Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A04103g78577336600.0
YOR322C81878714100.0
Scas_643.24d78467213471e-175
ACR291C68453712591e-163
CAGL0F00737g79580612001e-153
Kwal_26.71001781812626e-26
Scas_30.1d7248680.53
Scas_692.13108155760.66
CAGL0D06204g64974694.0
KLLA0C06633g63174676.5
CAGL0G00418g103997676.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04103g
         (773 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyce...  1414   0.0  
YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protei...   547   0.0  
Scas_643.24d                                                          523   e-175
ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981) [...   489   e-163
CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces cer...   466   e-153
Kwal_26.7100                                                          105   6e-26
Scas_30.1d                                                             31   0.53 
Scas_692.13                                                            34   0.66 
CAGL0D06204g complement(583144..585093) weakly similar to sp|P53...    31   4.0  
KLLA0C06633g 580349..582244 similar to sgd|S0002806 Saccharomyce...    30   6.5  
CAGL0G00418g 40916..44035 similar to sp|P46677 Saccharomyces cer...    30   6.8  

>KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 785

 Score = 1414 bits (3660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/773 (89%), Positives = 695/773 (89%)

Query: 1   MGFPKFGXXXXXXXXXXLQALDYTNHDDHPIELSINIESPPCVLYGSATESSGALLGGLL 60
           MGFPKFG          LQALDYTNHDDHPIELSINIESPPCVLYGSATESSGALLGGLL
Sbjct: 1   MGFPKFGSSKHNSSSSSLQALDYTNHDDHPIELSINIESPPCVLYGSATESSGALLGGLL 60

Query: 61  TVTINDDLPEIQPCKSTPLTPVNSGQRKQLTNXXXXXXXXXXXXXXXXXXXQKSGDNLKR 120
           TVTINDDLPEIQPCKSTPLTPVNSGQRKQLTN                   QKSGDNLKR
Sbjct: 61  TVTINDDLPEIQPCKSTPLTPVNSGQRKQLTNSLTTSLSHLSLSHAHHAHHQKSGDNLKR 120

Query: 121 LASMSNLITPPKAITSVSLNSVELSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWT 180
           LASMSNLITPPKAITSVSLNSVELSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWT
Sbjct: 121 LASMSNLITPPKAITSVSLNSVELSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWT 180

Query: 181 IMNKPTELAVGQHSFPFSHLIPGNLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKGESA 240
           IMNKPTELAVGQHSFPFSHLIPGNLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKGESA
Sbjct: 181 IMNKPTELAVGQHSFPFSHLIPGNLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKGESA 240

Query: 241 KRVLQLNLPISITRSILRGSDKTSLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICS 300
           KRVLQLNLPISITRSILRGSDKTSLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICS
Sbjct: 241 KRVLQLNLPISITRSILRGSDKTSLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICS 300

Query: 301 DDRRWRMRKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVKQDEERDRQIRKSSKPIKRSV 360
           DDRRWRMRKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVKQDEERDRQIRKSSKPIKRSV
Sbjct: 301 DDRRWRMRKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVKQDEERDRQIRKSSKPIKRSV 360

Query: 361 DMGPQVKMTVNTFHDVLLQQLSRANTEAEDVDNPEDTTTAPSDEALRDEDHDTIPDTPTD 420
           DMGPQVKMTVNTFHDVLLQQLSRANTEAEDVDNPEDTTTAPSDEALRDEDHDTIPDTPTD
Sbjct: 361 DMGPQVKMTVNTFHDVLLQQLSRANTEAEDVDNPEDTTTAPSDEALRDEDHDTIPDTPTD 420

Query: 421 FIHPNDDAXXXXXXXXXXXXXXXXXXXXLKQESALYTEEVRTIANGEIKSGWKSDFSDKG 480
           FIHPNDDA                    LKQESALYTEEVRTIANGEIKSGWKSDFSDKG
Sbjct: 421 FIHPNDDAMRQEIMQQQQRVRQQQIEEELKQESALYTEEVRTIANGEIKSGWKSDFSDKG 480

