Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A04862g50349526450.0
Kwal_47.1745354454012431e-167
AGR165W50050912281e-165
Sklu_1768.254253711891e-159
YGL017W (ATE1)50350111181e-149
Scas_638.951051410871e-144
CAGL0A00319g50951010611e-140
Scas_634.1268993730.77
CAGL0H01573g35949720.92
Sklu_2354.947534692.2
CAGL0H02145g62868656.0
Kwal_55.20766268076666.0
KLLA0D05137g59567656.8
KLLA0E06435g96562657.5
CAGL0E05170g35241639.5
CAGL0M09449g10781046410.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04862g
         (495 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04862g 431710..433221 similar to sp|P16639 Saccharomyces c...  1023   0.0  
Kwal_47.17453                                                         483   e-167
AGR165W [4476] [Homologous to ScYGL017W (ATE1) - SH] complement(...   477   e-165
Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement        462   e-159
YGL017W (ATE1) [1956] chr7 (459857..461368) Arginyltransferase (...   435   e-149
Scas_638.9                                                            423   e-144
CAGL0A00319g 30978..32507 similar to sp|P16639 Saccharomyces cer...   413   e-140
Scas_634.12                                                            33   0.77 
CAGL0H01573g complement(153035..154114) similar to tr|Q04431 Sac...    32   0.92 
Sklu_2354.9 YOL125W, Contig c2354 11872-13299                          31   2.2  
CAGL0H02145g complement(190804..192690) weakly similar to sp|P13...    30   6.0  
Kwal_55.20766                                                          30   6.0  
KLLA0D05137g 441827..443614 highly similar to sp|P15624 Saccharo...    30   6.8  
KLLA0E06435g complement(581935..584832) similar to sp|P38164 Sac...    30   7.5  
CAGL0E05170g complement(504611..505669) similar to tr|Q12068 Sac...    29   9.5  
CAGL0M09449g complement(938424..941660) similar to sp|P38167 Sac...    29   10.0 

>KLLA0A04862g 431710..433221 similar to sp|P16639 Saccharomyces
           cerevisiae YGL017w ATE1 arginyl tRNA transferase
           singleton, start by similarity
          Length = 503

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/495 (100%), Positives = 495/495 (100%)

Query: 1   MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHKFASPGWSDFYKGDEDKVELQSSTVG 60
           MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHKFASPGWSDFYKGDEDKVELQSSTVG
Sbjct: 1   MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHKFASPGWSDFYKGDEDKVELQSSTVG 60

Query: 61  FNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLKR 120
           FNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLKR
Sbjct: 61  FNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLKR 120

Query: 121 FKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRYQHYIHSD 180
           FKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRYQHYIHSD
Sbjct: 121 FKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRYQHYIHSD 180

Query: 181 EDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGERVTKNGPAHECYYHNGKL 240
           EDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGERVTKNGPAHECYYHNGKL
Sbjct: 181 EDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGERVTKNGPAHECYYHNGKL 240

Query: 241 IALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYIDDCPK 300
           IALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYIDDCPK
Sbjct: 241 IALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYIDDCPK 300

Query: 301 MNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFVGLNSTVASPDSEILITSASDKINF 360
           MNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFVGLNSTVASPDSEILITSASDKINF
Sbjct: 301 MNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFVGLNSTVASPDSEILITSASDKINF 360

Query: 361 DEPFINAVDDIYGPNGNASQNAITSVAKLRKYGINYSPDLQRSIYKEIPNDGNSTSSASS 420
           DEPFINAVDDIYGPNGNASQNAITSVAKLRKYGINYSPDLQRSIYKEIPNDGNSTSSASS
Sbjct: 361 DEPFINAVDDIYGPNGNASQNAITSVAKLRKYGINYSPDLQRSIYKEIPNDGNSTSSASS 420

Query: 421 DKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVVLFDTKINALRIVRDFISEKPEI 480
           DKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVVLFDTKINALRIVRDFISEKPEI
Sbjct: 421 DKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVVLFDTKINALRIVRDFISEKPEI 480

