Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A04081g52751927490.0
Sklu_1720.251851521230.0
Kwal_23.336652651720520.0
Scas_687.55604896062e-71
KLLA0D11330g5214625874e-69
Kwal_47.171695764895811e-67
Kwal_33.152765525265748e-67
YJR152W (DAL5)5434765676e-66
YLR004C5234635631e-65
Scas_590.105344625535e-64
KLLA0D02970g5504625344e-61
Kwal_26.66585454885203e-59
KLLA0E09548g5114634992e-56
CAGL0G04081g5134534941e-55
Kwal_47.165965044684834e-54
Kwal_23.64865474654284e-46
YLL055W5314394002e-42
Scas_630.155505183995e-42
KLLA0C18678g5505253917e-41
KLLA0F00286g5394523758e-39
KLLA0C19019g5115243403e-34
KLLA0A09449g5105113164e-31
Kwal_14.7824913583085e-30
Kwal_27.128325083183086e-30
Kwal_47.165865023133077e-30
ACL203C5374812962e-28
ABR113C4794652891e-27
KLLA0D07370g5995332893e-27
ADR330W4934902873e-27
Scas_645.75464582883e-27
CAGL0F08371g5294682831e-26
YGR260W (TNA1)5344552831e-26
YIL166C5425322778e-26
CAGL0F00209g5403792761e-25
AER444W5474812761e-25
KLLA0F09405g5434872723e-25
AFR229C5354812459e-22
AGL026W5454662422e-21
Kwal_33.132675504862386e-21
Kwal_33.137135004812289e-20
CAGL0L08052g4841892262e-19
AFL158C5643262243e-19
YCR028C (FEN2)5123502191e-18
KLLA0A06193g4382422172e-18
Scas_689.115083492163e-18
Sklu_1875.15724312173e-18
Sklu_2010.55173042145e-18
YAL067C (SEO1)5934612147e-18
Kwal_56.243535825342031e-16
AGR235W5624792013e-16
Scas_630.255824361924e-15
YGR065C (VHT1)5935441826e-14
CAGL0K04609g6094251801e-13
KLLA0D12716g5955811746e-13
KLLA0B07953g5982241711e-12
AEL143W5193031683e-12
Kwal_26.92646144311514e-10
CAGL0K04565g6204221461e-09
AFR578C6252521415e-09
Scas_683.236014241372e-08
Sklu_2043.22421301294e-08
Sklu_2358.2167861001e-04
Sklu_2244.62302311011e-04
YOL162W2152101012e-04
YOL163W169136900.002
KLLA0F06853g528163880.011
CAGL0I07447g570238800.12
Scas_581.6587198740.56
Scas_632.14553185701.7
KLLA0F11077g57984701.8
YOL103W (ITR2)609287692.2
Kwal_23.4803541158682.8
KLLA0B05841g1878195683.2
Scas_637.9607246665.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04081g
         (519 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04081g 366969..368552 similar to ca|CA5240|IPF3032 Candida...  1063   0.0  
Sklu_1720.2 , Contig c1720 2063-3619 reverse complement               822   0.0  
Kwal_23.3366                                                          795   0.0  
Scas_687.5                                                            238   2e-71
KLLA0D11330g 970243..971808 similar to ca|CA2478|CaDAL52 Candida...   230   4e-69
Kwal_47.17169                                                         228   1e-67
Kwal_33.15276                                                         225   8e-67
YJR152W (DAL5) [3043] chr10 (719581..721212) Allantoate and urei...   223   6e-66
YLR004C (YLR004C) [3422] chr12 complement(157933..159504) Member...   221   1e-65
Scas_590.10                                                           217   5e-64
KLLA0D02970g 252052..253704 similar to sp|P15365 Saccharomyces c...   210   4e-61
Kwal_26.6658                                                          204   3e-59
KLLA0E09548g complement(846600..848135) similar to sgd|S0003994 ...   196   2e-56
CAGL0G04081g 388383..389924 highly similar to tr|Q07904 Saccharo...   194   1e-55
Kwal_47.16596                                                         190   4e-54
Kwal_23.6486                                                          169   4e-46
YLL055W (YLL055W) [3368] chr12 (30109..31704) Member of the alla...   158   2e-42
Scas_630.15                                                           158   5e-42
KLLA0C18678g complement(1655735..1657387) similar to sgd|S000397...   155   7e-41
KLLA0F00286g 14519..16138 some similarities with sp|Q9C0U9 Schiz...   149   8e-39
KLLA0C19019g 1689555..1691090 weakly similar to sp|P53322 Saccha...   135   3e-34
KLLA0A09449g 825574..827106 similar to sp|P53322 Saccharomyces c...   126   4e-31
Kwal_14.782                                                           123   5e-30
Kwal_27.12832                                                         123   6e-30
Kwal_47.16586                                                         122   7e-30
ACL203C [846] [Homologous to ScYIL166C - NSH; ScYOL162W - NSH] (...   118   2e-28
ABR113C [705] [Homologous to ScYLL055W - NSH] (601035..602474) [...   115   1e-27
KLLA0D07370g complement(630095..631894) similar to ca|CA4956|IPF...   115   3e-27
ADR330W [2071] [Homologous to ScYGR260W (TNA1) - SH] complement(...   115   3e-27
Scas_645.7                                                            115   3e-27
CAGL0F08371g 835733..837322 highly similar to sp|P53322 Saccharo...   113   1e-26
YGR260W (TNA1) [2206] chr7 (1012490..1014094) Nicotinic acid per...   113   1e-26
YIL166C (YIL166C) [2512] chr9 complement(30938..32566) Member of...   111   8e-26
CAGL0F00209g complement(22109..23731) weakly similar to sp|P5332...   110   1e-25
AER444W [2944] [Homologous to ScYIL166C - NSH] complement(148785...   110   1e-25
KLLA0F09405g 867882..869513 similar to sp|P40445 Saccharomyces c...   109   3e-25
AFR229C [3421] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH] ...    99   9e-22
AGL026W [4285] [Homologous to ScYGR260W - NSH] complement(664335...    98   2e-21
Kwal_33.13267                                                          96   6e-21
Kwal_33.13713                                                          92   9e-20
CAGL0L08052g complement(878996..880450) similar to sp|P25621 Sac...    92   2e-19
AFL158C [3037] [Homologous to ScYAL067C (SEO1) - NSH] (137788..1...    91   3e-19
YCR028C (FEN2) [562] chr3 complement(170881..172419) High affini...    89   1e-18
KLLA0A06193g 566780..568096 similar to sp|P25621 Saccharomyces c...    88   2e-18
Scas_689.11                                                            88   3e-18
Sklu_1875.1 YAL067C, Contig c1875 643-2361 reverse complement          88   3e-18
Sklu_2010.5 YCR028C, Contig c2010 7036-8589                            87   5e-18
YAL067C (SEO1) [2] chr1 complement(7236..9017) Member of the all...    87   7e-18
Kwal_56.24353                                                          83   1e-16
AGR235W [4546] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH] ...    82   3e-16
Scas_630.25                                                            79   4e-15
YGR065C (VHT1) [2027] chr7 complement(618079..619860) H+/biotin ...    75   6e-14
CAGL0K04609g complement(437799..439628) highly similar to sp|P53...    74   1e-13
KLLA0D12716g complement(1084062..1085849) similar to sp|P39709 S...    72   6e-13
KLLA0B07953g 703782..705578 similar to sp|P53241 Saccharomyces c...    70   1e-12
AEL143W [2363] [Homologous to ScYCR028C (FEN2) - SH] complement(...    69   3e-12
Kwal_26.9264                                                           63   4e-10
CAGL0K04565g complement(431909..433771) similar to sp|P53241 Sac...    61   1e-09
AFR578C [3770] [Homologous to ScYGR065C (VHT1) - SH] (1474397..1...    59   5e-09
Scas_683.23                                                            57   2e-08
Sklu_2043.2 , Contig c2043 4428-5156 reverse complement                54   4e-08
Sklu_2358.2 YIL166C, Contig c2358 1699-2198                            43   1e-04
Sklu_2244.6 YOL162W, Contig c2244 14189-14881 reverse complement       44   1e-04
YOL162W (YOL162W) [4663] chr15 (10118..10765) Protein of unknown...    44   2e-04
YOL163W (YOL163W) [4662] chr15 (9596..10105) Protein of unknown ...    39   0.002
KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromy...    39   0.011
CAGL0I07447g 716104..717816 highly similar to sp|P30606 Saccharo...    35   0.12 
Scas_581.6                                                             33   0.56 
Scas_632.14                                                            32   1.7  
KLLA0F11077g 1021058..1022797 some similarities with sp|P53918 S...    32   1.8  
YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permea...    31   2.2  
Kwal_23.4803                                                           31   2.8  
KLLA0B05841g complement(522241..527877) highly similar to sp|P40...    31   3.2  
Scas_637.9                                                             30   5.7  

