKWLLRLRNSYSMK 367
           RLGW  G + LL       E+++Q+  GF  +LI G   RWGQ  Y+ WL+ LR  Y+  
Sbjct: 310 RLGWIAGAKQLLQAYLALLELTVQAPSGFTSSLIAGTLTRWGQEHYIDWLIELRREYTHL 369

Query: 368 RDHCLTQCQKYLPNEV-CSINLPISGMFFMVYIDPHKHPKFEREFKSKVDLLEEHLYNSF 426
           RD  +    +Y+P +    +N   +GMFF V+++   HP+F  E++S+ + +E  LY   
Sbjct: 370 RDVVMDALHRYIPAKPWVRVNPTEAGMFFTVHLNAAAHPRFVSEYESQPERVEWALYEKM 429

Query: 427 VQNGMLLACSSWFRV---DPNHNKILA------FRGSYASVDAEKMQNGIIMLGNV 473
           + +G+L     WFR    DP+ ++         FRG++A+V+ +K+  GI  LG++
Sbjct: 430 IAHGVLAVPGMWFRTGGKDPSRSRQAGDTNNIFFRGTFAAVEEDKLVVGIQRLGSM 485

>Kwal_33.14582
          Length = 525

 Score =  189 bits (480), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 115/387 (29%), Positives = 193/387 (49%), Gaps = 54/387 (13%)

Query: 38  PNIVFLGAGMPSGNMFPFESISFKSVSLD------DVNGTGAVEGC------------IH 79
           P  + L AG+P+   FP ES+    V         D N     +G             + 
Sbjct: 37  PKPIDLSAGLPNEGFFPLESLHLNVVDEPFQLTPCDANSHKLHQGVPKTGSEFDEREFVT 96

Query: 80  RD----------KSDLEICQDVPLGVALQYGNSRGQPELISFLKEHTSIFHNISINDWDL 129
           R           + D +    +PL  ALQY  +RG P LI F K+  S  +  +  DWDL
Sbjct: 97  RKIDSGSMVDVWRYDPDAPSVIPLSRALQYTATRGMPPLIDFCKDFISYVNPPAYADWDL 156

Query: 130 ITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMD------KDG 183
               G++ +        C++GE VL+EE+T++ +L    A G   V +K++        G
Sbjct: 157 TLANGTSDSLFKIFETLCDQGEAVLVEEFTFAPTLSNIRAAGGVPVPVKLNISADPQVQG 216

Query: 184 IKVDKLSEMLRDWDVAVQGPF-----PKLLYTIPNGHNPTGCTLHEERKPELVRLASQYD 238
           I +  L+E+L +W   VQGP+     PKLLYTIP G NPTG TL  E++ ++  LA ++D
Sbjct: 217 IDIGHLTELLDNW---VQGPYAHLSRPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHD 273

Query: 239 FIIIEDDPYYFLQMNEF--GAPELNVPGDVNEMQWFKENFVNK-LGRSLLEWDDVGRIIR 295
           FII+EDDPY +L+  ++    P+ N         +  + + +K L  S +  D   R++R
Sbjct: 274 FIIVEDDPYGYLKFPQYDPANPDYN---PYESHTYSIDEYCHKVLSPSFITIDKSARVLR 330

Query: 296 LESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWG------ 349
            E+ SK F+PG RL + +G ++L+  + ++ EVS ++  G +Q ++N + Q+W       
Sbjct: 331 CETFSKVFSPGLRLSFVVGNKFLISKIIDFAEVSSRAPSGVSQMIVNNVIQKWAKDYRNP 390

Query: 350 QIGYMKWLLRLRNSYSMKRDHCLTQCQ 376
           Q  ++ W++++   Y+ +R+  +   +
Sbjct: 391 QEAWLTWVMKVAGQYTERRNKLVQALE 417

>KLLA0D11110g 948248..949840 similar to sp|P38840 Saccharomyces
           cerevisiae YHR137w ARO9 aromatic amino acid
           aminotransferase II, start by similarity
          Length = 530

 Score =  185 bits (470), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 140/487 (28%), Positives = 230/487 (47%), Gaps = 64/487 (13%)

Query: 38  PNIVFLGAGMPSGNMFPFESI--------------SFKS----VSLDDVNGTGAVEGCIH 79
           PN   L AGMP+  +FP ES+               FKS    V      G    E    
Sbjct: 43  PNPYVLAAGMPNEGLFPVESVHVNVVERPFQHLEYPFKSEKIHVGAAGEIGVNEAEYVKS 102

Query: 80  R--DKSDLEICQ-------DVPLGVALQYGNSRGQPELISFLKEHTSIFHNISINDWDLI 130
           R  D S ++I +       ++P+  ALQY +++G P+LI F K+  S  +  + ++WD++
Sbjct: 103 RVDDGSMVDIWRYDPSHGDNIPIAQALQYSDTKGFPQLIDFSKKLVSYLNKPAYDNWDVM 162

Query: 131 TTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMD------KDGI 184
              GS+ +         +   TVLMEE+T++ ++    A G   + +K+D      + GI
Sbjct: 163 LANGSSDSLSKVFTTLTDEDVTVLMEEFTFTPTISNVTANGGIPIPLKVDITDDASQQGI 222

Query: 185 KVDKLSEMLRDWDVAVQGPF--PKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIII 242
            V+ + ++L +W          P+LLYTI  G NPTG T  +E++ ++  L  ++D II+
Sbjct: 223 NVEYMDQLLENWSTGEYSHLSKPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIIIV 282

Query: 243 EDDPYYFLQMNEFGA--PELNV--PGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLES 298
           EDDPY +L+   F    P  N    G +   ++ KE     L  S L  D  GR+IRLE+
Sbjct: 283 EDDPYGYLKFLPFDKSDPLKNQYNDGTITFDKYCKE----ILAPSYLTIDTSGRVIRLET 338

