Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A04884g1059104356050.0
Scas_638.101081106823310.0
YGL016W (KAP122)1081107622710.0
CAGL0A00385g1069106620770.0
Kwal_47.1745794795219770.0
AGR166W1013101917310.0
Kwal_55.1998164548751.2
ACL083C54171741.5
KLLA0C16115g118376741.6
ADL019W52583731.9
YPL260W55184722.3
YNR073C50246722.4
YEL070W50246722.4
Sklu_2412.7112752713.9
YDR263C (DIN7)43097685.7
Kwal_33.13665211943696.3
Kwal_55.2083257556678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04884g
         (1043 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04884g 433581..436760 similar to sp|P32767 Saccharomyces c...  2163   0.0  
Scas_638.10                                                           902   0.0  
YGL016W (KAP122) [1957] chr7 (461669..464914) Nuclear transport ...   879   0.0  
CAGL0A00385g complement(37162..40371) similar to sp|P32767 Sacch...   804   0.0  
Kwal_47.17457                                                         766   0.0  
AGR166W [4477] [Homologous to ScYGL016W (KAP122) - SH] complemen...   671   0.0  
Kwal_55.19981                                                          33   1.2  
ACL083C [966] [Homologous to ScYOR090C (PTC5) - SH] (199845..201...    33   1.5  
KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomy...    33   1.6  
ADL019W [1723] [Homologous to ScYPL260W - SH] complement(675944....    33   1.9  
YPL260W (YPL260W) [5190] chr16 (49303..50958) Protein of unknown...    32   2.3  
YNR073C (YNR073C) [4656] chr14 complement(774789..776297) Putati...    32   2.4  
YEL070W (YEL070W) [1360] chr5 (19589..21097) Putative mannitol d...    32   2.4  
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          32   3.9  
YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondr...    31   5.7  
Kwal_33.13665                                                          31   6.3  
Kwal_55.20832                                                          30   8.0  

>KLLA0A04884g 433581..436760 similar to sp|P32767 Saccharomyces
            cerevisiae YGL016w PDR6 Member of the karyopherin-beta
            family, nuclear import singleton, start by similarity
          Length = 1059

 Score = 2163 bits (5605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1043/1043 (100%), Positives = 1043/1043 (100%)

Query: 1    MDINHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANALLSQENGSTNVKYFGA 60
            MDINHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANALLSQENGSTNVKYFGA
Sbjct: 1    MDINHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANALLSQENGSTNVKYFGA 60

Query: 61   LTYTVQLTTCLHTESQLWSIFQGNLVHLTRMMFLFTSNPAAASNLLVTITKLMSNLSLIF 120
            LTYTVQLTTCLHTESQLWSIFQGNLVHLTRMMFLFTSNPAAASNLLVTITKLMSNLSLIF
Sbjct: 61   LTYTVQLTTCLHTESQLWSIFQGNLVHLTRMMFLFTSNPAAASNLLVTITKLMSNLSLIF 120

Query: 121  LTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERLVRTCLNEDV 180
            LTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERLVRTCLNEDV
Sbjct: 121  LTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERLVRTCLNEDV 180

Query: 181  PYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYEMVHNHLYISTMAILN 240
            PYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYEMVHNHLYISTMAILN
Sbjct: 181  PYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYEMVHNHLYISTMAILN 240

Query: 241  FNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLTEMFNNMINVMCMASNGSQE 300
            FNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLTEMFNNMINVMCMASNGSQE
Sbjct: 241  FNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLTEMFNNMINVMCMASNGSQE 300

Query: 301  FPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSRHSMNTSNDWMLAYMNHLVTNE 360
            FPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSRHSMNTSNDWMLAYMNHLVTNE
Sbjct: 301  FPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSRHSMNTSNDWMLAYMNHLVTNE 360

Query: 361  LYDDLKVLASCVVDFLQISNLDVCNKLFTNIHENTGDQSLEDYIRVLLQLTNFPLIPILQ 420
            LYDDLKVLASCVVDFLQISNLDVCNKLFTNIHENTGDQSLEDYIRVLLQLTNFPLIPILQ
Sbjct: 361  LYDDLKVLASCVVDFLQISNLDVCNKLFTNIHENTGDQSLEDYIRVLLQLTNFPLIPILQ 420

Query: 421  ETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPKISLMNKQKIMEE 480
            ETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPKISLMNKQKIMEE
Sbjct: 421  ETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPKISLMNKQKIMEE 480

Query: 481  DDDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVLIRGVGQADTNNVDLYQVEAMSFL 540
            DDDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVLIRGVGQADTNNVDLYQVEAMSFL
Sbjct: 481  DDDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVLIRGVGQADTNNVDLYQVEAMSFL 540

Query: 541  LAKLLDGVNFSQSPFISDAIGENHLIDNLLFLLQTGCKQKEHSKTAQVLKLDFVKATCNL 600
            LAKLLDGVNFSQSPFISDAIGENHLIDNLLFLLQTGCKQKEHSKTAQVLKLDFVKATCNL
Sbjct: 541  LAKLLDGVNFSQSPFISDAIGENHLIDNLLFLLQTGCKQKEHSKTAQVLKLDFVKATCNL 600

Query: 601  LGVMATYFHVDSKPLGPIVESLFECLETSRQYNPIEYSIKMELQLNRTISLICENCRKEL 660
            LGVMATYFHVDSKPLGPIVESLFECLETSRQYNPIEYSIKMELQLNRTISLICENCRKEL
Sbjct: 601  LGVMATYFHVDSKPLGPIVESLFECLETSRQYNPIEYSIKMELQLNRTISLICENCRKEL 660

Query: 661  IPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIGNIIQMCVSEGPEAQANHISNMVDMIG 720
            IPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIGNIIQMCVSEGPEAQANHISNMVDMIG
Sbjct: 661  IPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIGNIIQMCVSEGPEAQANHISNMVDMIG 720