Query: 481 KTVITDVIRLIGLDN 495
           KTVITDVIRLIGLDN
Sbjct: 481 KTVITDVIRLIGLDN 495

>Kwal_47.17453
          Length = 544

 Score =  483 bits (1243), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 246/540 (45%), Positives = 345/540 (63%), Gaps = 49/540 (9%)

Query: 1   MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHK-FASPGWSDFYKGDEDKVELQSSTV 59
           M+ +D+LIIS+PLY ++  D KCGYC+GKK + +  FA+  W  +++ D   ++  + T+
Sbjct: 1   MELSDRLIISKPLYFTEPND-KCGYCSGKKSNLYDYFATESWYKYHEDDAKTLQFNNCTL 59

Query: 60  GFNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLK 119
           G   EL+  + YDKLCNLGFRRSG+F+YK DMLRNCCRLYTIRT  +   MSKELK+ + 
Sbjct: 60  GLQVELIPVDVYDKLCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPEKCQMSKELKSCVT 119

Query: 120 RFKKKITSPEFKP-----------------------QPKYVSWIDELCDYEPKSTSFKAV 156
           RF+K+I+S + +                        Q +Y  +++E+   E  S SF A 
Sbjct: 120 RFRKRISSQQSQTPSKGQNAGTIAQTARKGQAARNGQARY-DYVNEIVQAEKNSESFHAR 178

Query: 157 FEPAEFTDEKYDLYVRYQHYIHSDEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWH 216
           FEPA +++EKY L+VRYQ  +H D +N+   F+ FLC++PF +  + GT++EW+QLNNW 
Sbjct: 179 FEPATYSNEKYQLFVRYQENVHGDFNNSVKAFKRFLCESPFPEDVVAGTQEEWDQLNNWR 238

Query: 217 NLQPGERVTKNGPAHECYYHNGKLIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALR 276
           +++ GE + + GPAHECYY  GKLIAL+V DFLPSG+SSVYFIWDPD+  WSLGK+SALR
Sbjct: 239 DMKEGEVLKRVGPAHECYYFEGKLIALAVTDFLPSGISSVYFIWDPDFPKWSLGKLSALR 298

Query: 277 ELALVSKIGRPYYYLGYYIDDCPKMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELF- 335
           EL+++SKI R YYYLGYYIDDCPKM YK K+GG+ILDVCN +YVPL  +   I+H + F 
Sbjct: 299 ELSVLSKINRQYYYLGYYIDDCPKMKYKRKYGGDILDVCNNEYVPLDLVAPFIEHGKFFL 358

Query: 336 VGLNS-------TVASPDSEILITSASDKINFDEPFINAVDDIYGPNGNASQNAITSVAK 388
           +G N             D E L      +++ +    N VD IYG NG A  +A  +  K
Sbjct: 359 LGANKENDDDDDDPTEHDCEELPLDDVPRLHLNASNTNVVDRIYGENGGAELSANEAAEK 418

Query: 389 LRKYGINYSPDLQRSIYKEIPNDGNSTSSASSD-------------KKDVYRIPNVVPGL 435
           L + GI Y+P +    YK  P +  S +S+  +                +Y +PNVVPGL
Sbjct: 419 LAEMGIEYTPTIFPDPYK--PKEFASLTSSEPEVHYEEDDGDVPGYTNQIYHLPNVVPGL 476

Query: 436 VPLMEIVSLFESGKMNELNNNVVLFDTKINALRIVRDFISEKPEIKTVITDVIRLIGLDN 495
           +PL +I+ + ESG++N LNN ++L++T+   + +V DF +E   IK VI +VIR+IGL N
Sbjct: 477 LPLWQILHIIESGEINRLNNKLMLYNTRSGQIHLVNDFQAESKRIKRVICNVIRMIGLKN 536

>AGR165W [4476] [Homologous to ScYGL017W (ATE1) - SH]
           complement(1054381..1055883) [1503 bp, 500 aa]
          Length = 500

 Score =  477 bits (1228), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 241/509 (47%), Positives = 328/509 (64%), Gaps = 31/509 (6%)

Query: 1   MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHKFASPGWSDFYKGDEDKVELQSSTVG 60
           M+  D+LIIS+PLYIS+ ADP+CGYC G+KDS + +A   W + Y        L+++T+G
Sbjct: 1   MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNYACESWHERYAAG-GGAALRTATIG 59