Query: 299 VSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQ-------I 351
            SK FAPG RL + +  +++LD L  Y ++S++S CG AQ +   +  +W +        
Sbjct: 339 FSKVFAPGMRLSFIVANKFILDKLLKYADISVRSPCGLAQAMTINIIDKWAENFNGDKVR 398

Query: 352 GYMKWLLRLRNSYSMKRDHCLTQCQKYLP---NEVCSINLPISGMFFMVYIDPHKHPKFE 408
            ++ W++++   Y+ +R+  L Q  +  P    E+  +  P +GMF  + I+  K  +  
Sbjct: 399 AWLSWVMKVAGEYTHRRN-VLFQALEATPAYKEELFELIEPSAGMFISIKINFDKFGEIS 457

Query: 409 REFKS----KVDLLEEHLYNSFVQNGMLLACSSWFRVDPNHNKILAFRGSYASVDAEKMQ 464
            + K+       LLEE      V  G  +A    F  D ++   + F     + D E +Q
Sbjct: 458 DKLKAMNFLNYKLLEE---GCIVILGYRMAVDKKFSYDRSNFLRITFA---MAPDEEHLQ 511

Query: 465 NGIIMLG 471
                LG
Sbjct: 512 TAAERLG 518

>Sklu_2392.1 YHR137W, Contig c2392 2001-3593
          Length = 530

 Score =  183 bits (464), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 139/476 (29%), Positives = 225/476 (47%), Gaps = 59/476 (12%)

Query: 38  PNIVFLGAGMPSGNMFPFESISFKSVSLDDVNGTGAVEG-CIHRD--KSDLEI------- 87
           P+ + L AGMP+  +FP ESI    VS    + +   +   +H+D  + D E        
Sbjct: 43  PSPIELAAGMPNEGLFPVESIHMNVVSKPFQHRSYPTKSRLLHKDTLEDDPEFDEAEFIK 102

Query: 88  ----------------CQDVPLGVA--LQYGNSRGQPELISFLKEHTSIFHNISINDWDL 129
                           C+   L +A   QY  +RG P ++ F K+    F+  + ++WD+
Sbjct: 103 SKIDDGSMVNIWRYDPCKPDRLSIARAFQYSETRGLPSVVEFSKKIVKRFNPPAYDNWDV 162

Query: 130 ITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKMD------KDG 183
           +   GS+ +        C+ G TVLMEE+T+S ++    A G   V +K++        G
Sbjct: 163 LLANGSSDSLFKIFETLCDEGVTVLMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQG 222

Query: 184 IKVDKLSEMLRDWDVAVQGPF-----PKLLYTIPNGHNPTGCTLHEERKPELVRLASQYD 238
           I V  L ++L +W+V   GP+     P++LYTI  G NPTG TL  E++  +  LA  ++
Sbjct: 223 IDVQYLCDLLENWEV---GPYKHLSKPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHN 279

Query: 239 FIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNK-LGRSLLEWDDVGRIIRLE 297
           FII+EDDPY +L+   +  PE  +       +   + + N+ LG S +  D  G ++RLE
Sbjct: 280 FIIVEDDPYGYLKFPAYD-PEDPLKNPYKSGEITPDIYCNQVLGNSFITIDTSGTVLRLE 338

Query: 298 SVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQ------I 351
           + SK F PG RL + +G ++L+D L    EVS ++  G +Q ++N + Q+W Q       
Sbjct: 339 TYSKLFFPGLRLSFIVGNKFLIDTLAELSEVSSRAPSGTSQAILNNITQKWCQDYGDEVD 398

Query: 352 GYMKWLLRLRNSYSMKRD---HCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFE 408
           G+  W++ +   Y+ +R+     L     Y    + S+  P +GMF  + I   K  K +
Sbjct: 399 GWTNWIMSVAEEYTHRRNVLFEALLSTDAY-KKGLFSLLEPSAGMFVSIEILLDKLVKLD 457

Query: 409 REFKSK-VDLLEEHLYNSFVQN--GMLLACSSWFRVDPNHNKILAFRGSYASVDAE 461
            E   K +D L   L    V    G  LA    F  D   +  L    +YA+ D +
Sbjct: 458 AEDHLKAMDFLNYRLIEEGVSTVLGYRLAVCKKFSYD--RSNFLRVTYAYAASDEQ 511

>Scas_697.11
          Length = 510

 Score =  181 bits (458), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 112/396 (28%), Positives = 196/396 (49%), Gaps = 42/396 (10%)

Query: 37  DPNIVFLGAGMPSGNMFPFESISFKSVSLDDVNGTGAVEGCIHRDKS---DLEICQDVPL 93
           DPN + +  GMP+   FP ESI+ K      ++ T   E    +  +     E   ++PL
Sbjct: 50  DPNSIQMSGGMPNEGFFPIESINLK------ISNTPHFEKSERKTVTTNISKETPVELPL 103

Query: 94  GVALQYGNSRGQPELISFLKEHTSIFHNISIND---WDLITTAGSTQAWDACLRLFCNRG 150
             ++QY  +RG   L+ F++       N    +   W+++   GS+ +        C+  
Sbjct: 104 SKSMQYSETRGLNPLLDFIRYFIKWIGNSPPYEDSLWEVMLANGSSDSMFKVFETLCDES 163

Query: 151 ETVLMEEYTYSSSLEAAVAQGLNCVAMKM----DKDGIKVDKLSEMLRDWDVAVQGPF-- 204
           +TVLMEE+T+   +   +A G  C+ +K+    +  GI +D LS +L +W    +GP+  
Sbjct: 164 DTVLMEEFTFVPVISNVMATGAKCIPIKVNLNYEDQGIDIDYLSNLLNNWK---EGPYKH 220