>KLLA0A04081g 366969..368552 similar to ca|CA5240|IPF3032 Candida
           albicans allantoate permease (by homology), start by
           similarity
          Length = 527

 Score = 1063 bits (2749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/519 (100%), Positives = 519/519 (100%)

Query: 1   MTSEIKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLK 60
           MTSEIKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLK
Sbjct: 1   MTSEIKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLK 60

Query: 61  YDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAI 120
           YDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAI
Sbjct: 61  YDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAI 120

Query: 121 FNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEA 180
           FNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEA
Sbjct: 121 FNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEA 180

Query: 181 SISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFL 240
           SISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFL
Sbjct: 181 SISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFL 240

Query: 241 VFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAM 300
           VFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAM
Sbjct: 241 VFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAM 300

Query: 301 LDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGM 360
           LDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGM
Sbjct: 301 LDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGM 360

Query: 361 VALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLI 420
           VALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLI
Sbjct: 361 VALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLI 420

Query: 421 NVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIV 480
           NVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIV
Sbjct: 421 NVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIV 480

Query: 481 YYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
           YYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ
Sbjct: 481 YYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519

>Sklu_1720.2 , Contig c1720 2063-3619 reverse complement
          Length = 518

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/515 (76%), Positives = 443/515 (86%), Gaps = 5/515 (0%)

Query: 5   IKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYDDK 64
           +  KEQ+E+ V  D E  S+         +        +HAVG++LFQE+LD++L  DDK
Sbjct: 1   MASKEQYEVNV-NDAEQQSVTSGSSSPDQIPIAD----KHAVGVELFQELLDAELDTDDK 55

Query: 65  EYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVG 124
           EY+ IRRKID WLLPVLCITYMLQFLDKLSLNYASAYSMKEDL L GN+YG+IAAI N G
Sbjct: 56  EYAPIRRKIDRWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLKLKGNDYGDIAAICNAG 115

Query: 125 YLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISP 184
           YL+GSIPAN+VIQK PVAKYTG AL  WAILLI HIGATNYSSMMALRFLLG+MEASISP
Sbjct: 116 YLVGSIPANWVIQKFPVAKYTGCALVTWAILLIAHIGATNYSSMMALRFLLGIMEASISP 175

Query: 185 SNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGI 244
           SNMMMC+MFYNK+EQPFRMCTFLSMNGVATMVGALLAYGLGH+T+TSL+PWKLIFLV G+
Sbjct: 176 SNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGALLAYGLGHSTSTSLKPWKLIFLVIGL 235

Query: 245 MNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLN 304
           +N VW+ +FLY+APDSPANA+FLTHEEKLKVID VSKNQMGIKDT++KP Q  EA  DLN
Sbjct: 236 LNFVWAGIFLYMAPDSPANARFLTHEEKLKVIDRVSKNQMGIKDTRLKPKQAWEAAKDLN 295

Query: 305 SWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALF 364
           SWILA IGLGCGV+NG TSNFISSLIKGFGFSGLNATLLQLPTGAIELV VF AGMVALF
Sbjct: 296 SWILALIGLGCGVVNGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFTAGMVALF 355

Query: 365 TNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLINVTV 424
           T KNVR ILLFL CIPTL  LIGI LIPL  KW+LVGCCWLLYIIGGPVIMCW+LINVT+
Sbjct: 356 TKKNVRTILLFLLCIPTLAGLIGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWILINVTI 415

Query: 425 AGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFL 484
           AGSSKIS+VKI+WF+ YTAGNI GSKI YA EAP+Y +GMKGLI  Y+GMMFL IVYY +
Sbjct: 416 AGSSKISSVKIMWFLLYTAGNIIGSKIFYAKEAPKYITGMKGLIASYAGMMFLSIVYYCM 475

Query: 485 MYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
           M+YRN+ RD +YG+LTPE E+EG+INGFKD TDF+
Sbjct: 476 MHYRNRTRDRKYGKLTPESEREGIINGFKDYTDFE 510