Query: 61  FNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLKR 120
             +EL+  + YD+LCN+GFRRSG F+YKTD LRNCCR+YTIRT+   L  SKEL++ +KR
Sbjct: 60  LQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVKR 119

Query: 121 FKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRYQHYIHSD 180
           F + I +            ++ L   E  ST F   FEPA FT EKY+L+VRYQ  +H D
Sbjct: 120 FLRHIGAGAGGHG------VEALVAAEQASTRFCTRFEPARFTQEKYELFVRYQRAVHHD 173

Query: 181 EDNT-PSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGERVTKNGPAHECYYHNGK 239
                P QF  FLC++PF +  + GT +EW +LN W + +PG+R  + GP HECYY +GK
Sbjct: 174 TGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQRFRRVGPVHECYYFDGK 233

Query: 240 LIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYIDDCP 299
           LIAL V DFLPSGVSSVYFIWDPDY  WSLGK+SALRE+A+V +IGR YYYLGYYI+DCP
Sbjct: 234 LIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYYLGYYIEDCP 293

Query: 300 KMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFVGLNSTVASPDSEILITSASD--- 356
           KM YKAK+GGE+LDVCN +Y+PL  +   I+H   FV      A PD++     A D   
Sbjct: 294 KMKYKAKYGGELLDVCNNQYLPLRVLEPFIEHGRFFV---LDRAEPDADCSDDEAGDDPL 350

Query: 357 ---------KINFDEPFINAVDDIYGPNGNASQNAITSVAKLRKYGINYSPDLQRSIY-K 406
                    +++   P  + V+ IYG +G A   A  +V  L   G+ Y+P L   ++  
Sbjct: 351 SELPLDDRARLDPAAPLRDVVERIYGASGGAFAAANQAVEGLVDLGVEYTPQLDVGLFPS 410

Query: 407 EIPNDGNSTSSASSDKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVVLFDTKINA 466
           E P+  +  +       DVY++PNVVPGLVPL +I+ + +SG++  +N  ++++DT++  
Sbjct: 411 ETPDLRDCLA-------DVYQLPNVVPGLVPLWQILKILKSGEIRHINTKLMIYDTRLGR 463

Query: 467 LRIVRDFISEKPEIKTVITDVIRLIGLDN 495
           +R+VRDF  E    K VI +VIRLIGL N
Sbjct: 464 VRLVRDFHQEAKTTKRVICNVIRLIGLKN 492

>Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement
          Length = 542

 Score =  462 bits (1189), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 242/537 (45%), Positives = 334/537 (62%), Gaps = 45/537 (8%)

Query: 1   MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHK-FASPGWSDFYKGDEDKVELQSSTV 59
           M+ +D+LIIS+PLYI+D++   CGYC   K++ +  F +  W   +K     +E+ + T+
Sbjct: 1   MEISDRLIISKPLYINDSSS-NCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINNCTL 59

Query: 60  GFNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLK 119
           G   EL   E YD  CNLGFRRSG+F+YK DMLRNCCRLYTIRT  K   +SKE K+ + 
Sbjct: 60  GLQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCIS 119

Query: 120 RFKKKI----------------TSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFT 163
           RFKK+I                T  + K Q  Y  +++E+   E  S +F   FEPA +T
Sbjct: 120 RFKKRIAPSSESSLSPGGTPLATGGKGKKQQPY-DFVNEIISAELSSKNFYTRFEPAIYT 178

Query: 164 DEKYDLYVRYQHYIHSDEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGER 223
            EKY L+V+YQ  +H+D +N+   F+ FLC++PF +  + GT +EW +LNNW NL P  +
Sbjct: 179 PEKYQLFVKYQEKVHNDHNNSVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSK 238

Query: 224 VTKNGPAHECYYHNGKLIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSK 283
           + + GP HECYY+  KLIAL+V DFLPSG+SSVYFIWDP+Y  WSLGK+SALREL+L+SK
Sbjct: 239 IQRVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSK 298

Query: 284 IGRPYYYLGYYIDDCPKMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFVGLNS--- 340
           I R YYYLGYYI+DCPKM YK K+GG+ILDVCN +YVPL ++   ++H + FV  N    
Sbjct: 299 INRDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSNENNK 358