Query: 205 ---PKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPE-L 260
              PK+LYTI  G NP G TL  E++ ++ ++A Q+D II+EDDPY +L   +F   +  
Sbjct: 221 LSKPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFPKFDPQDKF 280

Query: 261 NVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAPGCRLGWAIGPRYLLD 320
           N P + N     KE   N   +S +  D+ GR+IRLE+ SK FAPG RL + I  ++LL+
Sbjct: 281 NNPYE-NPNFTIKEYLQNHFTKSFITLDNDGRVIRLETFSKLFAPGLRLSFIIANKFLLE 339

Query: 321 HLWNYHEVSMQSTCGFAQTLINGMFQRWGQI--------------GYMKWLLRLRNSYSM 366
              ++ E+S ++  G +Q ++    +                    ++ W++++   Y+ 
Sbjct: 340 KFVDFSELSSRAPSGTSQAIVYSTVKALTTTRANNEKPDLEQMSKAWLSWIIQIAKHYTN 399

Query: 367 KRDHCLTQC--QKYLPNEVCSINLPISGMFFMVYID 400
           +R+  L+          ++ S+  P +GMF  + I+
Sbjct: 400 RRNITLSTLYESNAYKKKLFSVIEPSAGMFINLKIN 435

>YHR137W (ARO9) [2424] chr8 (375710..377251) Aromatic amino acid
           aminotransferase II [1542 bp, 513 aa]
          Length = 513

 Score =  179 bits (454), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/446 (25%), Positives = 226/446 (50%), Gaps = 51/446 (11%)

Query: 39  NIVFLGAGMPSGNMFPFESISFKSVSLDDVNGTGAVEGCIHRDKSDLEICQDVPLGVALQ 98
           +++ L  GMP+   FP ES+  K +S    N              DL    ++P+  + Q
Sbjct: 43  DVIELAGGMPNERFFPIESMDLK-ISKVPFNDNPKWHNSFTTAHLDLGSPSELPIARSFQ 101

Query: 99  YGNSRGQPELISFLKEHTS-----IFHNISINDWDLITTAGSTQAWDACLRLFCNRGETV 153
           Y  ++G P L+ F+K+  S      F + + ++WD+I + GS  +        C+   TV
Sbjct: 102 YAETKGLPPLLHFVKDFVSRINRPAFSDETESNWDVILSGGSNDSMFKVFETICDESTTV 161

Query: 154 LMEEYTYSSSLEAAVAQGLNCVAMKM------DKDGIKVDKLSEMLRDWDVAVQGPF--- 204
           ++EE+T++ ++    A G   + +KM      +  GI V+ L+++L +W     GP+   
Sbjct: 162 MIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWST---GPYKDL 218

Query: 205 --PKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPE-LN 261
             P++LYTI  G NPTG ++ + ++ ++ +LA ++DF+I+EDDPY +L    +   E L 
Sbjct: 219 NKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPSYNPQEPLE 278

Query: 262 VPGDVNEMQWFKENFVNK-LGRSLLEWDDVGRIIRLESVSKTFAPGCRLGWAIGPRYLLD 320
            P   +++    E ++N  L +S L  D   R+IRLE+ SK FAPG RL + +  ++LL 
Sbjct: 279 NPYHSSDLT--TERYLNDFLMKSFLTLDTDARVIRLETFSKIFAPGLRLSFIVANKFLLQ 336

Query: 321 HLWNYHEVSMQSTCGFAQTLINGMFQRWGQI--------------GYMKWLLRLRNSYSM 366
            + +  +++ ++  G +Q ++    +   +               G+++W++++ + Y+ 
Sbjct: 337 KILDLADITTRAPSGTSQAIVYSTIKAMAESNLSSSLSMKEAMFEGWIRWIMQIASKYNH 396

Query: 367 KRD---HCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFER--EFKSKVDLLEEH 421
           +++     L + + Y   +   +  P +GMF ++ I+      F+R  +   ++D+L++ 
Sbjct: 397 RKNLTLKALYETESYQAGQFTVME-PSAGMFIIIKIN---WGNFDRPDDLPQQMDILDKF 452

Query: 422 LYNSFVQNGMLLACSSWFRVDPNHNK 447
           L    ++NG+ +       V PN++K
Sbjct: 453 L----LKNGVKVVLGYKMAVCPNYSK 474

>CAGL0G06028g complement(579261..580874) similar to sp|P38840
           Saccharomyces cerevisiae YHR137w ARO9 aromatic amino
           acid aminotransferase II, start by similarity
          Length = 537

 Score =  175 bits (443), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 123/433 (28%), Positives = 211/433 (48%), Gaps = 56/433 (12%)

Query: 39  NIVFLGAGMPSGNMFPFESISFKSV-----SLDDVNGTGAVEGCIHRDKSDLEICQDVPL 93
           +++ L AGMP+   FP +++    V     S DD +     +   +  KS       +P+
Sbjct: 67  DVIELTAGMPNEQFFPIKAMDMTIVNKPFESADDTSKHLHCKMSTYEPKS-------LPI 119

Query: 94  GVALQYGNSRGQPELISFLKEHTSIFHN--ISINDWDLITTAGSTQAWDACLRLFCNRGE 151
             + QY    G P++ +F K   +  +    S + WD++ ++GS  +       FC+   
Sbjct: 120 ARSFQYNEVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKS 179

Query: 152 TVLMEEYTYSSSLEAAVAQGLNCVAMKMD--KD----GIKVDKLSEMLRDWDVAVQGPF- 204
           TVLMEE+T++  +    A G  C+ +KM+  KD    GI VD L+++L +W     GP+ 
Sbjct: 180 TVLMEEFTFTPVISHVKATGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWS---SGPYK 236