>Kwal_23.3366
          Length = 526

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/517 (74%), Positives = 438/517 (84%), Gaps = 6/517 (1%)

Query: 3   SEIKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYD 62
            + KE  Q E G + + +  +   YD      K Q     +H VG +LFQE+L+ + +  
Sbjct: 8   QDTKEPFQVESGEILEIKGSASPSYD------KGQLEVAGKHMVGAELFQELLEGESETS 61

Query: 63  DKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFN 122
           DKEY+ IRRKID WLLPVLC+TYMLQFLDKLSLNYASAYS+ +DL   GN+Y NIAAIFN
Sbjct: 62  DKEYAPIRRKIDRWLLPVLCVTYMLQFLDKLSLNYASAYSLSKDLNFKGNDYSNIAAIFN 121

Query: 123 VGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASI 182
           VGYL+GSIPAN+VIQKLPVAKYTG AL VWA+LL+ HIGA N   MMALRFLLGLMEASI
Sbjct: 122 VGYLVGSIPANWVIQKLPVAKYTGCALIVWAVLLVAHIGAKNTRDMMALRFLLGLMEASI 181

Query: 183 SPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVF 242
           SPSNMMMCAMFYNK+EQPFRMCTFLSMNGVATMVG+LLAYGLGH+T++SL+PWKLIFLV 
Sbjct: 182 SPSNMMMCAMFYNKQEQPFRMCTFLSMNGVATMVGSLLAYGLGHSTSSSLKPWKLIFLVI 241

Query: 243 GIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLD 302
           G++N VW+ VFLY+APDSPANA+FLTHEEKLKV++ VSKNQMGIKDTK+KP Q  EA+ D
Sbjct: 242 GLINFVWAFVFLYMAPDSPANARFLTHEEKLKVVERVSKNQMGIKDTKLKPKQALEALKD 301

Query: 303 LNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVA 362
           LN  ILA IGLGCG+ING TSNFISSLIKGFGFSGLNATLLQLPTGAIELV VFAAG++A
Sbjct: 302 LNVIILALIGLGCGIINGGTSNFISSLIKGFGFSGLNATLLQLPTGAIELVCVFAAGVLA 361

Query: 363 LFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLINV 422
           LFT KN+RVILLF+ CIPTL  L+GI LIPL  KW+LVGCCWLLYIIGGPVIMCWVL+NV
Sbjct: 362 LFTKKNIRVILLFVLCIPTLAGLLGIHLIPLEHKWALVGCCWLLYIIGGPVIMCWVLLNV 421

Query: 423 TVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYY 482
           TVAGSSKIST KI+WF+ YTAGNI GSKI YA EAPRY +GMKGLI+ Y+ MMFLCI+YY
Sbjct: 422 TVAGSSKISTSKIMWFLMYTAGNIIGSKIFYAKEAPRYITGMKGLISSYACMMFLCILYY 481

Query: 483 FLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
            LM+YRNK RD +YG+ TPE+EKEGVINGFKD TDF+
Sbjct: 482 ALMFYRNKTRDRKYGKPTPEEEKEGVINGFKDYTDFE 518

>Scas_687.5
          Length = 560

 Score =  238 bits (606), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/489 (31%), Positives = 270/489 (55%), Gaps = 23/489 (4%)

Query: 46  VGLDLFQEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKE 105
           + + L QE +D  L+   +E +++R KID  + P++C+ Y +QF+DK+S   A+   ++ 
Sbjct: 72  MAMKLAQESMD--LQITKEEDTRLRWKIDFCMFPLMCLLYAVQFMDKISTGSAAVMGLRT 129

Query: 106 DLGLVGNEYGNIAAIFNVGYLIGSI-PANYVIQKL-PVAKYTGVALFVWAILLIGH-IGA 162
           DL + G++Y  + + F  GYL  ++ P  ++ Q+   +AK   + + +W +LL  H + +
Sbjct: 130 DLKMHGDQYSWVGSAFYFGYLFMNMGPVQFIFQRSDKMAKMLALFVIIWGVLLSLHSVPS 189

Query: 163 TNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAY 222
            NY+S +ALR LLG  E+ ++P   ++ A ++   EQ  R+C +  MNG+ +++ + +AY
Sbjct: 190 VNYASFIALRVLLGCAESVVTPCFTIITAQYWKTEEQFTRVCIWFGMNGLRSIILSAIAY 249

Query: 223 GLG-HATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSK 281
           G+  H  + S++ W+L+F++ G++ +    +  +  PD P+ A+FL+  EKL V++ +  
Sbjct: 250 GVYIHEDSYSIKAWRLLFIITGVITIFVGFLIYFWIPDDPSKARFLSKREKLMVVERIRS 309

Query: 282 NQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKG-FGFSGLNA 340
           NQ G  + +IK  Q  EA+ D+ +W+     +   + NG  SNF+S L+   FGFS  + 
Sbjct: 310 NQQGFGNQQIKKYQIIEALKDVRTWLYFLFTVSSNIPNGGISNFLSILLNSDFGFSTKDT 369

Query: 341 TLLQLPTGAIELVVVFAAGMVALF-TNKNVRVILLFLT--CIPTLGALIGIRLIPL---S 394
            LL +PTGA+ELV     G++AL+  NK V +    L+      + ALI   ++     S
Sbjct: 370 FLLSIPTGAVELVGCPLFGILALYAANKKVPIWKYKLSWAIFSAVLALIASCMLGFANGS 429

Query: 395 EKWSLVGCCWLLYIIGGPVIMCWVLINVTV--AGSSKISTVKIVWFIFYTAGNICGSKIM 452
           +K  L G  +L YI   PV    V+ N++   +G +K  TV  +  + Y A N+ G +  
Sbjct: 430 KKARLAG-AYLWYI--SPVSYICVISNISANSSGYTKKWTVSSITLVAYAASNLAGPQTF 486

Query: 453 YANEAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVING- 511
            A +AP+Y      ++ CYS M+ + +V   +    NK+RD    E    + K+G+    
Sbjct: 487 IAKQAPKYHGAKVSMVVCYSCMIVILLVLLLINIRENKRRDKMALE---REGKDGIFENL 543

Query: 512 -FKDLTDFQ 519
            F D+TDF+
Sbjct: 544 EFSDITDFE 552

>KLLA0D11330g 970243..971808 similar to ca|CA2478|CaDAL52 Candida
           albicans allantoate permease (by homology), start by
           similarity
          Length = 521

 Score =  230 bits (587), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 138/462 (29%), Positives = 245/462 (53%), Gaps = 16/462 (3%)