Query: 721  GLIQTTDAKSDMLSLLACLSELGSGLSQLPNDDEFIENNPMYLAQLPAFQAYWLQDPMRV 780
            GLIQTTDAKSDMLSLLACLSELGSGLSQLPNDDEFIENNPMYLAQLPAFQAYWLQDPMRV
Sbjct: 721  GLIQTTDAKSDMLSLLACLSELGSGLSQLPNDDEFIENNPMYLAQLPAFQAYWLQDPMRV 780

Query: 781  KDKVMHLVQYALSKYGTDPEFVEVSCLIIGKAITLPDDIPHFLRYPLSEMMSFYMTCISN 840
            KDKVMHLVQYALSKYGTDPEFVEVSCLIIGKAITLPDDIPHFLRYPLSEMMSFYMTCISN
Sbjct: 781  KDKVMHLVQYALSKYGTDPEFVEVSCLIIGKAITLPDDIPHFLRYPLSEMMSFYMTCISN 840

Query: 841  CDYASGLPYIEYQLEKIVAGFKDQLTSHEFDEMFKQFFLNYYSSHISSDPDLIQSMVSWV 900
            CDYASGLPYIEYQLEKIVAGFKDQLTSHEFDEMFKQFFLNYYSSHISSDPDLIQSMVSWV
Sbjct: 841  CDYASGLPYIEYQLEKIVAGFKDQLTSHEFDEMFKQFFLNYYSSHISSDPDLIQSMVSWV 900

Query: 901  NSVLEAKPSLALKSEYWTQFIVPEFLKYLQAKEKFTISSTTKFWMKTLNNRRYTQEDTEI 960
            NSVLEAKPSLALKSEYWTQFIVPEFLKYLQAKEKFTISSTTKFWMKTLNNRRYTQEDTEI
Sbjct: 901  NSVLEAKPSLALKSEYWTQFIVPEFLKYLQAKEKFTISSTTKFWMKTLNNRRYTQEDTEI 960

Query: 961  INALFQSMGKQLVYQTMFSLHHAQRSDVPQYAELIRTLFAKYPMPMKDWLYELLPQITGK 1020
            INALFQSMGKQLVYQTMFSLHHAQRSDVPQYAELIRTLFAKYPMPMKDWLYELLPQITGK
Sbjct: 961  INALFQSMGKQLVYQTMFSLHHAQRSDVPQYAELIRTLFAKYPMPMKDWLYELLPQITGK 1020

Query: 1021 EAIFHERFINKLTVTRASRATLS 1043
            EAIFHERFINKLTVTRASRATLS
Sbjct: 1021 EAIFHERFINKLTVTRASRATLS 1043

>Scas_638.10
          Length = 1081

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1068 (45%), Positives = 695/1068 (65%), Gaps = 44/1068 (4%)

Query: 6    IVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANALLSQENGSTNVKYFGALTYTV 65
            +V LIE   + + S  +N+IQ  LQ  QKS  G  LAN LL   + S NVKYFGALT TV
Sbjct: 7    VVKLIEELYSPNPSHNVNEIQQTLQAIQKSNDGFQLANELLEGGDYSPNVKYFGALTLTV 66

Query: 66   QLTTCLHTESQLWSIFQGNLVHLTRMMFLFTSNPAAASNLLVTITKLMSNLSLIFLTINS 125
            Q+   +H+   LW +F+ NL+HLT+    + SNP   + L++TI KLMSNLSLIF  IN 
Sbjct: 67   QINVNVHSYEDLWRLFRANLIHLTKYCNNYVSNPQQYTPLMITIKKLMSNLSLIFNNINE 126

Query: 126  DAIG------ADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERLVRTCLNED 179
                      A    I  W NP++T I LL   NE +         EI    +   +N  
Sbjct: 127  STFQEVTPTEAAPVVITNWNNPIDTVIFLLSKSNELSDLGMNPHTDEI----ITEAINCT 182

Query: 180  VPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYEMVHNHLYISTMAIL 239
            +PY +L+  I S+   N+LLL+FT++IVED+ K QSKK +++ ++  VH +LY+STMA++
Sbjct: 183  IPYQQLLLFIGSNPAYNELLLIFTEIIVEDLTKLQSKKHAIAKIHTTVHTYLYVSTMALI 242

Query: 240  NFNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLTEMFNNMINVMCMASNGSQ 299
            N NL +  +  + + V+ CI SWI+YISM++NVS  G MDLTE+F N++++M  +S    
Sbjct: 243  NANLTSKQNIPSDT-VYNCINSWINYISMSQNVSQDGKMDLTEVFQNLLSLMQQSSEQLD 301

Query: 300  EFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSR--HSMNTSNDWMLAYMNHLV 357
             F  +++++ IF ++FS DP LM FE+R ++EA+FLG+SR  +     N WML YMN+LV
Sbjct: 302  NFTMAEKILVIFANVFSQDPLLMGFELREQVEALFLGISRSGNGDTAKNQWMLQYMNYLV 361

Query: 358  TNELYDDLKVLASCVVDFLQISNLDVCNKLFTNI-HENTGDQSLEDYIRVLLQLTNFPLI 416
            TNE+  +LK LA C+VDFLQI+ LDVCNKLFTNI ++   + + + YI+VLLQLTNFPL+
Sbjct: 362  TNEMVSELKDLAICIVDFLQINTLDVCNKLFTNISNDKFNEANSQQYIKVLLQLTNFPLV 421

Query: 417  PILQETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPKISLMNKQK 476
            P+LQE +S +MI+FWL+LAE Y  L  E LK +A+EI+  +F QV+ IYL KISL+NKQK
Sbjct: 422  PVLQEFFSVRMIDFWLELAECYSVLSNEMLKPNAHEISTEIFQQVINIYLAKISLINKQK 481

Query: 477  IMEED-DDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVLIRGVGQADTNN----VDL 531
            I+++D +D S +HEF+DFRSA  DL + LW ILGH  LT +LI G+G  D ++    ++L
Sbjct: 482  ILQDDTEDISAVHEFEDFRSAASDLAQTLWMILGHEHLTNILIAGIGGNDASSSKDMMNL 541