Query: 481 TIELVTDIDCMRLNSGVTNPISHASTRNPCVLPNQDNVNVSCDMEDTNLGVYVSHLLFVE 540
           TIELVTDIDCMRLNSGVTNPISHASTRNPCVLPNQDNVNVSCDMEDTNLGVYVSHLLFVE
Sbjct: 481 TIELVTDIDCMRLNSGVTNPISHASTRNPCVLPNQDNVNVSCDMEDTNLGVYVSHLLFVE 540

Query: 541 VIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNNADQRLAELSPIFADRENKPQPVID 600
           VIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNNADQRLAELSPIFADRENKPQPVID
Sbjct: 541 VIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNNADQRLAELSPIFADRENKPQPVID 600

Query: 601 NQPGNNVGPKIVGVPTGAARVLRMQFRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQ 660
           NQPGNNVGPKIVGVPTGAARVLRMQFRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQ
Sbjct: 601 NQPGNNVGPKIVGVPTGAARVLRMQFRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQ 660

Query: 661 DVXXXXXXXXXXXXXXXXXGESSLFTLETGNGAERAVTGSAPETXXXXXXXXXXXXAEYI 720
           DV                 GESSLFTLETGNGAERAVTGSAPET            AEYI
Sbjct: 661 DVSTTLLHSTLSSPTITPPGESSLFTLETGNGAERAVTGSAPETRSNSSVRLNVNNAEYI 720

Query: 721 RPPPALHHSANTSSTSIAFQFSDLDHVMSTQGAEPGFNSALTPQTTRMINVPT 773
           RPPPALHHSANTSSTSIAFQFSDLDHVMSTQGAEPGFNSALTPQTTRMINVPT
Sbjct: 721 RPPPALHHSANTSSTSIAFQFSDLDHVMSTQGAEPGFNSALTPQTTRMINVPT 773

>YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.578p [2457 bp, 818 aa]
          Length = 818

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/787 (41%), Positives = 444/787 (56%), Gaps = 55/787 (6%)

Query: 30  PIELSINIESPPCVLYGSATESSGALLGGLLTVTIND-----DLPEIQPCKSTPLTPVNS 84
           P+ LSI++ESPPCVLYGSA ESSGA+L GL TVT+ D     +   ++  +S   T   S
Sbjct: 28  PLTLSIDVESPPCVLYGSAMESSGAVLSGLFTVTVVDPYSSAEDKSLKNTESNVSTTSKS 87

Query: 85  GQRKQLTNXXXXXXXXXXXXXXXXXXXQKSGDNLKRLASMSNLITPPKAITSVSLNSVEL 144
            +RK                         S  ++    + +NL       T +++ SV L
Sbjct: 88  LKRKSTFGSALSSRLSSLSASTSNISPSTSSTSISHSPTPANLRIM-AGYTKITITSVTL 146

Query: 145 SLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWTIMNKPTELAVGQHSFPFSHLIPGN 204
           SL+QK+H+ KPF P+ + + TC NCKTKIT    W I +   +L+VG HS+PFS+LIPG+
Sbjct: 147 SLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKSWEIQSNTQDLSVGSHSYPFSYLIPGS 206

Query: 205 LPPTTHLGSNSHSTIKYELIAVATYKHPFKGK------------GESAKRVLQLNLPISI 252
           +P ++ LG+ + + +KYELIAV TY  P +                S KR+LQL +PI++
Sbjct: 207 VPCSSSLGATAETQVKYELIAVVTYIDPHRNSFSSGHSTPRKEGSSSKKRLLQLAMPIAV 266

Query: 253 TRSILRGSDKTSLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICSDDRRWRMRKLNW 312
           TRSI RG DK SLRVFPPTELTA AVLPNVVYPKSTF +E+KLDG+ S DRRWRMRKL+W
Sbjct: 267 TRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPKSTFPLEMKLDGVSSGDRRWRMRKLSW 326

Query: 313 RIEEKVKVRAHGCQAHKAKLKQLEEKVKQDEERDRQIRKSSKPIKRSVDMGPQVKMTVNT 372
           RIEE  +V+AH C  HK +L+QLEE+VK  E    +  +S   IKR  ++GPQ+++ VN+
Sbjct: 327 RIEETTRVKAHACPVHKHELRQLEEQVKIKESEKSKKPRSH--IKRYGELGPQIRVAVNS 384