Query: 64  KEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNV 123
           +E  K++RKID  ++P+    YM+QF+DK  +++A+   ++ D  +V   Y    + F +
Sbjct: 62  EEDRKVKRKIDMIVMPLFSFLYMIQFMDKTCISFAAVMGIQTDYKMVDTMYSWTTSCFYL 121

Query: 124 GYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASIS 183
           GYL  S  A   +QKLP  + + + + +W ++   H+ A +Y++   LR LLG++EA +S
Sbjct: 122 GYLFASPFAAVALQKLPSMRTSAICIVIWGVIQCLHVTAKSYATFTLLRTLLGVLEAFVS 181

Query: 184 PSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNT-SLQPWKLIFLVF 242
           P  ++M   +Y K E    +      NG+ T++ A ++YGL H   + +++ +K++F++ 
Sbjct: 182 PIFVIMMNQYYKKSEHFGYIGVLYGCNGLGTVILACISYGLYHNLGSYTMEAYKVLFIIV 241

Query: 243 GIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLD 302
           G + +    + L+I P++PA+A+FL   EKL V++ +  N  G      K  Q KE  +D
Sbjct: 242 GCLTIFNGLLILFIMPNTPADARFLNDREKLAVLERIRGNNQGFGSKTFKWHQMKECFMD 301

Query: 303 LNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVA 362
           + +W+   IG+   + NG  S+F S ++KGFG+S   + L++ P GA ELV +    +++
Sbjct: 302 MRTWLYFLIGISVAIPNGGISSFGSIILKGFGYSTEKSLLMKAPIGACELVGLVILPLIS 361

Query: 363 LFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIG-GPV--IMCWVL 419
            F +K + + + +L     L  ++   L+  S+  ++    +  YI G  PV  I     
Sbjct: 362 YFISKRMIIAVFYL-----LVCVMSTCLLAFSKNKNVALAGY--YITGIAPVGIITITSC 414

Query: 420 INVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCI 479
           +    AG +K  T   +  I Y+AGNI G +   +++AP Y      ++ CY   + L  
Sbjct: 415 VASNTAGHTKKLTANAISLIGYSAGNIVGPQTFRSSDAPNYPKAKAAVVGCYCASIALMG 474

Query: 480 VYYFLMYYRNKKRDAEYGELTPEDEKEGVING--FKDLTDFQ 519
           +  FL    N++RD    EL    +K  V+    F DLTDF+
Sbjct: 475 LMSFLNVRENRRRDKMQEEL---GDKYVVVENQEFADLTDFE 513

>Kwal_47.17169
          Length = 576

 Score =  228 bits (581), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 145/489 (29%), Positives = 243/489 (49%), Gaps = 30/489 (6%)

Query: 49  DLFQEVLDSD-LKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDL 107
           D  +  L+S  LK   +E  K+ RKID ++ P+LC+ Y +QF+DK+S   A+   ++EDL
Sbjct: 88  DAMKLALESQQLKITPEEDRKLVRKIDLYMFPLLCLLYSIQFMDKISNGSAAIMGLREDL 147

Query: 108 GLVGNEYGNIAAIFNVGYLIGSI-PANYVIQKLP-VAKYTGVALFVWAILLIGHIGAT-N 164
            + G++Y  + + F  GYL  ++ P  ++ QK   +AK   V + +W + L  H   + N
Sbjct: 148 KMHGDQYSWVGSAFYFGYLFFNLGPGQFIFQKTRWLAKTLAVFVMIWGMFLALHAAPSVN 207

Query: 165 YSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGL 224
           Y+S + LR LLG  E+ ++P+  ++ + ++ K EQ  R+C +   NG+  +    LAYGL
Sbjct: 208 YASFIFLRVLLGCAESMVTPTFTIITSQYWKKEEQFMRVCMWFGFNGLGGIWANALAYGL 267

Query: 225 -GHATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQ 283
               ++ S++ W+++F++ G++ +   A+  +  PD P+ A FLT  EKL V++ +  NQ
Sbjct: 268 YTRQSSYSIEAWRVLFIITGLITVAVGAMIYFHIPDDPSKAWFLTEREKLMVVERIRSNQ 327

Query: 284 MGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKG-FGFSGLNATL 342
            G  +  IK  Q KEA  D+ +W+     +G  + NG  +NFI+ LIK   G+      L
Sbjct: 328 QGFGNHHIKKYQIKEAFTDVRTWLYFLFSVGNNIPNGGLTNFINILIKNELGYDTKKTLL 387

Query: 343 LQLPTGAIELVVVFAAGMVALFTNKN--------------VRVILLFLTCIPTLGALIGI 388
           + +PTGA+EL+     G +++   +                  + +  TC+   G     
Sbjct: 388 MTMPTGAVELIACPLFGYLSIVCARRQIPFLRHRLAWGIMASTVAVVATCMLAFGG---- 443

Query: 389 RLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICG 448
                  K + +   +LLYI     I    +I+    G +K  TV  +  + Y + N+ G
Sbjct: 444 -----DSKNTKLAGAYLLYIAPLSFICILSIISSNTLGYTKKWTVSSINLVSYASSNLAG 498

Query: 449 SKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGV 508
            +   A +AP Y      +I CY+  + +    Y L Y  N +RD       P DEK   
Sbjct: 499 PQTFIAKQAPGYTGAKIAMIVCYASTVVVLSALYILNYRENIRRDKIAAARGP-DEKVIE 557

Query: 509 INGFKDLTD 517
              F DLTD
Sbjct: 558 NMEFADLTD 566

>Kwal_33.15276
          Length = 552

 Score =  225 bits (574), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 158/526 (30%), Positives = 263/526 (50%), Gaps = 19/526 (3%)

Query: 1   MTSEIKEKEQFEIGVVGDTE-TGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDL 59
           M+    E E+    V  +T  T S E  D  +K +K    E    +      QE +D   
Sbjct: 31  MSVSSTESEKSRKRVSEETAVTDSDEDVDVALKYLKRAHAEKVALSEDSTSAQEAVDKKA 90

Query: 60  K--YDDKEY-SKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGN 116
           +  +   E  SK+ RK+D ++LP LC TY+L FLDK  LNYA++  +K+ L   G+E+ N
Sbjct: 91  QNYFGSHELDSKLLRKVDWYILPFLCCTYLLMFLDKALLNYAASMGIKKHLK--GDEFSN 148