Query: 341 -----------TVASPDSEILITSASDKINFDEPFINAVDDIYGPNGNASQNAITSVAKL 389
                         +P SE+ +   + K + ++P  N V+ IYG  G A Q+A  +V KL
Sbjct: 359 KEDDDEYYEEVNELAPLSELPLDD-TKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKL 417

Query: 390 RKYGINYSPDLQRSIYK-------EIPNDGNSTSSASSD----KKDVYRIPNVVPGLVPL 438
              GI Y+P +   +YK       E P D         D      ++Y +PNVVPGL+PL
Sbjct: 418 TDLGIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPL 477

Query: 439 MEIVSLFESGKMNELNNNVVLFDTKINALRIVRDFISEKPEIKTVITDVIRLIGLDN 495
            +I+ + ESG++N LNN ++L++T+   +R+V DF  E    K VI +VIR+IGL N
Sbjct: 478 WQILQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLKN 534

>YGL017W (ATE1) [1956] chr7 (459857..461368) Arginyltransferase
           (arg-tRNA protein transferase), transfers arg to N-Asp
           or N-Glu of proteins prior to degradation by the N-end
           rule pathway [1512 bp, 503 aa]
          Length = 503

 Score =  435 bits (1118), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 219/501 (43%), Positives = 317/501 (63%), Gaps = 20/501 (3%)

Query: 3   FTDKLIISRPLYISDNADPKCGYCNGKKDSS--HKFASPGWSDFYKGDEDKVELQSSTVG 60
            +D+ +I  P   ++ A  KCGYC+G K  +    FA   W+  Y    D V++++ T+G
Sbjct: 1   MSDRFVIWAPSMHNEPA-AKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIG 59

Query: 61  FNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLKR 120
              E ++  TYD++CN+GFRRSG F+YK D LRNCCRLYTIRT  + L M+KELK  + R
Sbjct: 60  SFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISR 119

Query: 121 FKKKITSPEFKPQPKYVS-WIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRYQHYIHS 179
           F  +ITS ++ P     S ++ ++ + E  S +F   FEPA +++EKY L+V+YQ  +H 
Sbjct: 120 FATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQ 179

Query: 180 DEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGERVTKNGPAHECYYHNGK 239
           D +N+P  F+ FLCDTPF    + GT++ WEQLNNW  ++PGE++   GP HECYY+ GK
Sbjct: 180 DYNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEGK 239

Query: 240 LIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYIDDCP 299
           LIA++V D LPSG+SSVYFIWDPDY  WSLGK+SALR+LA++ +    YYYLGYYI+DCP
Sbjct: 240 LIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCP 299

Query: 300 KMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFV-GLNSTVASPDSEILITSASDKI 358
           KMNYKA +G E+LDVC+ KY+PL  I  +I   +LFV G   T  + +  ++ +      
Sbjct: 300 KMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRGE 359

Query: 359 NFDE----PFINAVDDIYGPNGNASQNAITSVAKLRK-YGINYSPDLQRSIYKEIPNDGN 413
            F       + N  ++IYG  G A ++A  S  +L++ YGI Y  +   +IY    ++G+
Sbjct: 360 GFPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLKEHNGH 419

Query: 414 STSSASSDKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVVLFDTKINALRIVRDF 473
           + +           IPNVVPGL+PL E++ + +SGK+ +L   + LF+ +   +R + +F
Sbjct: 420 APNG----------IPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINF 469

Query: 474 ISEKPEIKTVITDVIRLIGLD 494
            SE P +K  I DVIRL G +
Sbjct: 470 YSEPPNVKKRICDVIRLFGFE 490

>Scas_638.9
          Length = 510

 Score =  423 bits (1087), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 225/514 (43%), Positives = 320/514 (62%), Gaps = 33/514 (6%)

Query: 1   MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHK-FASPGWSDFYKG--DEDKVELQSS 57
           M   D+LII++P+Y  ++A  +CGYC+GKK +    F    W + YK   D D     + 
Sbjct: 1   MSLQDRLIITKPMYFKESAS-ECGYCHGKKKNPRNYFPLDSWYEKYKDGFDLDAPNRGTY 59