Query: 532  YQVEAMSFLLAKLLDGVNFSQSPFISDAIGENHL-IDNLLFLLQTGCKQ--KEHSKTAQV 588
            +Q+E+MSFLL  LL+G   + S +I + I EN   I N+L LL+TG ++  +     A  
Sbjct: 542  FQIESMSFLLNVLLEGSGDTLSKWICNVIKENAFTIGNILLLLKTGVQKLSENEDMVALS 601

Query: 589  LKLDFVKATCNLLGVMATYFHVDSKPLGPIVESLFECLET-SRQYNPIEYSI---KMELQ 644
            L+LD  + +C+LLG  + YF+ DS+ LGP +E+LF+ LE+ +   N +E +    K+E  
Sbjct: 602  LRLDLARTSCHLLGKCSGYFNEDSQQLGPSLETLFQGLESCTAPVNSLEATASNQKLETV 661

Query: 645  LNRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIGNIIQMCVSEG 704
            + RTI+++CE CR++L  FL  F  VL SIM P++ VS FTR   V+SIG IIQ     G
Sbjct: 662  IVRTITMLCETCRQQLSSFLGYFFTVLTSIMSPDAHVSTFTRSNLVRSIGYIIQSQTDGG 721

Query: 705  PEAQANHISNMVDMIGGLI---------QTTDAKSDML-SLLACLSELGSGLSQLPNDDE 754
            PE QA +I  ++D+I   I         QT D +   +  LL CLSELGS L    + DE
Sbjct: 722  PEQQAKYIIQVIDLISNFIEQNITLKVGQTPDQQHTYIHCLLECLSELGSALL---DPDE 778

Query: 755  FIENNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYALS--KYGTDPEFVEVSCLIIGKA 812
              ++    L +L  FQ +W  DP++V++K++ L++  LS   +    +F+EVSCLI+GK 
Sbjct: 779  LADSK--VLPRLAEFQQFWKNDPLQVRNKILLLIEKVLSVPTFSRKSDFIEVSCLILGKM 836

Query: 813  ITLPDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEKIVAGFKDQLTSHEFDE 872
            +TLPDD PHFLRY + E++ F +  + NC+ ++ LPY  Y LEK+V  FK  LTS EFD 
Sbjct: 837  LTLPDDEPHFLRYSMQEIIEFILRHVGNCELSTSLPYFVYLLEKLVIHFKQTLTSQEFDF 896

Query: 873  MFKQFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKSEYWTQFIVPEFLKYLQAK 932
            +F++  L YYS  I  DPDL+Q  +++VN++L+  PS+ + S +W  FI PEF+K L +K
Sbjct: 897  LFEKIILVYYSQFIFPDPDLLQMTINFVNTILDTNPSILVHSNHWNSFIFPEFIKLLLSK 956

Query: 933  EKFTISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQLVYQTMFSLHHAQRSDVPQYA 992
            EKFTI +  KFW K LNN+RYT+ED EI  +   ++G+ LVY  M+ L+H QRSD+  Y 
Sbjct: 957  EKFTIIAVNKFWTKVLNNKRYTKEDLEITRSQIGAIGQDLVYHIMYGLYHTQRSDLNSYT 1016

Query: 993  ELIRTLFAKYPMPMKDWLYELLPQITGKEAIFHERFINKLTVTRASRA 1040
            +++R L AK+PM  K WL  +LPQ++  + + HERFINKL +TR +RA
Sbjct: 1017 DVLRALVAKFPMETKPWLINVLPQLS-DQPVVHERFINKLFITRGNRA 1063

>YGL016W (KAP122) [1957] chr7 (461669..464914) Nuclear transport
            factor, member of karyopherin-beta family [3246 bp, 1081
            aa]
          Length = 1081

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1076 (43%), Positives = 695/1076 (64%), Gaps = 56/1076 (5%)

Query: 3    INHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANALLSQENGSTNVKYFGALT 62
            I+ +V+LIE   + H    +N IQ  LQ  QKSE G  LAN LLS +  S NVKYFGALT
Sbjct: 4    IHEVVALIEELYSPHPKHDVNQIQQSLQSIQKSEQGFHLANELLSDDKYSANVKYFGALT 63

Query: 63   YTVQLTTCLHTESQ-LWSIFQGNLVHLTRMMFLFTSNPAAASNLLVTITKLMSNLSLIFL 121
             TVQL T    + + LW++F+ NL++LT+   L+ SNP      L+ I KLMSNLSLIF 
Sbjct: 64   LTVQLNTRGENDYETLWNVFRSNLLYLTKFSTLYVSNPNMYGQSLIIIKKLMSNLSLIFT 123

Query: 122  TINSDAI--GADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEI-AERLVRTCLNE 178
             IN   +    + N I  W NP+NT I+L+              N  I A++L+   +N 
Sbjct: 124  KINDPQLNNAGNENMIKQWNNPINTFIQLMS-----------VQNQNINADQLLLDSINC 172

Query: 179  DVPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYEMVHNHLYISTMAI 238
             + Y +L   +S S   N+L L FT+VIVED+ K+Q+K+ S+S ++E+VH HLYISTMA+
Sbjct: 173  SLTYEQLSQFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEHLYISTMAL 232

Query: 239  LNFNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLTEMFNNMINVMCMASNGS 298
            +N NL        T  VF CIT+WI+YIS+ R+VS+ G MDL+E+F N+I++M  ++ GS
Sbjct: 233  INLNLTAQAVFNPT--VFDCITAWINYISLTRSVSSSGRMDLSEIFQNLIDLMYQSTEGS 290

Query: 299  QEFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSR-----HSMNTSNDWMLAYM 353
              +  ++++++IF ++F+NDP LMS+++R ++E IFLGV R       ++  N WML YM
Sbjct: 291  DGYENAEKILTIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDSGITDISNKNSWMLQYM 350

Query: 354  NHLVTNELYDDLKVLASCVVDFLQISNLDVCNKLFTNIHE----NTGDQSLEDYIRVLLQ 409
            N+LVTN+ + +LK LA C+VDFLQI+ L VCNKLFTNI         D+ +++YI+VLLQ
Sbjct: 351  NYLVTNDFFSELKELAICIVDFLQINTLSVCNKLFTNIQAADNGQVQDEYIQEYIKVLLQ 410