Query: 373 FHDVLLQQL--SRANTEAEDVDNPEDT-TTAPSDEALRDEDHDTIPDTPTDFIHPNDDAX 429
             ++  Q+L       +A +   P  T      DE   +ED +  P   ++FIHP+DDA 
Sbjct: 385 LENMPSQRLPGEPGREQAPNSSGPASTGNVGLDDENPVNEDEEDQPG--SEFIHPSDDAL 442

Query: 430 XXXXXXXXXXXXXXXXXXXLKQESALYTEEVRTIANGEIKSGWKSDFSDKGTIELVTDID 489
                              LK  S+L+TEEVR I+ GE+KSGWK+DF + G IELVT+ID
Sbjct: 443 RQELLMQQQRARQQQLQQELKNNSSLFTEEVRIISKGEMKSGWKTDFDNNGKIELVTEID 502

Query: 490 CMRLNSGVTNPISHAST-RNPCVLPNQDNVNVSCDMEDTNLGVYVSHLLFVEVIVAEEQL 548
           CM LNSGV+NP+ HAST + P     + ++NV+CD++D NLG+YVSH+L VE++VAEE L
Sbjct: 503 CMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQDPNLGLYVSHILAVEIVVAEETL 562

Query: 549 QNVNGGNRSRTGSTVSDTSKTASKPKNNADQRLAELSPIFADRENKPQ----------PV 598
           Q  NG    +  S     +   +   +N DQRLAELSPIFA+R N P+          PV
Sbjct: 563 QYANGQPIRKPNSKNKKETNNNTMNVHNPDQRLAELSPIFANR-NTPKVRRMGPEDITPV 621

Query: 599 IDNQPGNNVGPK----------IVGVPTGAARVLRMQFRVIMTERSGLGISWDDEVPPAY 648
             N+  ++   +          IV VPTGAARVLRMQFR+ +TERSGLGISWD+EVPP Y
Sbjct: 622 NSNKSNHSTNKEKASNGASNSNIVSVPTGAARVLRMQFRLTVTERSGLGISWDEEVPPIY 681

Query: 649 QDIRMLTPPRYQ-DVXXXXXXXXXXXXXXXXXGESSLFTLETGNGAERAVTGSAPETXXX 707
           QD+ +L+PP Y+  +                  E         +       G  P     
Sbjct: 682 QDVELLSPPCYELSINNGIKNKLYSTMSTPVRSEDDFVGGSDEDIGNYESQGLEP----G 737

Query: 708 XXXXXXXXXAEYIRPPPALHHSANTSSTSIAF---QFSDLDHVMSTQGAEPGFNSALTPQ 764
                       +  PP  HH    SS+  +    Q   L+ V+S QG+ P     LTP 
Sbjct: 738 PNVQEVTITQNKLTIPPTAHHYQPASSSQRSLTTVQSPPLESVVSVQGSVPFRGHVLTPH 797

Query: 765 TTRMINV 771
           +TR I +
Sbjct: 798 STRDIRI 804

>Scas_643.24d
          Length = 784

 Score =  523 bits (1347), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 291/672 (43%), Positives = 407/672 (60%), Gaps = 70/672 (10%)

Query: 28  DHPIELSINIESPPCVLYGSATESSGALLGGLLTVTINDDLPE--------IQPCKSTPL 79
           +HPIELSIN+ESPPCVLYGSA +S+G+LL G++T+ + D   +        I+P KS P 
Sbjct: 127 EHPIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKPSKSAPQ 186

Query: 80  TPVNSGQRKQLTNXXXXXXXXXXXXXXXXXXXQKSGDNLKRLASMSNLITPPKAITSVSL 139
                G+RK                                  S + ++      T +S+
Sbjct: 187 KSPRPGRRKSAIGSTLSTTFSQLAVAQSQATASSQKTTPSPSPSNTKIM---NGYTKISV 243

Query: 140 NSVELSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWTIMNKPTELAVGQHSFPFSH 199
            SV L+ +QK+H+ KPF P  + + +CTNC+TK+T+   W I   P +  VG H++PFS+
Sbjct: 244 TSVSLTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYPFSY 303

Query: 200 LIPGNLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKG-ESAKRVLQLNLPISITRSILR 258
           LIPG++P T++LGSN+ + IKYELIAVATYK P +    +S +++L+L +P+++TRSI R
Sbjct: 304 LIPGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLVMPVAVTRSIPR 363

Query: 259 GSDKTSLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICSDDRRWRMRKLNWRIEEKV 318
           G DK SLRVFPPTELTA AVLPNV+YPKSTF +E+KLDG+   DRRWRMRKL+WR+EE  
Sbjct: 364 GPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKLSWRVEETT 423

Query: 319 KVRAHGCQAHKAKLKQLEEKVKQDEERDRQIRKSSKP---IKRSVDMGPQVKMTVNTFHD 375
           +VR++ C+ H+ +L++LE+ VK+     R+I ++ KP   IKR  D+GPQV++ V++  +
Sbjct: 424 RVRSYACKVHQHELRKLEKHVKE-----REIERNKKPMQQIKRYGDIGPQVRVAVSSPEN 478

Query: 376 VLLQQLSRANTEAEDVDNPEDTTTAPSDEALRD-----------EDHDTIPDTPTD-FIH 423
           + LQ+L        +      +   P D +              ED D   D   D FIH
Sbjct: 479 LPLQRLRNHGDLNSNSSRNNPSMRTPQDGSASSGNGHNGSNDIPEDRDDQDDVSVDEFIH 538

Query: 424 PNDDAXXXXXXXXXXXXXXXXXXXXL-KQESALYTEEVRTIANGEIKSGWKSDFSDKGTI 482
           P+DDA                    + K +S L+TEEVR IA G++KSGWK+DF + G I
Sbjct: 539 PSDDALRQELLQQQQRLREQQLQQEIAKNDSTLFTEEVRIIAKGDMKSGWKTDFENNGKI 598

Query: 483 ELVTDIDCMRLNSGVTNPISHASTRNPCVLPNQDNVNVSCDMEDTNLGVYVSHLLFVEVI 542
           ELVT+IDCM LNSGV NP++  ST  P +  ++ + N+SCD++D NLG+YV+H+L VE++
Sbjct: 599 ELVTEIDCMPLNSGVGNPVTMVSTSKPHINSHKQDANISCDIQDPNLGIYVNHILAVEIV 658

Query: 543 VAEEQLQNVNGG---NRSRTGSTVSDTSKTASKPKNNADQRLAELSPIFADRENKP--QP 597
           VAEE LQ  NG    ++SR+  + + ++  +S     ADQRLAELSP+FA+R N P  +P
Sbjct: 659 VAEETLQYSNGQPIRSKSRSDKSKNSSNSGSS-----ADQRLAELSPMFANR-NAPRTRP 712

Query: 598 VIDN--------------QPGNN------------VGPKIVGVPTGAARVLRMQFRVIMT 631
           V +N                GNN               K+V VPTGAARVLRMQFR+ +T
Sbjct: 713 VSNNSITPVNSRTTNGETSSGNNDENNSENAGLPINSSKVVSVPTGAARVLRMQFRLNVT 772

Query: 632 ERSGLGISWDDE 643
           ERSGLGISWD+E
Sbjct: 773 ERSGLGISWDEE 784

>ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981)
           [2055 bp, 684 aa]
          Length = 684

 Score =  489 bits (1259), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 256/537 (47%), Positives = 337/537 (62%), Gaps = 46/537 (8%)

Query: 144 LSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWTIMNKPTELAVGQHSFPFSHLIPG 203
           L L Q+V Y +PF   A  L +C  C+ +  E  RW ++ +  ELA G+H++PFSHL+ G
Sbjct: 72  LVLEQQVTYGRPF--VAGPLGSCAACRERRRELARWEVVAQAAELAGGRHAYPFSHLLAG 129

Query: 204 NLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKGESAKRVLQLNLPISITRSILRGSDKT 263
            LP T+ LGS   + I+YEL+A A Y+    G GE  +R  +L LP+ +TRSILRG D+ 
Sbjct: 130 ELPATSTLGSAGATQIRYELVADAVYR---AGGGEERRR--ELRLPVLVTRSILRGPDRN 184

Query: 264 SLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICSDDRRWRMRKLNWRIEEKVKVRAH 323
           SLRVFPPT++TA AVLP+V+YP+ST  +EL+L G+C  DRRWRMR+L WRI+EKV+VR+H
Sbjct: 185 SLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCADRRWRMRRLTWRIDEKVRVRSH 244