Query: 58  TVGFNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTS 117
            +GF +EL+  E YD LCNLGFRRSG F+Y+ DMLRNCCRL+TIRT+     ++KEL+ +
Sbjct: 60  NLGFQAELMTVEMYDTLCNLGFRRSGKFIYRHDMLRNCCRLFTIRTSPDQFQITKELRKT 119

Query: 118 LKRFKKKITSPEFKPQP----KYVSWIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRY 173
           +K+FKK IT+ +   +P    +   +I E+   E  S  FK VFEPA FT EKYDL+ +Y
Sbjct: 120 VKKFKKHITAVDAIEEPSSKNQKFDFIKEIISAEKASPDFKTVFEPAIFTQEKYDLFAKY 179

Query: 174 QHYIHSDEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHN--LQPGERVTKNGPAH 231
           Q  +H+D  + P  F+ FLCD PF    ITGT +EW+ LN W +       ++T+ GP H
Sbjct: 180 QENVHNDFKHNPKSFKRFLCDGPFMPQVITGTAEEWKALNEWQDQDFNNSTKITRLGPTH 239

Query: 232 ECYYHNGKLIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYL 291
           ECYY+  KLIA++VLDFLPSGVSSVYFIWDPD+  WSLGK+SA+RE+A++SK+ R YYY+
Sbjct: 240 ECYYYKDKLIAMAVLDFLPSGVSSVYFIWDPDFKKWSLGKISAMREMAILSKLQRKYYYM 299

Query: 292 GYYIDDCPKMNYKAKFGGEILDVCNQKYVPLSKIH--QIIKHNELFVGLNS-TVASPDSE 348
           GYY++DCPKMNYK  +GGE+LDVCN +YV L  +H  Q+I + +LFV   S T  S DS 
Sbjct: 300 GYYVEDCPKMNYKGAYGGELLDVCNGEYVSLDFLHRKQMISNGKLFVMDESETGTSSDSP 359

Query: 349 ILIT-SASDKINFDEPFINA-------VDDIYGPNGNASQNAITSVAKLRKYGINYSPDL 400
           ++   SA  + NF  P +N         ++IYG NG A  +    ++ L  + + Y  + 
Sbjct: 360 LMRKLSAESENNF--PSVNTKVKSKNIAENIYGVNGEAYDDIEQYISGLLNFDMPYLSED 417

Query: 401 QRSIYKEIPNDGNSTSSASSDKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVVLF 460
           + +IY  I   G+  S+          +PNV PGL+PL E+  + E  ++ +LN  +++ 
Sbjct: 418 EDAIYGVIKAGGDGMSA----------LPNVSPGLLPLQELYFIVELEEITDLNGKLLIL 467

Query: 461 DTKINALRIVRDFISEKPEIKTVITDVIRLIGLD 494
           DT  N +R + +   E    K VI D++R +GL+
Sbjct: 468 DTDDNEIRPMLNIYGESESSKRVICDLVRTLGLE 501

>CAGL0A00319g 30978..32507 similar to sp|P16639 Saccharomyces
           cerevisiae YGL017w ATE1 arginyl tRNA transferase, start
           by similarity
          Length = 509

 Score =  413 bits (1061), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 226/510 (44%), Positives = 311/510 (60%), Gaps = 32/510 (6%)

Query: 5   DKLIISRPLYISDNADPKCGYCNGKKDSSHKFAS-PGWSDFYKGDED----KVELQSSTV 59
           +KLII RPLY SD +D  CGYC+GKK     F S   W +  K + D    ++ ++S TV
Sbjct: 3   NKLIIHRPLYFSDKSD--CGYCHGKKAKGSDFYSLESWYERIKENADSEVEELPVRSCTV 60

Query: 60  GFNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLK 119
           GF  E +    YD++CN+GFRRSG F+YK D LR+CCRLYTIRT   +  ++K+++  + 
Sbjct: 61  GFQCENMTVAMYDQMCNMGFRRSGLFVYKMDALRSCCRLYTIRTRPDWFKLTKDMRKCIN 120