Query: 205 ----PKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPEL 260
               P++LYTI  G NPTG T+  E + ++  LA +++F+I+EDDPY +L    +  PE 
Sbjct: 237 HLNKPRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPYGYLSFPSY-KPED 295

Query: 261 NVPGDVNEMQWFKENFVNK-LGRSLLEWDDVGRIIRLESVSKTFAPGCRLGWAIGPRYLL 319
            +  D  E  +  E + N+ L  S L  D   R+IR+E+ SK FAPG RLG+ +  +Y++
Sbjct: 296 PLKNDYLEDGFTVEKYTNEFLVDSFLTIDTDARVIRMETFSKVFAPGLRLGFIVANKYII 355

Query: 320 DHLWNYHEVSMQSTCGFAQTLINGMFQRWGQI------------------GYMKWLLRLR 361
            +L  Y E++ ++  G +Q ++    +                       G+M W++++ 
Sbjct: 356 SNLLEYAEITTRAPSGVSQAVLYNTLETMALYQDGDDKEDPEKKQEALFQGWMHWIMKVA 415

Query: 362 NSYSMKRD---HCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFEREFKSKVDLL 418
             Y+ +R+     L +   Y  N + ++  P +GMF  V I   K P        ++  L
Sbjct: 416 AEYTHRRNITLKALYETDAY-KNGLFTVIEPSAGMFVGVKIKWDKAPGEIGNIPEQMKKL 474

Query: 419 EEHLYNSFVQNGM 431
           +  L    VQNG+
Sbjct: 475 DRFL----VQNGI 483

>AGR141C [4452] [Homologous to ScYER152C - SH] (1013962..1015278)
           [1317 bp, 438 aa]
          Length = 438

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 100/227 (44%), Gaps = 29/227 (12%)

Query: 171 GLNCVAMKMDKDG-IKVDKLSEMLRDWDV------AVQGPF---PK-----LLYTIPNGH 215
           G    A++  +DG + ++ L+E L ++D       A+  P    PK     ++Y IP   
Sbjct: 131 GGRMTAVRETQDGQLDLEYLAEKLSEFDAEHPSTEALTEPRRTPPKRTYRYVMYLIPTYS 190

Query: 216 NPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKEN 275
           NP+G T   E +  LV LA +YD ++I DD Y  L  ++   P   +P  +  +      
Sbjct: 191 NPSGSTYSLETRTRLVELARRYDMLLISDDIYDLLAYDQ---PSDQLPRALPSLVHVDRA 247

Query: 276 FVNKLGRSLLEWDDVGRIIRLESVSKTFAPGCRLGW--AIGPRYLLDHLWNYHEVSMQST 333
            +N+      E D  G  +   S SK  APG R G+  ++  R L+  L N        +
Sbjct: 248 TLNE------EQDSWGHTVANASFSKIVAPGLRCGYQESVTSR-LVGQLANGGANVSGGS 300

Query: 334 CGFAQTLINGMFQRWGQIGYMKWLLRLRNSYSMKRDHCLTQCQKYLP 380
                ++I G     G++ ++  L  LR+ Y  + +      ++YLP
Sbjct: 301 PAQLNSMIIGTLISTGELAHLLQL--LRSVYQDRAEVLHRAVREYLP 345

>CAGL0I06578g 637311..638621 similar to sp|P10356 Saccharomyces
           cerevisiae YER152c, hypothetical start
          Length = 436

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 100/237 (42%), Gaps = 29/237 (12%)

Query: 207 LLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDV 266
           ++Y +P   NP+G +   E + +L+ +A +YD +II DD Y  L  +           DV
Sbjct: 185 VMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYDLLDYST----------DV 234

Query: 267 NEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAPGCRLGWAIGPRYLLDHLWNYH 326
           +E    ++  V+    +  + ++ G  I   + SK  APG R G+      + D L    
Sbjct: 235 HEWPRPQKRLVHIDRATAPDDNEFGNTISNATFSKIIAPGLRFGYH---ETINDKLAAQL 291

Query: 327 EVSMQSTCGFAQTLINGMF-QRWGQIGYMKWLL-RLRNSYSMKRDHCLTQCQKYLPNEVC 384
                +  G   + +N M      Q G M+ +L +LR +Y  +        QK++P +  
Sbjct: 292 SRGGANVSGGTPSQLNSMIVGTILQNGSMERILGKLRETYKTRSVAMWDSLQKHMPKDT- 350

Query: 385 SINLPISGMFFMVYIDPHKHPKFEREFKSKVDLLEEHLYNSFVQNGMLLACSSWFRV 441
            I+ P  G F  V + P    K     K    L +EH        G++LA  S F V
Sbjct: 351 HISSPKGGYFVWVTLPPGYDAK-----KIGKKLKDEH--------GVILANGSDFEV 394

>YER152C (YER152C) [1581] chr5 complement(472652..473983) Protein of
           unknown function, has a region of weak similarity to a
           region of kynurenine aminotransferase II (human KATII),
           which catalyzes conversion of L-kynurenine to kynurenic
           acid and may act in glutamatergic neurotransmission and
           neurodegeneration [1332 bp, 443 aa]
          Length = 443

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 83/203 (40%), Gaps = 20/203 (9%)

Query: 200 VQGP------FPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMN 253
           +QGP      +  ++Y IP   NP+G T   E +  L+ +A +YD +II DD Y  L   
Sbjct: 174 IQGPKLTKKVYRYVMYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDVYDIL--- 230

Query: 254 EFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAPGCRLGWAI 313
           ++  P   +P     M     +            D  G  +   + SK  APG R G+  
Sbjct: 231 DYTTPSDELPSPPLRMVHIDRSTAPS------GEDSFGNTVSNATFSKLIAPGLRFGYHE 284