Query: 410  LTNFPLIPILQETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPKI 469
            +TNFPL P+LQE +S +M++FWLDL++ Y NL  E L+ ++ E++  +F Q++ IYLPKI
Sbjct: 411  MTNFPLTPVLQEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQLINIYLPKI 470

Query: 470  SLMNKQKIMEEDDDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVLIRGVGQADTNNV 529
            SL  KQ+I+EE+ + + ++EF+DFR+A  DL + LW+ILG+  LT VLI G+GQ    + 
Sbjct: 471  SLSVKQRIIEEEGESTSVNEFEDFRNAVSDLAQSLWSILGNDNLTNVLIDGMGQMPAASD 530

Query: 530  D---------LYQVEAMSFLLAKLLDGVNFSQSPFISDAIGENHLID-NLLFLLQTGCKQ 579
            +         L+++E M F+L  +L  +  S+SP+I + +  N   + N++ + QTG + 
Sbjct: 531  ETLIIKDTDVLFRIETMCFVLNTILVDMTLSESPWIKNIVDANKFFNQNVISVFQTGFQT 590

Query: 580  KEHSKTAQVLKLDFVKATCNLLGVMATYFHVDSKPLGPIVESLFECLETSRQY---NPIE 636
               +K +Q+LKLDFV+ +  L+G +A YF  +   L P VE+LF+ L T   +   N  E
Sbjct: 591  SASTKVSQILKLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEALFQGLHTCTNFTSKNEQE 650

Query: 637  Y--SIKMELQLNRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIG 694
               + K+E+ + +T+S +CE CR+EL P+L +FI  L +++ P+S VSHFTR K V+SIG
Sbjct: 651  KISNDKLEVMVIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHFTRTKLVRSIG 710

Query: 695  NIIQMCVSEGPEAQANHISNMVDMIGGLIQTTDAKSDMLS--------LLACLSELGSGL 746
             ++Q  VS GPE QA +I  + +++ G I+   A S  L         LL C+SEL + L
Sbjct: 711  YVVQCQVSNGPEEQAKYILQLTNLLSGSIEHCLASSVQLQEQQDYINCLLYCISELATSL 770

Query: 747  SQLPNDDEFIENNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYAL--SKYGTDPEFVEV 804
             Q     E IEN+ + L +L  FQ++W  DP++++ K+M  +   L  S Y  +  FVE+
Sbjct: 771  IQ---PTEIIENDAL-LQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSIYCKNSAFVEI 826

Query: 805  SCLIIGKAITLPDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEKIVAGFKDQ 864
             CLI+GK + LPD  P+FL+Y +SE+M+F +  + NC+ A+ LPY  Y LEK+++ F+ +
Sbjct: 827  GCLIVGKGLNLPDGEPYFLKYNMSEVMNFVLRHVPNCELATCLPYFVYLLEKLISEFRKE 886

Query: 865  LTSHEFDEMFKQFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKSEYWTQFIVPE 924
            LT  EFD MF++  L YY ++I +DPDL+Q  + +VN+VL+ KP LA+ S++WT FI+P+
Sbjct: 887  LTPQEFDFMFEKILLVYYDAYIINDPDLLQMTIGFVNNVLDVKPGLAIGSKHWTSFILPQ 946

Query: 925  FLKYLQAKEKFTISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQLVYQTMFSLHHAQ 984
            FLK + ++EKFTI +  KFW K +NN++Y QE+   +     S+G  LVYQ M+ L H Q
Sbjct: 947  FLKLIPSREKFTIVAVAKFWTKLINNKKYNQEELTTVRQQVSSIGGDLVYQIMYGLFHTQ 1006

Query: 985  RSDVPQYAELIRTLFAKYPMPMKDWLYELLPQITGKEAIFHERFINKLTVTRASRA 1040
            RSD+  Y +L+R L AK+P+  ++WL  +LPQI    A  HE+FINKL +TR SRA
Sbjct: 1007 RSDLNSYTDLLRALVAKFPIEAREWLVAVLPQICNNPA-GHEKFINKLLITRGSRA 1061

>CAGL0A00385g complement(37162..40371) similar to sp|P32767
            Saccharomyces cerevisiae YGL016w PDR6, start by
            similarity
          Length = 1069

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1066 (41%), Positives = 678/1066 (63%), Gaps = 44/1066 (4%)

Query: 3    INHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANALLSQENGSTNVKYFGALT 62
            +  +V+LIE   +   ++ +N+IQ VLQ  QKS  G+ L +ALLS    STNVKYFGALT
Sbjct: 4    VEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSALLSGPY-STNVKYFGALT 62

Query: 63   YTVQLTTC---LHTESQLWSIFQGNLVHLTRMMFLFTSNPAAASNLLVTITKLMSNLSLI 119
              VQ+      L  E   +++F+ NL  L +      ++P+A S+  + I KLMSNLS++
Sbjct: 63   LAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMSNLSIL 122

Query: 120  FLTINSDAIGADSNKIPAWRNPVNTCIKLL----QHCNESNLFEWRTDNSEIAERLVRTC 175
            F++IN++   ++++ I +W NP+NT I L     Q   +     + T+N+  +++++   
Sbjct: 123  FVSINNNN-PSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNNNSESDKIILDT 181

Query: 176  LNEDVPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYEMVHNHLYIST 235
            +N +VPY +LI  ISSS   N+L LLFT+++VED+ K+Q++K ++++++ +VH HLYIST
Sbjct: 182  INSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIHGVVHEHLYIST 241

Query: 236  MAILNFNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLTEMFNNMINVMCMAS 295
            MA++ FNL N+ ++     +F CI +WI+YIS++R VS  G MDL+E+  +++ VM + S
Sbjct: 242  MALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQGRMDLSELLESLLKVM-LQS 300