Query: 120 RFKKKITSPEFKPQPKYVSWIDELCDYEPKSTS--FKAVFEPAEFTDEKYDLYVRYQHYI 177
           RF+K +   E     K   +++++ D E +S S  F   F PA +TDEKY+L+  YQ  +
Sbjct: 121 RFRKHVLG-EPVANAKTQGYVEDIVDIEGQSDSINFYTRFGPAVYTDEKYELFSIYQERV 179

Query: 178 HSDEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGERVTKNGPAHECYYHN 237
           H D D++   F+ FLCD PFT   I GTE+EWEQLNNW +++PGER+ + GP HE YY+ 
Sbjct: 180 HQDFDHSKKGFKRFLCDAPFTQGVIMGTEEEWEQLNNWKSMKPGERLLRTGPVHESYYYK 239

Query: 238 GKLIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYIDD 297
           GKLIAL+V DFLPSG+SSVYFIW PDY+ WSLGK+SALREL+LVSK    YYYLGYYIDD
Sbjct: 240 GKLIALAVTDFLPSGISSVYFIWHPDYHKWSLGKLSALRELSLVSKTNLKYYYLGYYIDD 299

Query: 298 CPKMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFVGLNSTVASPDSEILITSA-SD 356
           C KMNYKA +GGE+LD C ++Y  LS++  +I+  +LF+ + +       E+ ++ A  D
Sbjct: 300 CKKMNYKANYGGELLDSCTERYFKLSQVKDMIRGGKLFM-VGTQGHDISREVALSDAIRD 358

Query: 357 KINFDEPFINAVDD-----IYGPNGNA--SQNAITSVAKLRKYGINYSPDLQRSIYKEIP 409
            I   + F  A DD     +YG + N    Q     ++ L+  G+ Y           I 
Sbjct: 359 CIYQTDAFDIASDDNVAEKVYGTSSNIYRPQYLKEVISFLKTSGLEYDF--------PIY 410

Query: 410 NDGNSTSSASSDKKDV----YRIPNVVPGLVPLMEIVSLFESGKMN-ELNNNVVLFDTKI 464
           NDG     A    KD     + IP++ PGL+PL E+  L  SGK+  EL    ++FDT  
Sbjct: 411 NDGVFNQYAKRIAKDGEDPDFTIPSICPGLIPLWELKDLLMSGKLQKELTGRTLVFDTSF 470

Query: 465 NALRIVRDFISEKPEIKTVITDVIRLIGLD 494
             +R +  +  E    KT I DV+RL+GL+
Sbjct: 471 GFIRKLEPWEDEDSTTKTAICDVVRLLGLE 500

>Scas_634.12
          Length = 689

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 13/93 (13%)

Query: 84  SFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLKRFKKKITSPEFKPQPKYVSWI--- 140
           S + K   L+NC R+  +R N+K+L    E +  +K F+    +PE +  P   + +   
Sbjct: 424 SVVLKLMKLKNCGRIQKLRLNQKWLKFETEWEKDMKSFRG--LTPEEEDVPDDTTELDES 481

Query: 141 --------DELCDYEPKSTSFKAVFEPAEFTDE 165
                   DE     P+++S  +    A+F D+
Sbjct: 482 ENDKFEEEDEFSSLTPRTSSRSSRINRADFVDD 514

>CAGL0H01573g complement(153035..154114) similar to tr|Q04431
           Saccharomyces cerevisiae YDR532c, hypothetical start
          Length = 359

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 11/49 (22%)

Query: 209 WEQLNNWHNLQPGERVTKN-----------GPAHECYYHNGKLIALSVL 246
           WE L+ W  LQ  +R+TKN               ECY     L  L+VL
Sbjct: 170 WELLDEWQRLQDDQRITKNEDNSNRKDTELNAMEECYEEWKTLEELAVL 218

>Sklu_2354.9 YOL125W, Contig c2354 11872-13299
          Length = 475

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 340 STVASPDSEILITSASDKINFDEPFINAVDDIYG 373
           ST  +P   +LI  AS+++ FD+ F++ V+D Y 
Sbjct: 243 STALNPPDFVLIDRASNRMKFDKKFVDDVNDFYS 276

>CAGL0H02145g complement(190804..192690) weakly similar to sp|P13574
           Saccharomyces cerevisiae YHR084w STE12 transcriptional
           activator, hypothetical start
          Length = 628