Query: 314 GPRYLLDHLWNYHEVSMQ-STCGFAQTLINGMFQRWGQIGYMKWLLRLRNSYSMKRDHCL 372
                L    +    ++   T     ++I G   R G     + +  LR+ YS +     
Sbjct: 285 SINANLARQLSKGGANVSGGTPSQLNSMIVGEMLRSG--AAQRCIAHLRSVYSERATVLT 342

Query: 373 TQCQKYLPNEVCSINLPISGMFF 395
           +  +KY+P  + +  +P+ G +F
Sbjct: 343 SALKKYMP--LGTEIMPLKGGYF 363

>CAGL0J05126g complement(484849..486150) highly similar to sp|P47039
           Saccharomyces cerevisiae YJL060w, hypothetical start
          Length = 447

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 120/301 (39%), Gaps = 48/301 (15%)

Query: 90  DVPLGVALQYGNSRGQPELISFLKE-HTSIFHNISINDWDLITTAGSTQAWDACLRLFCN 148
           DVPL    QY  +RG+P LI  L E +  +F +  I++ +++ T G+ +   +CL    N
Sbjct: 70  DVPL--VNQYSPTRGRPSLIKSLVELYKPVFGDF-IDNQNVLVTTGANEGILSCLMGILN 126

Query: 149 RGETVLM-----EEYTYSSSLEAAVAQGLNCVAMKMDKDGIKVDKLSEMLRDWDVAVQGP 203
            G+ V++     ++Y  +  L   V + +     K  K   +     E   DWD   +  
Sbjct: 127 AGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMK--TRNTTGDEWQIDWDALEKTF 184

Query: 204 FPKLLYTIPNG-HNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNV 262
             K    I N  HNP G    E+   +L +L  +++ ++I D+ Y  L   E   P +  
Sbjct: 185 NNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTE-SFPRI-- 241

Query: 263 PGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAP-GCRLGWAIGPRYLLDH 321
             ++NE                   D     + + S  K+FA  G R+GW I      D 
Sbjct: 242 -ANINE-------------------DIANLTLTVGSAGKSFAATGWRIGWIISKN---DQ 278

Query: 322 LWNYHEVSMQSTCGFA-----QTLINGMFQRWGQIGYMKWLLRLRNSYSMKRDHCLTQCQ 376
           L NY   +    C FA     Q    G  +   +I Y     ++R  Y  K +   T   
Sbjct: 279 LLNYVSKAHTRIC-FASPSPLQEACAGSIEHALKIDYFP---KMREEYRKKFEILTTAFD 334

Query: 377 K 377
           K
Sbjct: 335 K 335

>YJL060W (BNA3) [2851] chr10 (323302..324636) Protein predicted to
           be part of the nicotinic acid biosynthetic pathway from
           tryptophan, has similarity to human tyrosine
           transaminase, mutations in which cause tyrosinemia, may
           be localized to mitochondria [1335 bp, 444 aa]
          Length = 444

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 97/233 (41%), Gaps = 36/233 (15%)

Query: 90  DVPLGVALQYGNSRGQPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCNR 149
           D+P+    QY  +RG+P LI+ L +  S  +N  +   ++  T G+ +   +CL    N 
Sbjct: 81  DIPM--VNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNA 138

Query: 150 GETVLMEEYTYSSSLEAAVAQGLNCVAM------KMDKDGIKVDKLSEMLRDWDVAVQGP 203
           G+ V++ E  +   +      G   V +      ++D+   + ++ +     ++ A+   
Sbjct: 139 GDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSK 198

Query: 204 FPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVP 263
              ++   P  HNP G     E    L  +  +++ +II D+ Y                
Sbjct: 199 TKAVIINTP--HNPIGKVFTREELTTLGNICVKHNVVIISDEVY---------------- 240

Query: 264 GDVNEMQWFKENFVNKLGRSLLEWDDVGRI-IRLESVSKTFAP-GCRLGWAIG 314
               E  +F ++F      S     ++G++ + + S  K+FA  G R+GW + 
Sbjct: 241 ----EHLYFTDSFTRIATLS----PEIGQLTLTVGSAGKSFAATGWRIGWVLS 285

>Scas_555.7
          Length = 446

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 51/108 (47%), Gaps = 13/108 (12%)

Query: 207 LLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDV 266
           ++Y +P   NP+G T   + K +L+ LA +YD +II DD Y  L   +F     +VP   
Sbjct: 190 VMYCVPTFSNPSGNTYSLKTKLKLIELARRYDMLIISDDVYDLLDYEQFLDVLPHVP--- 246

Query: 267 NEMQWFKENFVNKLGR--SLLEWDDVGRIIRLESVSKTFAPGCRLGWA 312
                  + FV+ L R  S    +  G  +   + SK  APG R G+ 
Sbjct: 247 -------KRFVH-LDRETSTHPENSFGNTLSNATFSKIIAPGLRFGYT 286

>Sklu_2389.7 YJL060W, Contig c2389 13116-14459 reverse complement
          Length = 447

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 98/231 (42%), Gaps = 34/231 (14%)

Query: 93  LGVAL--QYGNSRGQPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCNRG 150
           L VAL  QY  ++G+P LI+ L +  S F+   +   ++  T G+ +A  +CL    N+G
Sbjct: 83  LEVALNNQYSPTKGRPSLINELIKLYSPFYKTRLGPSNVQVTTGANEAILSCLVGLLNQG 142

Query: 151 ETVLMEEY---TYSSSLEAAVAQGLNCVAMKMDKD-GIKVDKLSEMLRDWDVAVQGPFPK 206
           + V++ E     Y S++E    + +  V +   K+   +V   +E   D+D       PK
Sbjct: 143 DEVIVFEPFFDQYISNIEIPGGK-VTYVPLHPPKELENRVTHGTEWTVDYDELRAAITPK 201