Query: 296  NGSQEFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSRHSMNTSND---WMLAY 352
            N ++++  +++VISIF  +FSNDP LM+FE+R++LE IFLGVS    N       WMLAY
Sbjct: 301  NENEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSHGDTNADKSQYQWMLAY 360

Query: 353  MNHLVTNELYDDLKVLASCVVDFLQISNLDVCNKLFTNIHENTGDQSLED----YIRVLL 408
            MN+LVTNE+Y +LK L+ CV DFLQI+ LD+CNKLFT I   T DQ+  D    YI+VLL
Sbjct: 361  MNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQ--TQDQAASDNTQEYIKVLL 418

Query: 409  QLTNFPLIPILQETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPK 468
            QLTNFPL P+ QE++S KM++FWLDLAEGY NL  E+LK ++ +++  +F QV+ IY+PK
Sbjct: 419  QLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQLSIEIFQQVINIYVPK 478

Query: 469  ISLMNKQKIMEEDDDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVLIRGVGQAD-TN 527
            ISL NK+  +E  +D+++L+EF+DFR+A  DL + LW +LG+  LT VLI GVG  +  +
Sbjct: 479  ISLSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGNENLTNVLIAGVGSTEIAS 538

Query: 528  NVDLYQVEAMSFLLAKLLDGVNFSQSPFISDAI-GENHLIDNLLFLLQTGCKQKEHSKTA 586
              +L+ +E MS+LL KLL  +N  +S ++ D +     L+ N+  LL+TG         +
Sbjct: 539  ETELFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVANVQTLLRTGLD------NS 592

Query: 587  QVLKLDFVKATCNLLGVMATYFHVDSKPLGPIVESLFECLET-SRQYNPIEYSIKMELQL 645
              L +DFV+++  L+  ++ ++  + + +G  +E L + LE  +          K+E  L
Sbjct: 593  GPLSIDFVRSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKCAFSTGGANAFTKVESML 652

Query: 646  NRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIGNIIQMCVSEGP 705
             +TIS +C  CRKEL P+L NF   L SIM P+   S FTR    +SIG IIQ     GP
Sbjct: 653  VKTISTLCSVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTRRSLTRSIGYIIQGQFENGP 712

Query: 706  EAQANHISNMVDMIGGLIQTT--------DAKSDMLSLLACLSELGSGLSQLPNDDEFIE 757
            +AQ  +I  +V M   LI+          + ++ +  +L C+SELG+GL      D+   
Sbjct: 713  DAQGGNIDKLVMMFNNLIEQALGSGLSIQEKQNYIQCVLDCISELGNGLVYPQEMDD--- 769

Query: 758  NNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYALSK--YGTDPEFVEVSCLIIGKAITL 815
              P  +  LP ++ YW  DP+ ++ K+M +++  L    +      +E SCLI+GK++TL
Sbjct: 770  --PKVIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSSLIEASCLILGKSLTL 827

Query: 816  PDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEKIVAGFKDQLTSHEFDEMFK 875
            P++ P+FLRY ++E+++F  T +  CD A  LP+  Y LE + + +K  +TS EFD +F+
Sbjct: 828  PEEEPYFLRYSMNEIINFVFTHLQTCDIAPALPFFVYLLENLFSCYKATMTSAEFDVIFE 887

Query: 876  QFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKSEYWTQFIVPEFLKYLQAKEKF 935
            +  ++ Y   I  DPD +Q+ V++VNS+L+ KP +A+ S+YW+ FI+ EFL+ L  KEKF
Sbjct: 888  RVMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGIAVYSQYWSSFILKEFLQLLTHKEKF 947

Query: 936  TISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQLVYQTMFSLHHAQRSDVPQYAELI 995
            TI + TKFW K +NN++YT+E+ EI      ++G QL    M  L+H QRSD+  Y ELI
Sbjct: 948  TIVAVTKFWTKVVNNKKYTREELEITRQQVAAVGAQLTAHVMAGLYHTQRSDLNAYTELI 1007

Query: 996  RTLFAKYPMPMKDWLYELLPQITGKEAIFHERFINKLTVTRASRAT 1041
            RTL AK+P+  K WL  +LPQ+  K    HE+FINKL +TR SRA 
Sbjct: 1008 RTLVAKFPIEFKSWLVAVLPQLVDKPQA-HEKFINKLFITRGSRAA 1052

>Kwal_47.17457
          Length = 947

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/952 (42%), Positives = 612/952 (64%), Gaps = 39/952 (4%)

Query: 106  LVTITKLMSNLSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNS 165
            +  I KLMSN + IF  ++        N I  W+NP+ T + L                 
Sbjct: 1    MFVIKKLMSNAARIFFQLHDPK--HQENSI-TWKNPLETFLLLTSQ---------EGVRP 48

Query: 166  EIAERLVRTCLNEDVPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYE 225
            E+ +  ++  L E+VPY  LI  ++SS   N LLLLF++VI+ED+ K+Q+ K   S+++ 
Sbjct: 49   EVMDNFLQHILAENVPYDNLIQVVNSSTAFNTLLLLFSEVIIEDLIKFQATKVGSSHLHN 108

Query: 226  MVHNHLYISTMAILNFNLENMMSSGAT---------SEVFPCITSWIHYISMARNVSAHG 276
             V  HLYIS+M+I+N+NL+ + +S  T           VF C+ +WI Y +MAR+  + G
Sbjct: 109  AVREHLYISSMSIVNYNLQQLSASFQTRPHETPEVADTVFRCVRAWIEYATMARS-GSQG 167

Query: 277  TMDLTEMFNNMINVMCMASNGSQEFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLG 336
             +DLTE F N+I++MC+  N    FPYS+ ++SI  ++F  DPT++++E+R  LE +FLG
Sbjct: 168  HLDLTENFENLIHLMCL-HNPDFGFPYSETIVSILGEIFGTDPTILNYELRTTLEGVFLG 226

Query: 337  VSRHSMNTS--NDWMLAYMNHLVTNELYDDLKVLASCVVDFLQISNLDVCNKLFTNIHEN 394
            V R + N S  ++WML YMNHLV N+++DDLK LA CVVDFLQ+SNLDVCNKLFT +  +
Sbjct: 227  VGRTAQNKSEGHEWMLQYMNHLVVNQMFDDLKDLALCVVDFLQVSNLDVCNKLFT-VASD 285