Query: 117 IAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLG 176
           +  IF+  Y+       + IQ+ PV+K  GV + +W  +L  H    +Y+S+M +R LLG
Sbjct: 149 LGTIFSAAYIFAEPFVTFCIQRYPVSKVMGVFIMLWGAVLACHSACKSYASLMIVRTLLG 208

Query: 177 LMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWK 236
           L E+S +   + +  M+Y K EQ  R+  + +  G   +VG L+++G  H   T    W+
Sbjct: 209 LFESSSAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVGGLISFGFLHYHGTEFTSWQ 268

Query: 237 LIFLVFGIMNLVWS-AVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQ 295
           ++FLV G++ +++  A F+Y+ PD+  NA FL  +EK++V+ H+  NQ G+++ K+K  Q
Sbjct: 269 IMFLVVGLVTVLFGIATFVYL-PDNVTNAWFLNEDEKVEVLRHIRANQTGLENKKLKKHQ 327

Query: 296 FKEAM-LDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAI-ELV 353
            KE   LD  ++ +  +     +  GS   F  ++ + FGF    + LLQLP GAI  ++
Sbjct: 328 LKELFCLDKLTYPMLMLTACSQISTGSIGTFSVTITQTFGFDKYESALLQLPIGAITAMI 387

Query: 354 VVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPV 413
           ++    M++ + N  +  + ++   IP +   I +  +PLS K   +   +LLY     +
Sbjct: 388 ILITTQMLSRWGNYTLVTVSMY---IPAIIGCIVMICLPLSHKIGNLFALYLLYSGSCVI 444

Query: 414 IMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSG 473
              ++  +   +G SK      +  I Y    I   ++  A  APRY      L+     
Sbjct: 445 TNIYIWNSCNTSGYSKRVFRNAITMIVYNISCIVAPQMFRAYSAPRYMPAKITLLVTQCV 504

Query: 474 MMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
            + L +   +L    NKKRD E      ++ KE     F DLTD +
Sbjct: 505 CVPLQLYIGYLCREENKKRDRE------QEGKEVPSYQFLDLTDIE 544

>YJR152W (DAL5) [3043] chr10 (719581..721212) Allantoate and
           ureidosuccinate permease, member of the allantoate
           family of the major facilitator superfamily (MFS) [1632
           bp, 543 aa]
          Length = 543

 Score =  223 bits (567), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 145/476 (30%), Positives = 254/476 (53%), Gaps = 20/476 (4%)

Query: 58  DLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNI 117
           +++   +E  K+R KID  + P++CI Y +QF+DK+S + A+   ++ DL + G++Y  +
Sbjct: 66  EIEVTPEEDRKLRWKIDYCMFPLMCILYAVQFMDKISTSSAAVMGLRTDLKMHGDQYSWV 125

Query: 118 AAIFNVGYLIGSI-PANYVIQKLP-VAKYTGVALFVWAILLIGHIGAT-NYSSMMALRFL 174
            + F  GYL  ++ P  ++ Q+   ++K   V + +W +LL  H   T  Y S + LR L
Sbjct: 126 TSAFYFGYLFMNLGPVQFIFQRTSHMSKMLAVFIVIWGMLLALHAAPTVKYPSFIVLRVL 185

Query: 175 LGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLG-HATNTSLQ 233
           LG  E+ ++P   ++ A ++   EQ  R+  +  MNG+ +++   +AYG+  H  + +++
Sbjct: 186 LGCAESVVTPCFTIITAQYWKTEEQFTRVSIWFGMNGLGSILINAIAYGVYIHQDSYAIK 245

Query: 234 PWKLIFLVFGIMNL-VWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIK 292
            W+ +F++ G++ + +   +FL+I PD P+ A+FL+  EKL V+  +  NQ G  + +IK
Sbjct: 246 GWRTLFVITGVITIFIGILIFLWI-PDDPSKARFLSKREKLMVVQRIRSNQQGFGNHEIK 304

Query: 293 PDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKG-FGFSGLNATLLQLPTGAIE 351
             Q  EA+ D+ +W+     +   + NG  S+F+S L+   FG+S     L+ LPTGA+E
Sbjct: 305 KYQIIEALKDVRTWLYFLFTVSSNIPNGGISSFMSILLNSDFGYSSKETLLMGLPTGAVE 364

Query: 352 LVVVFAAGMVALF-TNKNV-----RVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWL 405
           LV     G++A++  NK +     ++       +  L A   +     S+K  L G  +L
Sbjct: 365 LVGCPLFGILAVYAANKKIPFWKYKLSWAIFAAVLALIASCMLGFATNSKKARLAG-AYL 423

Query: 406 LYIIGGPVIMCWVLINVTV--AGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSG 463
            YI   PV    VL N++   +G SK  TV  +  + Y A N+ G +   A +AP+Y   
Sbjct: 424 WYI--SPVSFICVLSNISANSSGYSKKWTVSSINLVAYAAANLAGPQTFIAKQAPKYHGA 481

Query: 464 MKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
              ++ CY+ M+ L  +   +    NK+RD    E    +E E +   F DLTDF+
Sbjct: 482 KVAMVVCYAVMIVLLSILLIVNLRENKRRDKIAAERGFPEETENL--EFSDLTDFE 535

>YLR004C (YLR004C) [3422] chr12 complement(157933..159504) Member of
           the allantoate permease family of the major facilitator
           superfamily (MFS), has similarity to Dal5p [1572 bp, 523
           aa]
          Length = 523

 Score =  221 bits (563), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 144/463 (31%), Positives = 238/463 (51%), Gaps = 16/463 (3%)

Query: 61  YDDKEYS-KIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAA 119
           Y   E S K+ RK+D ++LP LC TY+L FLDK  LNYA++  +K+ L   GNE+ N+  
Sbjct: 65  YGSHELSPKVLRKVDLFILPFLCCTYLLMFLDKALLNYAASMGIKDHLK--GNEFSNLGT 122

Query: 120 IFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLME 179
           IF+  Y+       Y+IQK P++K  G  + VW I+L  H     Y+S+M +R LLGL E
Sbjct: 123 IFSAAYIFMEPVVTYLIQKFPISKILGTFITVWGIVLACHAACKTYASLMVVRTLLGLFE 182

Query: 180 ASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIF 239
           +S +   + +  M+Y K EQ  R+  + +  G   +VG L+++G  H   T+   W+++F
Sbjct: 183 SSSAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVGGLISFGFLHYHGTAFTSWQIMF 242