Query: 207 LLYTIPNG-HNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGD 265
               I N  HNP G     E   E+  +  + + +II D+ Y  L               
Sbjct: 202 TKALILNTPHNPIGKVFTREELLEIGNICVENNVVIISDEVYEHLY-------------- 247

Query: 266 VNEMQWFKENFVNKLGRSLLEWDDVGRI-IRLESVSKTFAP-GCRLGWAIG 314
                     F ++  R      ++G + + + S  KTFA  G R+GW + 
Sbjct: 248 ----------FTSEFTRIATLSPEIGNLTLSVGSAGKTFAATGWRIGWIVS 288

>Kwal_8.585
          Length = 446

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 111/275 (40%), Gaps = 37/275 (13%)

Query: 207 LLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDV 266
           ++Y +P   NP+G T  +E + +L+ LA +YD +II DD Y  L     G         +
Sbjct: 191 VIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVYDLL-----GFHGQRTDSGI 245

Query: 267 NEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAPGCRLGWAIGPRYLLDHLWNYH 326
            +   F+   ++++  ++   +  G  I   + SK  APG R G+        ++L N  
Sbjct: 246 RKPSHFRFPQLDRI--TVPAGNTHGNTISNCTFSKIIAPGLRTGYQETAN---ENLANQL 300

Query: 327 EVSMQSTCGFAQTLINGMF----QRWGQIGYMKWLLRLRNSYSMKRDHCLTQCQKYL-PN 381
            +   +  G     +N M      + G +G  + + RL + Y+ +        + YL P 
Sbjct: 301 SLGGANISGGTPAQLNSMIIATMIKSGAVG--RIVARLTDVYAERARVLEASIKAYLPPG 358

Query: 382 EVCSINLPISGMFFM-VYIDPHKHPKFEREFKSKVDLLEEHLYNSFVQNGMLLACSSWFR 440
             C+   P  G +F    + P  + K   E  S                G++LA  S F 
Sbjct: 359 TQCT---PCEGGYFSWCTLPPGYNSKLIAERAS--------------AKGLILANGSLFE 401

Query: 441 V--DPNHNKILAFRGSYASVDAEKMQNGIIMLGNV 473
           V  D  +    A R   +    E+++ GI + G V
Sbjct: 402 VTGDERNWGSRAVRLCVSFSSKEQIEEGIRIWGEV 436

>Kwal_14.2574
          Length = 443

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/272 (22%), Positives = 106/272 (38%), Gaps = 46/272 (16%)

Query: 98  QYGNSRGQPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEE 157
           QY  ++G+  LI+ L +  S  +N  ++  ++  T G+ +   +CL    N G+ V++ E
Sbjct: 86  QYAPTKGRVSLINSLVKLYSPLYNTQLDASNVQVTTGANEGILSCLVGLLNPGDEVIVFE 145

Query: 158 YTYSSSLEAAVAQG--LNCVAMKMDKD-GIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNG 214
             +   +      G  +  V M   K+  ++  K +E   ++D       PK    I N 
Sbjct: 146 PFFDQYISNIQIPGGKVTYVPMHPPKEMNVRNTKGTEWTVNYDELEAAITPKTKALILNT 205

Query: 215 -HNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFK 273
            HNP G     E    +  +  +++ +II D+ Y                    E  +F 
Sbjct: 206 PHNPVGKVFTREELLRIGEICVKHNVVIISDEVY--------------------EHLYFT 245

Query: 274 ENFVNKLGRSLLEWDDVGRI-IRLESVSKTFAP-GCRLGWAIGPRYLLDHLWNYHEVS-- 329
             F      S     ++G+I + + S  K+FA  G R+GW +    L   L  Y  ++  
Sbjct: 246 PEFTRIATLS----PEIGQITLTVGSAGKSFAATGWRIGWVVS---LNPELLKYASMAHT 298

Query: 330 ---------MQSTCG--FAQTLINGMFQRWGQ 350
                    +Q  C       L NG F++  Q
Sbjct: 299 RICFSSPSPLQEACANSLNTALDNGYFEKMRQ 330

>KLLA0E00935g 101430..102767 similar to sp|P10356 Saccharomyces
           cerevisiae YER152c singleton, start by similarity
          Length = 445

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 92/221 (41%), Gaps = 26/221 (11%)

Query: 182 DGIKVDKLSEM-LRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFI 240
           D I  D  SE+ L     A +  +  ++Y +P   NP G T   E + +L+ LA ++D +
Sbjct: 162 DSISNDNSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDML 221

Query: 241 IIEDDPYYFLQMNEFGAPELNVP----GDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRL 296
           I+ DD Y  L+ ++    EL  P      V+ M +       K G S       G  I  
Sbjct: 222 IVSDDVYDLLRYDD-SLDELPHPLPRLTHVDRMSY-------KHGDS-----GYGNTISN 268

Query: 297 ESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMF-QRWGQIGYMK 355
            + SK  APG R G+      + ++L         +  G   + +N M      Q G  K
Sbjct: 269 ATFSKIIAPGLRFGYQ---ETVNENLAYQLSQGGANVSGGTPSQLNSMIVGTLIQNGKAK 325

Query: 356 WLL-RLRNSYSMKRDHCLTQCQK-YLPNEVCSINLPISGMF 394
            ++  LR  Y + R  CL Q  K YLP      +L + G F
Sbjct: 326 EIICSLRKEYQL-RAACLYQSVKSYLP-RATQYHLQLGGYF 364

>CAGL0L12254g complement(1324815..1326539) similar to sp|P52893
           Saccharomyces cerevisiae YLR089c, hypothetical start
          Length = 574