Query: 395  TGDQSLEDYIRVLLQLTNFPLIPILQETYSSKMIEFWLDLAEGYGNLPQEALKADANEIA 454
            TG  +L+ YI+VLLQ+TNF L+P+L+E +S +M++FWLDL +GY NL +E LK +  E+A
Sbjct: 286  TGSGNLDQYIKVLLQMTNFTLVPVLEEFFSVRMVDFWLDLCDGYNNLVRETLKPETPELA 345

Query: 455  ENMFNQVVQIYLPKISLMNKQKIMEEDDDQSLLHEFDDFRSATQDLMEILWTILGHSKLT 514
             N+F QV QIYLPKI+L NKQKI+ E ++ SLLHEFDDFR A  DL+E +W++LGH KLT
Sbjct: 346  ANIFGQVAQIYLPKINLQNKQKIIREGEEDSLLHEFDDFRGAVLDLIESMWSVLGHEKLT 405

Query: 515  IVLIRGVGQ-ADTNNVDLYQVEAMSFLLAKLLDGVNFSQSPFISDAI-GENHLIDNLLFL 572
             +L+  +GQ A ++  DL+QVEAM F L KLL  +N ++SP + +++      + N+L L
Sbjct: 406  DILVYSIGQIAPSSAEDLFQVEAMCFCLNKLLADMNLAESPSVCESLRNSKGFLANVLLL 465

Query: 573  LQTGCKQKEHS--KTAQVLKLDFVKATCNLLGVMATYFHVDSKPLGPIVESLFECLETSR 630
            +QT C+QK+ S  + AQ+L  DF+K   ++L  ++ YF  D   L   +++LF  LET  
Sbjct: 466  IQTSCQQKDASNGREAQILSSDFIKTGSSMLATVSDYFKRDEAELRNCMDTLFSSLETCS 525

Query: 631  QYNPIEYSIKMELQLNRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVSHFTREKFV 690
              + ++   K EL + +  + ICE  R EL  +LP F ++  ++++P S VS F+++ F 
Sbjct: 526  NKDAVD--TKFELLITKCTTSICEKSRLELGSYLPTFTKIQHAMIQPSSNVSSFSKQGFT 583

Query: 691  KSIGNIIQMCVSEGPEAQANHISNMVDMIGG-LIQTTDAKSDMLSLLACLSELGSGLSQL 749
            + +G IIQ    +GPEAQA ++  +++ I   ++   + +  +L LL+CLSELGS   Q 
Sbjct: 584  RCLGYIIQAYTRDGPEAQAQYLLQVINSIKSEVVNANNDRDQILCLLSCLSELGSAFIQ- 642

Query: 750  PNDDEFIENNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYALSKYGTDPEFVEVSCLII 809
               DEF   +P YL+QL  FQ +W +DP+ ++ +++ +++  L+ +G DPEF+EV+CLI+
Sbjct: 643  --SDEF--EDPAYLSQLSHFQTFWQEDPLHLRVQILDMLESILALHGKDPEFIEVACLIM 698

Query: 810  GKAITLPDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEKIVAGFKDQLTSHE 869
            GK + + DD PHFL Y + E+M F +     C+ +SGL +I Y LEK+V  ++  L+  +
Sbjct: 699  GKKLNVSDDEPHFLGYSMHELMDFLLRRCDTCEPSSGLSFIIYLLEKVVIQYRSSLSPQD 758

Query: 870  FDEMFKQFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKSEYWTQFIVPEFLKYL 929
            F+ M   FFL  +   +S+DPDL Q MV++VNSV++++P LA+  E W  F++PEF++ L
Sbjct: 759  FNFMLSSFFLEKHRDAVSADPDLTQLMVTFVNSVMDSRPGLAVHCEQWAVFLLPEFMRLL 818

Query: 930  QAKEKFTISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQLVYQTMFSLHHAQRSDVP 989
             +KE+FTIS+ TKFW K +NN++YT+ D   +      +G +L   TM +L  AQRS++ 
Sbjct: 819  SSKERFTISAVTKFWTKVINNKKYTRHDEVTVREQIFGLGLELTNGTMSALLSAQRSELN 878

Query: 990  QYAELIRTLFAKYPMPMKDWLYELLPQITGKEAIFHERFINKLTVTRASRAT 1041
             Y++L+R L A+YP+  K WL + LP +       H+  + KL VTR SRA 
Sbjct: 879  FYSDLLRALIARYPLQSKQWLLQTLPLLCENHRA-HQLLVEKLFVTRGSRAA 929

>AGR166W [4477] [Homologous to ScYGL016W (KAP122) - SH]
            complement(1056332..1059373) [3042 bp, 1013 aa]
          Length = 1013

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1019 (36%), Positives = 589/1019 (57%), Gaps = 42/1019 (4%)

Query: 41   LANALLSQENGSTN-VKYFGALTYTVQLTTCLHTESQLWSIFQGNLVHLTRMMFLFTSNP 99
            +A+ALLS E+ +   + YFGALTYTVQL     TE+Q  ++ +GNLVH  R++  + + P
Sbjct: 1    MAHALLSVEDDAQGLINYFGALTYTVQLYRNSETETQQAALLEGNLVHFARLLGTYLAAP 60

Query: 100  AAASNLLVTITKLMSNLSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFE 159
                  L  + KLMSNL+ +F+ +N    G+     P W+NPV+T + LL    + +   
Sbjct: 61   E--KRFLQVLRKLMSNLARLFIKVNQKTAGSGD---PTWKNPVHTILFLLHAYRQGDRSR 115

Query: 160  WRTDNSEIAERLVRTCLNEDVPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSS 219
            W   +++++E  VR  L+ ++P+ ELIG + SSA LN+ +LL  +V+ ED+   QS++S 
Sbjct: 116  WHLGDAQLSET-VRASLHVEIPFEELIGFLDSSAELNRQMLLCVRVLAEDLTSEQSRRSP 174