Query: 324 GCQAHKAKLKQLEEKVKQDEERDRQIRKSSKPIKRSVDMGPQVKMTVNTFHDVL-LQQLS 382
            C AH+A+L+ LEE+V+    R+  ++K +KPIKR+ DMGPQV ++V T  D L     S
Sbjct: 245 ACAAHRARLRALEEEVRAKTARN--LKKPAKPIKRTPDMGPQVTVSVATVEDPLPFDAGS 302

Query: 383 RANTEAEDVDNPEDTTTAPSDEALRDEDHDTIPDTPTDFIHPNDDAXXXXXXXXXXXXXX 442
            A  +  DV N +D                   DT + FIHP+D A              
Sbjct: 303 AAARQEADVGNMDDDA-----------------DTQSAFIHPSDHAMQQELQELQARIRQ 345

Query: 443 XXXXXXLKQESALYTEEVRTIANGEIKSGWKSDFSDKGTIELVTDIDCMRLNSGVTNPIS 502
                  KQE++ Y EEVRTIA  +I+SGWKSDFS  G IELV +IDCM+LNSGVTNP++
Sbjct: 346 QQLEEERKQETSHYIEEVRTIAGTDIRSGWKSDFSGSGKIELVMEIDCMKLNSGVTNPVN 405

Query: 503 HASTRNPCVLPNQDNVNVSCDMEDTNLGVYVSHLLFVEVIVAEEQLQNVNG--------- 553
             ST +P +   Q  VNV+CD+ED  LG+ V+HLL VE+IVAEE L   NG         
Sbjct: 406 MVSTTSPYLARGQAPVNVTCDVEDPTLGISVNHLLLVEIIVAEEMLHYTNGQLLSKGEAQ 465

Query: 554 GNRSRTGSTVSDTSKTASKPKNNADQRLAELSPIFADRENK--PQPVIDNQPG------- 604
           G     G  +++ +K A    ++ADQRLAELSP+FA+R N        ++ PG       
Sbjct: 466 GEGEGQGEALAE-AKPAGLAGSHADQRLAELSPMFANRNNSMFRASAEEHSPGLEPDGST 524

Query: 605 NNVGPKIVGVPTGAARVLRMQFRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQD 661
                +IVG PTGAARVLRMQF++ MTERSGLGISWDDEVPP YQ ++ L PP Y +
Sbjct: 525 AGADKRIVGTPTGAARVLRMQFKLTMTERSGLGISWDDEVPPKYQQVKFLYPPSYDE 581

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 35/55 (63%)

Query: 28 DHPIELSINIESPPCVLYGSATESSGALLGGLLTVTINDDLPEIQPCKSTPLTPV 82
          DH +EL + IESPPCVLYG  TES+GALL GL+TV +     E   C    LT V
Sbjct: 19 DHVVELGLEIESPPCVLYGPPTESAGALLSGLVTVHVQGAGAEAGGCVVARLTLV 73

>CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 795

 Score =  466 bits (1200), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 301/806 (37%), Positives = 419/806 (51%), Gaps = 154/806 (19%)

Query: 30  PIELSINIESPPCVLYGSATESSGALLGGLLTVTINDDLPEIQPCKSTPLTPVNSGQRKQ 89
           PI+L +N+ESPPCVLYGSAT+S+GA+L G   + + D      P     +  V++     
Sbjct: 56  PIDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKD------PQSENFIYSVDN----- 104

Query: 90  LTNXXXXXXXXXXXXXXXXXXXQKSGDNLKRLASMSNLITPPKAITSVSLNSVELSLIQK 149
                                 +  G N  +  +  N IT         + SV L  +QK
Sbjct: 105 ---------------------QEHGGRNATQHETGYNNIT---------ITSVHLKFVQK 134

Query: 150 VHYEKPFRPSAAV----------------LNTCTNCKTKITEFHRWTIMNKPTELAVGQH 193
           V Y KPF P +++                +  C NCK K T    W I +    + +G+H
Sbjct: 135 VTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSWNIQSTKKLITIGKH 194