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 58/124 (46%), Gaps = 7/124 (5%)

Query: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKD---G 183
           D+  TAG++ A D  L +FC   ET VL+    Y         Q  + +   ++++    
Sbjct: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292

Query: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243
              ++L  ++ D   +++      +  + N  NPTG  L EE   ++  LA++Y  I+I 
Sbjct: 293 TDPEELESIILD---SIENNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIA 349

Query: 244 DDPY 247
           D+ Y
Sbjct: 350 DEVY 353

>KLLA0F01617g complement(154025..155359) highly similar to sp|P47039
           Saccharomyces cerevisiae YJL060w singleton, start by
           similarity
          Length = 444

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 97/231 (41%), Gaps = 34/231 (14%)

Query: 90  DVPLGVALQYGNSRGQPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCNR 149
           +VPL    QY  +RG+P L+  L +  S  +N ++N+ ++  T G+ +   A L    N 
Sbjct: 81  NVPLNN--QYSPTRGRPSLLKSLTDFYSPIYNETLNESNVTITTGANEGILASLVGLLNP 138

Query: 150 GETVLM-----EEYTYSSSLEAAVAQGLNCVAMKMDKDGIKVDKLSEMLRDWDVAVQGPF 204
           G+ V++     ++Y  +  +     + +  VA K   + + +   +E   D+D+  +   
Sbjct: 139 GDEVIVFEPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIG--AEWKIDFDILNKTIN 196

Query: 205 PKLLYTIPNG-HNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVP 263
            +    I N  HNP G     E   +L  +  + +  II D+ Y                
Sbjct: 197 ERTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY---------------- 240

Query: 264 GDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAP-GCRLGWAI 313
               E  +F + F  ++     E  D+   + + S  K+FA  G R+GW +
Sbjct: 241 ----EHLYFGDEFT-RIATISKEIGDL--TLSVGSAGKSFAATGWRIGWVV 284

>Kwal_56.23791
          Length = 518

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 73/166 (43%), Gaps = 10/166 (6%)

Query: 99  YGNSRGQPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCN---RGETVLM 155
           Y NS+G       + E          +  D+  T G++ A    L LFCN    G  + +
Sbjct: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207

Query: 156 EEYT-YSSSLEAAVAQGLNCVAMKMDKDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNG 214
            +Y  Y++SL    +  L     +     +  +++ ++++D     +G  P  L  I N 
Sbjct: 208 PQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDS--IKKGIRPTCLVVI-NP 264

Query: 215 HNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPEL 260
            NPTG  L+ +    ++++A++Y  +II D+ Y   Q N F   E 
Sbjct: 265 GNPTGALLNTDTIENVIKVAAKYSMVIIADEVY---QENGFNDAEF 307

>Scas_711.52
          Length = 445

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 96/235 (40%), Gaps = 40/235 (17%)

Query: 90  DVPLGVALQYGNSRGQPELI-SFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCN 148
           D+PL    QY  +RG+  L+ + +K++T I+ +  +   ++  T G+ +   +CL    N
Sbjct: 82  DIPL--VNQYSPTRGRVSLLNALIKQYTPIYGS-ELKQENVTITTGANEGILSCLMGLLN 138

Query: 149 RGETVLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGIKVDKLSEMLRDWDV-------AVQ 201
            G+ V++ E  +   +      G   V + ++    ++D+      +W V       A+ 
Sbjct: 139 AGDEVIVFEPFFDQYISNIELMGGKIVYVPINPPK-ELDQRVTEGTEWTVDMEQFKNAIT 197

Query: 202 GPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELN 261
                ++   P  HNP G     E   ++  +  + + III D+ Y  L           
Sbjct: 198 SKTKAVIINTP--HNPIGKVFTREELLQIGNICVEKNVIIISDEVYEHLY---------- 245

Query: 262 VPGDVNEMQWFKENFVNKLGRSLLEWDDVGRI-IRLESVSKTFAP-GCRLGWAIG 314
                         F ++  R      ++G++ + + S  KTFA  G R+GW I 
Sbjct: 246 --------------FTDEFTRIATLSPEIGQLTLTVGSAGKTFAATGWRIGWVIS 286

>YLR089C (YLR089C) [3504] chr12 complement(318238..320016) Putative
           mitochondrial alanine aminotransferase [1779 bp, 592 aa]
          Length = 592

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 128 DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183
           D+  TAG++ A +  L +FC   ET   + + +Y  Y+++L    +Q L     +     
Sbjct: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWS 310

Query: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243
              +++  ++++   A+Q      +  + N  NPTG  L  E   ++  +A++Y  ++I 
Sbjct: 311 TNPEEIETVVKE---AIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367

Query: 244 DDPY 247
           D+ Y
Sbjct: 368 DEVY 371

>AGR085W [4395] [Homologous to ScYLR089C - SH; ScYDR111C - SH]
           complement(887029..888594) [1566 bp, 521 aa]
          Length = 521

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 61/139 (43%), Gaps = 10/139 (7%)

Query: 122 ISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKM-- 179
           I  N  ++  TAG++ A    L  FC   ET ++          A + Q  N VA+    
Sbjct: 174 IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQN-NAVALPYYL 232

Query: 180 -DKDGIKVDKLSEMLRD-WDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQY 237
            + DG   +   EM R   D   +   PK L  I N  NPTG  L  +    ++ LA++Y
Sbjct: 233 NEADGWSTNP-DEMERVILDSKKRNIAPKCLVVI-NPGNPTGSVLSVKDMEAILTLAAKY 290