Query: 220  LSNVYEMVHNHLYISTMAILNFNLE------NMMSSGATSEVFPCITSWIHYISMARNVS 273
            L +V  +V  HLYI+ MA++N  LE      N + + A + VF  IT+WI Y+S+ R  S
Sbjct: 175  LHDVNALVRKHLYITAMAMINHTLEQSMLPENCLYAAAETVVFEAITAWIEYVSLVRTNS 234

Query: 274  AHGTMDLTEMFNNMINVMCMASNGSQEFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAI 333
                MDLT++F ++I +MC++ +GS  FP++D VI I   + S+ P LM+ ++R +LE+I
Sbjct: 235  P-DYMDLTDLFEHLIRLMCISCDGS--FPFADTVIRILSSVLSHHPELMNVDLRVQLESI 291

Query: 334  FLGVSR----HSMNTSNDWMLAYMNHLVTNELYDDLKVLASCVVDFLQISNLDVCNKLFT 389
            FLGV+R         S++WML YMNHLV    YD L  LA+CVV FL ++ LD+ ++LFT
Sbjct: 292  FLGVTRSDDQQVSRQSHEWMLLYMNHLVAAGAYDGLSDLATCVVGFLNLNCLDISSRLFT 351

Query: 390  NIHENTGDQSLEDYIRVLLQLTNFPLIPILQETYSSKMIEFWLDLAEGYGNLPQEALKAD 449
              H +T    ++ YI+VLLQLTNFP  P+LQE YS  M  FW DL + Y  L  + L+ D
Sbjct: 352  RAHNDTS--QIQQYIKVLLQLTNFPAAPVLQEVYSVHMTTFWQDLCDSYYGLSADVLRPD 409

Query: 450  ANEIAENMFNQVVQIYLPKISLMNKQKIMEE---DDDQSL--LHEFDDFRSATQDLMEIL 504
               IAE++F Q+V IYLPK+SL+NK KI++    D +Q+   + +F+ FR+    L+   
Sbjct: 410  GPAIAEDVFGQLVDIYLPKVSLINKLKIIDGTIGDAEQTRGSISKFEYFRNEVATLVAQS 469

Query: 505  WTILGHSKLTIVLIRGVG--QADTNNVDLYQVEAMSFLLAKLLDGVNFSQSPFISDAIGE 562
            W ILG+SKLT  LI  V   Q  + +VDL+QVE M+FLL +LL+GV+  ++P + + I E
Sbjct: 470  WMILGNSKLTNQLILKVCEQQRQSGSVDLFQVECMAFLLERLLEGVDLEETPQLCELIRE 529

Query: 563  NHLIDNLLFLLQTGCKQKEHSKTAQVLKLDFVKATCNLLGVMATYFHVDSKPLGPIVESL 622
            + L++ +++LL  GCKQ  H++  + LKL FV     LL  + TYF V+   L  +V ++
Sbjct: 530  SELMEYIMYLLNAGCKQHMHTEGLEKLKLQFVDTGSALLRNLLTYFKVNQDSLIHVVGNI 589

Query: 623  FECLETSRQYNPIEYSIKMELQLNRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVS 682
            F C+    ++N  + +  +E  L +T + +C  CR E++P  P+ + ++  ++ P S  S
Sbjct: 590  FSCMAECSRFNSPDDTNDIEASLMQTFTALCNQCRHEMVPLFPSLLGIMEQMLSPASNTS 649

Query: 683  HFTREKFVKSIGNIIQMCVSEGPEAQANHISNMVDMIGGLIQTTDAKSDMLSLLACLSEL 742
               R   V+S+  IIQ   S+ P +    I+NM+D+        D KS   +LL  + EL
Sbjct: 650  KSVRRDMVRSVSFIIQAGSSQDPISLGKDINNMLDLFCATTDVADKKSTN-ALLTYILEL 708

Query: 743  GSGLSQLPNDDEFIENNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYALSKYGTDPEFV 802
            G GL       E      + +A     + +   D  ++ DKV+ ++     ++  D   +
Sbjct: 709  GQGL-------EDCSGGGIDVAGHKVLEKHVQADLQQIHDKVLSVIYAGCKQHNGDTNLI 761

Query: 803  EVSCLIIGKAITLPDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEKIVAGFK 862
            + SCLI+G  + +    PH  R+ + +++ F    ++ C+  + LP++   LE+++    
Sbjct: 762  QTSCLILG--LNVQSKPPHLFRFTVPQILDFLFAQLALCNLGACLPHMIRLLERLLVHQL 819

Query: 863  DQLTSHEFDEMFKQFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKSEYWTQFIV 922
            D  +  +FD +   FF+ +Y+  I+ DPDLI SM ++  + L+ KP+  L+S +   F++
Sbjct: 820  DAFSQEQFDHLLLSFFVQHYAL-IAEDPDLIHSMGTFFVTALQKKPAFVLRSAHMHSFVL 878

Query: 923  PEFLKYLQAKEKFTISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQLVYQTMFSLHH 982
            P FL Y+ A+E  TI +  +FW   L N RY  +D   + A    +G QLV  TM +L H
Sbjct: 879  PRFLDYIAAQESLTIRAAVRFWSLFLKN-RYLPDDRAAVTACMSLIGPQLVSNTMRALFH 937

Query: 983  AQRSDVPQYAELIRTLFAKYPMPMKDWLYELLPQITGKEAIFHERFINKLTVTRASRAT 1041
             +RS++  Y +++R L A YP+  K WL   + ++ G+  + H RFI  + VTR S A 
Sbjct: 938  VRRSEINSYTDILRALVASYPIQTKAWLSATMAKLDGRPEV-HARFIESILVTRGSHAA 995

>Kwal_55.19981
          Length = 645

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 9/48 (18%)

Query: 810 GKAITLPDD----IPHFLRYPLSEMMS---FYMTCISNCDYASGLPYI 850
           G+ I +  D    +PH  ++PLS++       M C+S CDY +G+P +
Sbjct: 191 GEGIEICSDDFQYLPH--KFPLSQLSPEEMRIMVCLSGCDYTAGIPKV 236