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 18  NADPKCGYCNGKKDSSHKFASPGWSDFYKGDEDKVELQSSTVGFNSELVNAETYDK-LCN 76
           N+  + G    +KDS H++ +    +  +        Q S   F+  L +AETYDK   N
Sbjct: 438 NSASRMGTQVEQKDSFHEYTTSSNEETIRSGVSVAHTQRSGSQFDDGLASAETYDKDDYN 497

Query: 77  LGFRRSGS 84
           +  R SGS
Sbjct: 498 IAGRTSGS 505

>Kwal_55.20766
          Length = 2680

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 17/76 (22%)

Query: 104  NEKYLTMSKELKTSLKRFKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFT 163
            N+ +  + K    SL RF + I +PE +   K V             T  KA+ +P ++T
Sbjct: 1508 NDSHKEVRKAADQSLTRFGEVIRNPEIQ---KLVP------------TLIKAIGDPTKYT 1552

Query: 164  DEKYDLYVRYQ--HYI 177
            +E  D  +R Q  HYI
Sbjct: 1553 EEALDALIRTQFVHYI 1568

>KLLA0D05137g 441827..443614 highly similar to sp|P15624
           Saccharomyces cerevisiae YLR060w FRS1 phenylalanyl-tRNA
           synthetase, alpha subunit, cytosolic singleton, start by
           similarity
          Length = 595

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 29/67 (43%)

Query: 114 LKTSLKRFKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRY 173
           +  SL  F   + +PE+K        I E    + +S +  A+     FT+  Y  ++  
Sbjct: 69  IAQSLNEFLGNVEAPEYKLSKPTTKLIIEESTTQIRSYACAAILRNVTFTEANYASFISL 128

Query: 174 QHYIHSD 180
           Q  +HS+
Sbjct: 129 QDKLHSN 135

>KLLA0E06435g complement(581935..584832) similar to sp|P38164
           Saccharomyces cerevisiae YBL104c singleton, hypothetical
           start
          Length = 965

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 9/62 (14%)

Query: 236 HNGKLIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYI 295
            NG+L  L +    P+G+         D     +GK S ++  AL+S  G P Y++   +
Sbjct: 721 ENGELEGLILTGITPNGI---------DLLQSYVGKTSDIQTAALISVFGSPRYFMDPRV 771

Query: 296 DD 297
           D+
Sbjct: 772 DE 773

>CAGL0E05170g complement(504611..505669) similar to tr|Q12068
           Saccharomyces cerevisiae YOL151w GRE2, start by
           similarity
          Length = 352

 Score = 28.9 bits (63), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 19  ADPKCGYCNGKKDSSHKFASPGWSDFYKGDEDKVELQSSTV 59
           +DP  GYC  KK     FA     DFY  ++D V+ + S +
Sbjct: 169 SDPIRGYCGSKK-----FAEKAAWDFYNANKDSVKFKLSII 204

>CAGL0M09449g complement(938424..941660) similar to sp|P38167
           Saccharomyces cerevisiae YBL101c involved in cell wall
           biogenesis and architecture, hypothetical start
          Length = 1078

 Score = 29.3 bits (64), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 11/104 (10%)

Query: 155 AVFEPAEFTDEKYDLYVRYQHYIHSDEDNTPSQFESF---------LCDTPFTDSEITGT 205
           +V  P + TD K +L  R + Y H+    T + FE F         L DT + D  +  T
Sbjct: 287 SVKSPIKLTDLKVELSSRVRIYWHAGVPPTKTFFEEFYQAGYVNWNLNDTNY-DVFVPTT 345

Query: 206 EKEWEQLNNWHNLQPGERVTKNGPAHECYYHNGKLIALSVLDFL 249
                Q+   HN  P  ++ +N P  E YY +   +    LD L
Sbjct: 346 VSSNTQIVERHNNTP-TKIFRNKPISERYYTDKSKLKRQYLDSL 388

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,505,440
Number of extensions: 899303
Number of successful extensions: 2732
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2777
Number of HSP's successfully gapped: 29
Length of query: 495
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 389
Effective length of database: 12,926,601
Effective search space: 5028447789
Effective search space used: 5028447789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)