Query: 240 LVFGIMNLVWSAV-FLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKE 298
           LV G++ + +  + FLY+ PD+  NA FL  EEK++V++H+  NQ G++  K K  Q KE
Sbjct: 243 LVVGLVTVAFGVLTFLYL-PDNVTNAWFLNKEEKIQVVEHIRANQTGLETKKFKKQQVKE 301

Query: 299 AML-DLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIE-LVVVF 356
             L D  +W +  +     +  G+   F  ++   FGF      LLQLP GAI  ++++ 
Sbjct: 302 LFLHDKFTWPMLLLTACSQISTGAIGTFSVTITGTFGFDKYETALLQLPIGAITAMIILI 361

Query: 357 AAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMC 416
              M++ + +  +    +++  I  +G ++ I L PLS K   +   +LLY     +   
Sbjct: 362 TTQMLSRWGHITLITTSMYIPAI--IGCIVLISL-PLSHKIGNLFSLYLLYSGSCVITNI 418

Query: 417 WVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMF 476
           ++  +   +G +K      +  I Y    I   ++  A  APRY      L+      + 
Sbjct: 419 YIWNSCNTSGYTKRVFRNAITMIVYNVSCIIAPQMFRAYSAPRYIPAKIALLVTQCVCVP 478

Query: 477 LCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
           L +   ++    N+KRD E      ++ +E     F DLTD +
Sbjct: 479 LQLYIGYICKKENEKRDKE------QEGQERKKYQFLDLTDIE 515

>Scas_590.10
          Length = 534

 Score =  217 bits (553), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 138/462 (29%), Positives = 230/462 (49%), Gaps = 29/462 (6%)

Query: 68  KIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLI 127
           K+ RK+D ++LP LC  Y+L FLDK  LNYA++  +K+ L   G+E+ N+  IF+  Y+ 
Sbjct: 84  KVLRKVDMFILPFLCCIYLLMFLDKALLNYAASMGIKKHLK--GDEFSNLGTIFSAAYIF 141

Query: 128 GSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNM 187
                 Y+IQK P++K   V +  W I+L  H    +Y+S+M +R LLGL EAS +   +
Sbjct: 142 MEPIVTYLIQKYPISKVLSVFITTWGIVLTCHCACKSYASLMIVRTLLGLFEASSAVGCI 201

Query: 188 MMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNL 247
            +  M+Y K EQ  R+  +    G   +VG L+++G  H   T    W+++FLV G++ +
Sbjct: 202 AISGMYYTKSEQSARIGFWAIQAGTGYIVGGLISFGFLHYHGTEFTSWQIMFLVVGLVTI 261

Query: 248 VWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAML-DLNSW 306
           V+  +  +  PD+  NA FLT EEK++V++H+  NQ G+++ K K +Q KE  L D  ++
Sbjct: 262 VFGIITFFYLPDNVTNAWFLTQEEKIQVVEHIRSNQTGLENKKFKKEQIKELFLKDKLTY 321

Query: 307 ILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIE-LVVVFAAGMVALFT 365
            +  +     +  G+   F +++   FGF      LLQLP GAI  L+++    M++ + 
Sbjct: 322 PMLLLTACSQISTGAIGTFSTTITATFGFDSYQTALLQLPIGAITALIILITTQMISRWG 381

Query: 366 NKNVRVILLFLTCIPTLGALIGIRLIPLSEK--------WSLVGCCWLLYIIGGPVIMCW 417
           N  +    ++   IP +   I +  +PLS K            G C +  I        +
Sbjct: 382 NITLVTTSMY---IPAIIGCIVMLALPLSHKVGNLLSLYLLYSGSCVITNI--------Y 430

Query: 418 VLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFL 477
           +  +   +G SK      +  I Y    I   ++     APRY      L+   +  + L
Sbjct: 431 IWNSCNTSGYSKRVMRNAITMIVYNVSCIVAPQMFRQYSAPRYIPAKIALLVTQAVCIPL 490

Query: 478 CIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
            +   ++    N+KRD E      ++ KE     F D+TD +
Sbjct: 491 QLYIGYICKKENQKRDRE------QEGKEVKKYQFLDMTDIE 526

>KLLA0D02970g 252052..253704 similar to sp|P15365 Saccharomyces
           cerevisiae YJR152w DAL5 allantoate permease, start by
           similarity
          Length = 550

 Score =  210 bits (534), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 138/462 (29%), Positives = 233/462 (50%), Gaps = 11/462 (2%)

Query: 67  SKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYL 126
           +K+ RKID  L P++CI Y +QF+DK++ + A+   ++ DL + G +Y  + + F  GYL
Sbjct: 83  AKLLRKIDLMLFPIMCIIYSVQFMDKITTSNAAIMGLQTDLKMHGEQYSYVGSAFYFGYL 142

Query: 127 IGSIPANYVIQKLP-VAKYTGVALFVWAILLIGHIG-ATNYSSMMALRFLLGLMEASISP 184
            G     +++QK     K     + +W ++L  H   + NY S + LR LLG +E++I+P
Sbjct: 143 GGLFILPFLMQKTKKFMKMLTSIIVIWGMVLALHAAPSVNYPSFIFLRCLLGFLESAITP 202

Query: 185 SNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLG-HATNTSLQPWKLIFLVFG 243
           +  ++ + ++ K EQ  R+  +   NG+ ++ G  +AYGL  H  +  L  WKL+F++ G
Sbjct: 203 AFTIITSQYWKKEEQFSRITCWFGFNGLGSIWGGAIAYGLYIHKDSYPLAAWKLVFIITG 262

Query: 244 IMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDL 303
            + +V   + +   PDSP  A F + EEKL +++ + +NQ G  +  IK  Q  EA  D+
Sbjct: 263 CITIVVGFIMMIHLPDSPDKAWFFSEEEKLLLVERIRENQQGFGNHHIKKYQIVEAFKDV 322

Query: 304 NSWILAFIGLGCGVINGSTSNFISSLIK-GFGFSGLNATLLQLPTGAIELVVVFAAGMVA 362
            +W+     +   + NG  +NF S L+K  F FS   + L+ + +GA+ELV     GM++
Sbjct: 323 RTWLYFLFSVSSNIPNGGITNFSSILLKEDFQFSTDKSLLVNMGSGAVELVGCPLFGMLS 382

Query: 363 LFTNKNVRVIL---LFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVL 419
            +  K    ++   L      T    +G+ ++  ++         L+     PV    VL
Sbjct: 383 FWCLKRKYKVVGSRLAWAFFATAICFMGVCMLAFAKHDKSARLAGLMLFGISPVSFICVL 442