>ACL083C [966] [Homologous to ScYOR090C (PTC5) - SH]
           (199845..201470) [1626 bp, 541 aa]
          Length = 541

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 13/71 (18%)

Query: 847 LPYIEYQLEKIVAGFKDQLTSHEFDEMFKQFFLNYYSSHISSDPDLIQSMVSWV------ 900
           +PY+ +QL KI A   + LTS   D+  +Q FL         D D++Q  +         
Sbjct: 190 VPYVAHQLSKIYAQGNEALTSEAIDDAIEQGFLQL-------DNDIVQKTLGQFFENPSK 242

Query: 901 NSVLEAKPSLA 911
            S++EA P+++
Sbjct: 243 ESLIEALPAVS 253

>KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomyces
           cerevisiae YPL226w NEW1, start by similarity
          Length = 1183

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 426 KMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPKI-SLMNKQKIMEEDDDQ 484
           KM E  +D+ +G G+   EAL           +    + +LPK  S ++K+K++EE  D+
Sbjct: 914 KMFEKEIDIGDGRGSRQVEALVGRQKLKKSFQYEVKWKWWLPKYNSWVSKEKLLEEGFDK 973

Query: 485 SLLHEFDDFRSATQDL 500
            L+ +FDD  ++ + L
Sbjct: 974 -LVQKFDDHEASREGL 988

>ADL019W [1723] [Homologous to ScYPL260W - SH]
           complement(675944..677521) [1578 bp, 525 aa]
          Length = 525

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 116 LSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERLVRTC 175
           LSL FLT+         N  PA    ++T  +LL+H  E+N++ + +D   I ERL    
Sbjct: 54  LSLSFLTVGL------KNTAPATYASLSTVQRLLEHMEEANVYTY-SDLRPIKERLDE-- 104

Query: 176 LNEDVPYTELIGNISSSAPLNKL 198
           + E V     +  +   APL++L
Sbjct: 105 IGEIVEKNSYMSMVEDEAPLDEL 127

>YPL260W (YPL260W) [5190] chr16 (49303..50958) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.7361p [1656 bp, 551 aa]
          Length = 551

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 18/84 (21%)

Query: 99  PAAASNLLVTITKLMSN-----------LSLIFLTINSDAIGADSNKIPAWRNPVNTCIK 147
           PA ++  L+  T+L +            LSL FLT+         N  PA    ++T   
Sbjct: 72  PAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGL------KNSAPATYASLSTVES 125

Query: 148 LLQHCNESNLFEWRTDNSEIAERL 171
           LL+H NESN+F    D S I ERL
Sbjct: 126 LLEHLNESNVF-THHDLSPIKERL 148

>YNR073C (YNR073C) [4656] chr14 complement(774789..776297) Putative
           mannitol dehydrogenase with similarity to E. coli
           D-mannonate oxidoreductase, nearly identical to Yel070p
           [1509 bp, 502 aa]
          Length = 502

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 388 FTNIHENTGDQSLEDYIRVLLQLTNFPLIPILQ----ETYSSKMIE 429
           +T IHE   D ++  YIRVL++    PL+P +     E Y++ ++E
Sbjct: 324 YTYIHEVVNDPTINKYIRVLMREEVIPLLPKVPGVDFEEYTASVLE 369

>YEL070W (YEL070W) [1360] chr5 (19589..21097) Putative mannitol
           dehydrogenase, nearly identical to Ynr073p [1509 bp, 502
           aa]
          Length = 502

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 388 FTNIHENTGDQSLEDYIRVLLQLTNFPLIPILQ----ETYSSKMIE 429
           +T IHE   D ++  YIRVL++    PL+P +     E Y++ ++E
Sbjct: 324 YTYIHEVVNDPTINKYIRVLMREEVIPLLPKVPGVDFEEYTASVLE 369

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 612 SKPLGPIVESLF-ECLETSRQYNPIEYSIKMELQLNRTISLICENCRKELIP 662
           S+P+ PI + +F EC     ++  +EY   ++ Q  + + L C NCR+ + P
Sbjct: 879 SEPIEPITQVIFTECAHAFCEHCLLEY---IDFQTQKKLELKCPNCRESIDP 927

>YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondrial
           inner membrane nuclease with a role in stabilizing the
           mitochondrial genome, expression is induced by DNA
           damage [1293 bp, 430 aa]
          Length = 430

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 763 LAQLPAFQAYWLQDPMRVKDKVMHLVQYALSKYGTDPEFVEVSCLII-------GKAITL 815
           L  +P   A +  DP  V  + M L+Q  +S+   D + +   C  +       GKA+ +
Sbjct: 139 LHSIPYIVAPFEADPQMVYLEKMGLIQGIISE---DSDLLVFGCKTLITKLNDQGKALEI 195

Query: 816 PDD----IP-HFLRYPLSEMMSFYMTCISNCDYASGL 847
             D    +P +F    LSE     + C++ CDY SG+
Sbjct: 196 SKDDFSALPENFPLGELSEQQFRNLVCLAGCDYTSGI 232

>Kwal_33.13665
          Length = 2119

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 419  LQETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQV 461
            L+ TY S+ +  W+DL  GY    QEA+KA       N+FN++
Sbjct: 1728 LESTYVSERLHEWIDLIFGYKQKGQEAVKAI------NVFNRL 1764

>Kwal_55.20832
          Length = 575

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 116 LSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERL 171
           LSL FLT+         N  PA    ++T  +LL+H +ESN+F    D   I ERL
Sbjct: 95  LSLSFLTVGL------KNSAPATYASLSTVQRLLEHLDESNVFTHH-DLRPIKERL 143

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,823,457
Number of extensions: 1479748
Number of successful extensions: 4613
Number of sequences better than 10.0: 35
Number of HSP's gapped: 4690
Number of HSP's successfully gapped: 35
Length of query: 1043
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 931
Effective length of database: 12,718,893
Effective search space: 11841289383
Effective search space used: 11841289383
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)