Query: 194 SFPFSHLIPGNLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKGESAKRVLQLNLPISIT 253
           ++PFS+L+PG++P T+ LG ++++ I+YEL+   +Y  P     E    +L + +PI +T
Sbjct: 195 AYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHKDKE---YMLNIKMPIPVT 251

Query: 254 RSILRGSDKTSLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICS------DDRRWRM 307
           RSI RG DK SLRVFPPT+LTA AVLPNVVYPKSTF +E+KL+GI S       D+RWRM
Sbjct: 252 RSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGISSPSTGKGSDKRWRM 311

Query: 308 RKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVK-QDEERDRQIRKSSKPIKRSVDMGPQV 366
           RKL WR+EE  +V+ + C  HK  LK+LE++VK ++EER    +K   PIKR  D+GPQ+
Sbjct: 312 RKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERS---KKPPVPIKRYGDIGPQI 368

Query: 367 KMTVNTFHDVLLQQLSRAN-----TEAEDVDNPEDTTTAPSDEALRDEDHDTIPDTPTDF 421
           ++ +++  ++ L    R+      T +E+  N    ++   +    D D +   +T   F
Sbjct: 369 RIALSSPSNMPLSG-GRSGPQPTLTSSEEAPNSATLSSREGEAGNIDTDEN---ETTDQF 424

Query: 422 IHPNDDAXXXXXXXXXXXXXXXXXXXXLKQESALYTEEVRTIANGEIKSGWKSDF-SDKG 480
           +HP+DDA                    LK  SAL++EEVR I+ GE+KSGWK+DF SD G
Sbjct: 425 VHPSDDAMRQELLQQQQRQREQQLKQELKNSSALFSEEVRIISKGEMKSGWKTDFDSDNG 484

Query: 481 TIELVTDIDCMRLNSGVTNPISHASTRNPC-VLPNQDNVNVSCDMEDTNLGVYVSHLLFV 539
            +ELVTDID +  NSGV+NPI H ST +P    P+   V ++CD++D NLG+YV+H L +
Sbjct: 485 KVELVTDIDLLHSNSGVSNPIMHTSTTHPYKKKPDLPPVTIACDIQDPNLGIYVNHTLAI 544

Query: 540 EVIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNNA-------------DQRLAELSP 586
           E++VAEE LQ  NG      GS  S      SKP+                DQRL ELSP
Sbjct: 545 EIVVAEEALQYANGQPIRNGGSRRSSVIPEGSKPEGTTENMNDDDDDSREMDQRLLELSP 604

Query: 587 IFADRE-NKPQPVIDN-----------QPGNNVG---------PKIVGVPTGAARVLRMQ 625
           +FA+R   + +PV  N           + GNN G         P+IV VPTGAARVLRMQ
Sbjct: 605 MFANRNAQRAKPVEYNDLSPVNSRSSTRSGNNTGRITPHMSSTPRIVSVPTGAARVLRMQ 664

Query: 626 FRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQDVXXXXXXXXXXXXXXXXXGESSLF 685
           FR+ +TERSGLGISWD+EVPP Y +I+   PP Y+                         
Sbjct: 665 FRINVTERSGLGISWDEEVPPMYHEIQTNAPPSYEAA----------------------- 701

Query: 686 TLETGNGAE----RAVTGSAPETXXXXXXXXXXXXAEYIRPPPALHHSANTSSTSIAFQF 741
            L+   G +        G  PE                  PP A H+++N  +     Q 
Sbjct: 702 -LKDSGGVQIVDNSEDLGEEPEHQTPIIAF----------PPMAHHNNSNIRNNLTTVQS 750

Query: 742 SDLDHVMSTQGAEP-GFNSALTPQTT 766
             L++++S QGA P G  S LTP  T
Sbjct: 751 PQLENIISIQGAVPYGRGSPLTPNNT 776

>Kwal_26.7100
          Length = 178

 Score =  105 bits (262), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 90/181 (49%), Gaps = 10/181 (5%)

Query: 1   MGFPKFGXX--XXXXXXXXLQALDYTNHDDHPIELSINIESPPCVLYGSATESSGALLGG 58
           MGFPK G            +  +     +D  +EL I+IESPPCVLYG+ATES+GALL G
Sbjct: 1   MGFPKLGHQHDKKYASNSSVDRIFSDTSNDGLVELLIDIESPPCVLYGTATESTGALLSG 60