Query: 420 --INVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFL 477
             I+    G +K  TV  +  + Y + NI G     A +AP Y      L+  Y+  M +
Sbjct: 443 SCISSNTLGFTKKWTVSSINLLAYASANIAGPHTFIATQAPSYTGAKISLVVNYAAAMVI 502

Query: 478 CIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
            ++ Y +    NK+RD    E T E   E +   F DLTDF+
Sbjct: 503 IVLIYIVNARENKRRDKIEAERTHEQVVENI--EFADLTDFE 542

>Kwal_26.6658
          Length = 545

 Score =  204 bits (520), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 142/488 (29%), Positives = 240/488 (49%), Gaps = 17/488 (3%)

Query: 42  TEHAVGLDL-FQEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASA 100
           T+    +DL FQ +   D++   +E  K+ RKID  + P++ + Y +QF+DK +L  A+ 
Sbjct: 57  TDFDDAMDLGFQAI---DIELTPEENKKLVRKIDLCMFPLMSLIYAIQFMDKTTLGNAAI 113

Query: 101 YSMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLP-VAKYTGVALFVWAILLIGH 159
             +  DL + G++Y    + F  GYL G      ++QK     K     +  W ++L  H
Sbjct: 114 MGLLPDLKMTGDQYSWAGSAFYFGYLGGLFVLPPLLQKCQYFMKLLCAIIITWGMVLALH 173

Query: 160 IGAT-NYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGA 218
              + NY + + LR LLG  E++I+P+  ++ A ++ K EQ  R+C +   NG+  M G 
Sbjct: 174 SAPSVNYGAFIFLRCLLGFFESTITPAFTIITAQYWKKEEQFLRICIWFGFNGLGAMWGC 233

Query: 219 LLAYGLG-HATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVID 277
            +AYGL   A+  S+  WK++F+  G + + +  + +   PDSP  A FL+  +K+ +  
Sbjct: 234 SMAYGLYIRASEYSIAAWKIVFISTGCITIFFGLLMMLHLPDSPTKAWFLSKHDKVLLTR 293

Query: 278 HVSKNQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKG-FGFS 336
            +  NQ G  +  IK  Q +EA++D  +W+  F  +   + NG+ +NF S L K  FG++
Sbjct: 294 RIRDNQQGFGNHHIKKKQIQEALIDPRTWLYFFYCVSASIPNGALTNFQSILFKSDFGYT 353

Query: 337 GLNATLLQLPTGAIELVVVFAAGMVALFTNK---NVRVILLFLTCIPTLGALIGIRLIPL 393
                L+ +   AI+ + +   G+ + F  K   N     L  + +  L ALIG+ ++  
Sbjct: 354 TEKTLLVSIGIAAIQWIGLPLLGLASFFCAKRKINYLESRLIWSMMALLVALIGVCMLAF 413

Query: 394 SEKWSLVGCCWLLYIIGGPVIMCWVLINVTVA--GSSKISTVKIVWFIFYTAGNICGSKI 451
           +++        +      P+    VL N++    GS+K  TV  +  I Y A NI G   
Sbjct: 414 AKENKNAKLAGIALNYLSPLAFICVLGNISANTLGSTKKWTVSSITLIGYAAANIAGPHT 473

Query: 452 MYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVING 511
             +++AP Y      L+ CY+  + +    Y L    NK+RD    E  P+ E       
Sbjct: 474 FISSQAPHYSGAKITLVVCYASGIAILATLYLLNARENKRRDEIVLEKLPQIENI----E 529

Query: 512 FKDLTDFQ 519
           F DLTDF+
Sbjct: 530 FADLTDFE 537

>KLLA0E09548g complement(846600..848135) similar to sgd|S0003994
           Saccharomyces cerevisiae YLR004c, start by similarity
          Length = 511

 Score =  196 bits (499), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 132/463 (28%), Positives = 229/463 (49%), Gaps = 29/463 (6%)

Query: 68  KIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLI 127
           K+ RK+D ++LP LC TY+L FLDK  LNYA++  +K++L  VG+E+ N+  IF+  Y+ 
Sbjct: 59  KVLRKLDIFVLPFLCCTYLLMFLDKALLNYAASMGIKDNL--VGDEFSNLGTIFSASYIF 116

Query: 128 GSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNM 187
               A Y++Q+ PV++  G  +  W ++++ H     Y+S+M +R LLGL E+  +   +
Sbjct: 117 AEPFAVYLLQRFPVSRVLGSFIICWGVVVVCHCVCKTYASLMIVRVLLGLFESCSAVGCI 176

Query: 188 MMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNL 247
            +  M+Y K EQ  R+  + +  G   ++G L+++G  H   T    W+++FLV G++ +
Sbjct: 177 TVNGMYYTKSEQTQRIGYWAAQAGTGYIIGGLMSFGFLHYHGTEFTSWQIMFLVVGLVTV 236

Query: 248 VWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAML-DLNSW 306
            +  V  +  PD+   A FL  +EK++VI+H+  NQ G++  KIK  Q KE +L D  +W
Sbjct: 237 GFGIVTYFYLPDNVPKAWFLNEKEKVQVIEHIRSNQTGLETKKIKMHQVKELLLKDKLTW 296

Query: 307 ILAFIGLGCGVIN-GSTSNFISSLIKGFGFSGLNATLLQLPTGAIE-LVVVFAAGMVALF 364
            +  +  GC  I+ GS   F  ++   FGF     +LLQLP G +  ++++    ++  F
Sbjct: 297 PMLLLT-GCSQISTGSIGTFSVTITGTFGFDSYQTSLLQLPIGCVTIMIILITTQLIGRF 355

Query: 365 TNKNVRVILLFLTCIPTLGALIGIRLIPLSEK--------WSLVGCCWLLYIIGGPVIMC 416
           +   +    ++   IP +   I +  +PL+ K            G C +  I        
Sbjct: 356 SQFTLITTSMY---IPAIIGCIVMICLPLTNKIGNLLSLYLLYSGSCTITNI-------- 404

Query: 417 WVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMF 476
           ++      +G +K      +  I Y    I   ++  A   PRY      L+      + 
Sbjct: 405 YIWNTCNTSGYTKRLARNGLTMIVYNIACIVAPQMFRAYSYPRYIPAKIALLVTQCVCVP 464