Query: 238 DFIIIEDDPYYFLQMNEFG 256
             ++I D+ Y   Q N FG
Sbjct: 291 GIVVIADEVY---QDNVFG 306

>YDR111C (YDR111C) [960] chr4 complement(678235..679758) Protein
           with high similarity to S. cerevisiae Ylr089p, which is
           a putative mitochondrial alanine aminotransferase
           involved in energy pathways, contains an
           aminotransferase class I and II domain, which are found
           in some pyridoxal-dependent enzymes [1524 bp, 507 aa]
          Length = 507

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 59/129 (45%), Gaps = 17/129 (13%)

Query: 128 DLITTAGSTQAWDACLRLFCNRGETVLM------EEYTYSSSLEAAVAQGLNCVAMKMDK 181
           D+  T G++ A  + L L C   +T L+        YT S+SL  A       +   +D+
Sbjct: 166 DIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYPLYTASASLFNA-----QVLPYYLDE 220

Query: 182 DG---IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYD 238
           +       D++ ++++D   A++      +  + N  NPTG  L EE    +  +A++Y 
Sbjct: 221 ESNWSTNSDEIEKVVQD---ALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYG 277

Query: 239 FIIIEDDPY 247
             II D+ Y
Sbjct: 278 ITIISDEVY 286

>AEL170C [2336] [Homologous to ScYJL060W - SH] (318032..319408)
           [1377 bp, 458 aa]
          Length = 458

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 91/222 (40%), Gaps = 31/222 (13%)

Query: 98  QYGNSRGQPELI-SFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCNRGETVLME 156
           QY  +RG+P L+ + LK +  ++ +++  +  +  T G+ +   ACL    N G+ V++ 
Sbjct: 102 QYAPTRGRPALVEALLKLYRPMYGDLAAENVQV--TTGANEGIFACLAGLVNPGDEVIVF 159

Query: 157 EYTYSSSLEAAVAQG--LNCVAMKMDKD-GIKVDKLSEMLRDWDVAVQGPFPKLLYTIPN 213
           E  +   +      G  +  V ++   +   +V + +E + D+D+  Q    K    I N
Sbjct: 160 EPFFDQYIPNIELLGGVVRYVPIRPPAELSKRVTEGTEWVIDYDMLRQTINEKTKAVIIN 219

Query: 214 G-HNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWF 272
             HNP G     E   +L  +  +    II D+ Y                    E  +F
Sbjct: 220 SPHNPIGKVFTREELLKLGNICVEKGIYIISDEVY--------------------EHLYF 259

Query: 273 KENFVNKLGRSLLEWDDVGRIIRLESVSKTFAP-GCRLGWAI 313
            + F      + L  +     + + S  K+FA  G R+GW I
Sbjct: 260 TDEFTRI---ATLSEEISQHTLTVGSAGKSFAATGWRIGWVI 298

>KLLA0F19162g complement(1775240..1776826) similar to sp|P52893
           Saccharomyces cerevisiae YLR089c, start by similarity
          Length = 528

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 7/124 (5%)

Query: 128 DLITTAGSTQAWDACLRLFC---NRGETVLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183
           D+  TAG++ A    L + C   N G  + + +Y  Y++SL    ++ L     +     
Sbjct: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246

Query: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243
              +++ +++ D   A+Q         + N  NPTG  L E+   ++  +A++Y  ++I 
Sbjct: 247 TDPEEIEQVVLD---AIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 303

Query: 244 DDPY 247
           D+ Y
Sbjct: 304 DEVY 307

>Scas_681.2
          Length = 568

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 9/125 (7%)

Query: 128 DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183
           D+  TAG++ A    L + C   ET   + + +Y  Y++SL    +  L     +     
Sbjct: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWS 286

Query: 184 IKVDKLSEM-LRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIII 242
               ++ E+ L   D  ++   P +L  I N  NPTG  L E+    +  +A++Y  ++I
Sbjct: 287 TNPKEIEEVVLAAKDKKIR---PSVLVVI-NPGNPTGAVLSEKSIEHIFEIAAKYGIVVI 342

Query: 243 EDDPY 247
            D+ Y
Sbjct: 343 ADEVY 347

>Scas_693.9
          Length = 497

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGIKV 186
           D+  T G+T A    L + C   +T VL+    Y              +   +D++    
Sbjct: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWS 215

Query: 187 DKLSEMLR-DWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDD 245
              +E+ +   D   +G  P ++  I N  NPTG  L E    ++ ++A++Y  +++ D+
Sbjct: 216 TNTTEIEKLVLDSIKKGIKPSVIVVI-NPGNPTGAVLSELAIAKIFQIAAKYGIVVLADE 274

Query: 246 PY 247
            Y
Sbjct: 275 VY 276

>Scas_693.17
          Length = 1049

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 21/46 (45%)

Query: 90  DVPLGVALQYGNSRGQPELISFLKEHTSIFHNISINDWDLITTAGS 135
           D+     ++   S+ QP   S   +    FH  S+ DWD + T G+
Sbjct: 34  DIATPRTIEPATSKDQPSNNSKQSQKLRQFHRTSLGDWDFVETVGA 79

>AFR004W [3196] [Homologous to ScYLR321C (SFH1) - SH]
           complement(443634..444785) [1152 bp, 383 aa]
          Length = 383

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 18/39 (46%)

Query: 404 HPKFEREFKSKVDLLEEHLYNSFVQNGMLLACSSWFRVD 442
           H  +E   K K D LE HL    V NG    C S  R+D
Sbjct: 282 HALYESILKIKKDWLEGHLNPEHVANGAAFGCLSGIRLD 320

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,428,860
Number of extensions: 740685
Number of successful extensions: 1659
Number of sequences better than 10.0: 41
Number of HSP's gapped: 1604
Number of HSP's successfully gapped: 41
Length of query: 473
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 368
Effective length of database: 12,961,219
Effective search space: 4769728592
Effective search space used: 4769728592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)