Query: 59  LLTVTINDDLPEIQPCKSTPLTPVNSGQRKQLTNXXXXXXXXXXXXXXXXXXXQKSGDNL 118
           LL V +    P  +   S PL+PVNS  RK+ ++                     +  N+
Sbjct: 61  LLKVRVKQ--PGDKISSSEPLSPVNSHGRKKKSSTGLNAISQTLSNLSL------ANANV 112

Query: 119 KRLASMSNLITPPKAITSVSLNSVELSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHR 178
             +AS     TP    T   + SV LSL+QKV Y KPF      + +C NC++K TE  R
Sbjct: 113 SPVASPGISRTPSVIFTKALVKSVSLSLVQKVRYAKPFDAQCNSIQSCLNCRSKDTERAR 172

Query: 179 W 179
           W
Sbjct: 173 W 173

>Scas_30.1d
          Length = 72

 Score = 30.8 bits (68), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 724 PALHHSANTSSTSIAFQFSDLDHVMSTQGAEPGFNSALTPQTTRMINV 771
           P  H   ++     + Q   L++V+S QG  PG    LTP TTR I +
Sbjct: 11  PVAHXHQDSFHGLASVQSPQLENVVSIQGNAPGHGYILTPHTTRDIGI 58

>Scas_692.13
          Length = 1081

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 299 CSDDRRWRMRKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVKQDEERDRQIRKSS 353
           C +  +  M   N R  +KVK       ++  KLK+LEEK K D ER   +RK+S
Sbjct: 815 CGNVNKSLMSNKNSRFYKKVK-----SISNNVKLKELEEKRKADTERLNSLRKTS 864

>CAGL0D06204g complement(583144..585093) weakly similar to sp|P53180
           Saccharomyces cerevisiae YGL045w, hypothetical start
          Length = 649

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 15/74 (20%)

Query: 188 LAVGQHSFPFSHLIPGNLPPTTHLGSNSHSTIKYELIAV-----ATYKHPFKGKGESAKR 242
           L  G H FPFS  +P         G   HS+IK+E  +V     A ++   + +G SAK 
Sbjct: 106 LTKGVHKFPFSIRVPS--------GKKIHSSIKFERGSVSYHLMAVFESVVEPEGVSAKV 157

Query: 243 VLQLNL--PISITR 254
             ++N+  PI + R
Sbjct: 158 RTKVNILVPIDVYR 171

>KLLA0C06633g 580349..582244 similar to sgd|S0002806 Saccharomyces
           cerevisiae YDR398w, start by similarity
          Length = 631

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 540 EVIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNNADQRLAELSPI-------FADRE 592
           ++ + EE L ++N GN+ R+G      +KT +  ++N+  RL  +          F+  E
Sbjct: 247 DIAIFEEPLVSINSGNKRRSGKISKQKNKTITLLRSNSATRLPIIKSFINKDLINFSWLE 306

Query: 593 NKPQPVIDN-QPGN 605
           N   P  D  Q GN
Sbjct: 307 NATTPYFDQVQLGN 320

>CAGL0G00418g 40916..44035 similar to sp|P46677 Saccharomyces
            cerevisiae YGR274c TAF145 TFIID subunit, hypothetical
            start
          Length = 1039

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 42/97 (43%), Gaps = 2/97 (2%)

Query: 515  QDNVNVSCDMEDTNLGVYVSHLLFVEVIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPK 574
            +DN+NV   +E+T+  ++    + ++  + E +L N+    + R    +  +     K  
Sbjct: 924  KDNLNVDKLLEETDTDIHNIEDIEMQKKILETELANLEKSQQRRARLNLKKSEGKVGKGA 983

Query: 575  NNADQRLAELSPIFADRENKPQPVI--DNQPGNNVGP 609
             N  +R A    +   R NK  P+   DN PG    P
Sbjct: 984  KNTSRRCATCGQVGHIRTNKSCPMYYSDNGPGGRNAP 1020

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,458,928
Number of extensions: 967321
Number of successful extensions: 2902
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2949
Number of HSP's successfully gapped: 51
Length of query: 773
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 664
Effective length of database: 12,822,747
Effective search space: 8514304008
Effective search space used: 8514304008
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)