Query: 477 LCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
           L +   +  Y  N++RD E  E   + E+      F D TD +
Sbjct: 465 LQLYIGYTSYTENRRRDKEQAESETKPEQ----YQFLDKTDIE 503

>CAGL0G04081g 388383..389924 highly similar to tr|Q07904
           Saccharomyces cerevisiae YLR004c, hypothetical start
          Length = 513

 Score =  194 bits (494), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 132/453 (29%), Positives = 231/453 (50%), Gaps = 21/453 (4%)

Query: 73  IDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIPA 132
           +D ++L  LC+TY+L FLDK  LNYA+A  +K++L   G+E+ N++ IF+  Y+      
Sbjct: 68  LDKYILSFLCVTYLLMFLDKALLNYAAAMGIKKNLK--GDEFSNLSTIFSAAYIFMEPIV 125

Query: 133 NYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAM 192
             +IQ  P++K  G  +  W  +L  H     Y+S+M +R LLG+ E++ +   + +  M
Sbjct: 126 TLLIQYFPLSKIMGTFICTWGAVLACHSACKTYASLMIVRTLLGMFESASAVGCIAISGM 185

Query: 193 FYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAV 252
           +Y K EQ  R+  + +  G   ++G L+++G  H        W+++FLV G++ +V+  V
Sbjct: 186 YYTKSEQSARIGFWATQAGTGYVIGGLISFGFLHYHGRDFTSWQIMFLVVGLITVVFGIV 245

Query: 253 -FLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAML-DLNSWILAF 310
            FLY+ PD+  NA FL H+EK+ VI+H+  NQ G+++ K K    KE  L D  +W +  
Sbjct: 246 TFLYL-PDNVTNAWFLDHDEKVAVIEHIRDNQTGVENKKFKKSHIKELFLKDKLTWPMLM 304

Query: 311 IGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLP-TGAIELVVVFAAGMVALFTNKNV 369
           I     +  G+  +F +++ K FGF    + LLQLP    + ++++    M++ + +  +
Sbjct: 305 ITACSQISTGAIGSFSTTITKTFGFDSYESALLQLPIGAIVAIIIIVTTQMISRWGHFTL 364

Query: 370 RVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYII-GGPVIMCWVLI--NVTVAG 426
               +++  +  +G+++ I L PL  K   +G  + LY++  G  ++  + I      +G
Sbjct: 365 VTTSMYIPAV--IGSIVLISL-PLEHK---IGNLFSLYLVYSGSCVITNIYIWNTCNTSG 418

Query: 427 SSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLMY 486
             K      +  I Y    I   ++  A  APRY      L+   +  + L +   +L  
Sbjct: 419 YCKRIFRNAITMIVYNISCIVAPQMFRAYSAPRYIPAKIALLVTQAVCIPLQLYVGYLSK 478

Query: 487 YRNKKRDAEYGELTPEDEKEGVINGFKDLTDFQ 519
             N+KRD E     PE         F DLTD +
Sbjct: 479 KENEKRDKEQEGQAPEKYM------FLDLTDIE 505

>Kwal_47.16596
          Length = 504

 Score =  190 bits (483), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 126/468 (26%), Positives = 221/468 (47%), Gaps = 9/468 (1%)

Query: 28  DGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYML 87
           + E+ +  S  +E T  A G D   +     + +  +E   + RKID ++LP++C  +  
Sbjct: 15  EAEVSSRNSSLIEKTNQASGEDALDDAYLETVTFTAEEERALVRKIDLYILPIMCFVFFS 74

Query: 88  QFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGV 147
           Q+LDK SL+YA+ + + +DL +  ++    + IF +G L  +    Y++  +P A  TG 
Sbjct: 75  QYLDKQSLSYATVFGLTKDLKMGAHDISWCSTIFYIGQLGANFVFTYLMTVIPRAPMTGA 134

Query: 148 ALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFL 207
            + +W++  +              R  LG+ EA + P+ +++ + +Y KREQP R   ++
Sbjct: 135 CVVIWSVCCMCLAAPNTKQGFWVGRLFLGIFEAVVQPACVLITSYWYRKREQPMRTACWI 194

Query: 208 SMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFL 267
           SMN +A ++G+ L YG+G    +S   WK++F+  G ++L+   +F    P SP  A+FL
Sbjct: 195 SMNAIAQIIGSYLMYGIGKTNKSSTADWKILFIACGAISLIAGVLFYLWIPISPRTARFL 254

Query: 268 THEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGV-INGSTSNFI 326
           T  EK   +  +            K +Q  E  L  +   L+    G  V +   T  F 
Sbjct: 255 TKREKEIAVKRLFDESDRTATNVFKKEQLFEC-LKFDWLFLSAAAFGFLVTVTSGTIVFQ 313

Query: 327 SSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALI 386
           S +++ FG+   +      P GA++L+ ++ A +          +I L L CIP  G+++
Sbjct: 314 SLMLRSFGYGKFDIMKFGSPAGAVQLLFIWLAVLAVRLIPSERAMITLVLVCIPLAGSIM 373

Query: 387 GIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNI 446
            + L   S  W +VG  WL  +I   + +   L++  V G++K S     +F  Y     
Sbjct: 374 VLCLSKNSGWWMIVG-SWLGSVISCIMSVLLSLMSSNVRGNTKKSVCSNAFFAGY----- 427

Query: 447 CGSKIMYAN-EAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRD 493
           C + I+Y       Y  G+   +  +  +  L I Y F     NKKRD
Sbjct: 428 CLAAIIYPQWWIGTYRGGLIVNVIMWVLLDILLIFYRFKAILENKKRD 475

>Kwal_23.6486
          Length = 547

 Score =  169 bits (428), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 141/465 (30%), Positives = 224/465 (48%), Gaps = 20/465 (4%)

Query: 68  KIRRKIDTWLLPVL-CITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYL 126
           ++ RK+ TW++  L     M+ + DK  +++A+ ++  ED GL  N Y N   +F VG++
Sbjct: 82  RLSRKV-TWIVVSLTAFIDMVLYADKAVMSFAAIFTFFEDTGLTQNRYNNANTLFYVGFI 140

Query: 127 IGSIPAN-YVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPS 185
            G   +N Y +QK PV K   V   +W I++  H  A N+  + ALRF LG +E+   P+
Sbjct: 141 FGQ--SNLYFLQKFPVGKVVAVMTSLWCIIIFLHCTAFNHQGVYALRFFLGFVESIGIPA 198

Query: 186 NMMMCAMFYNKREQPFRMCTFLSMN-GVATMVGALLAYGLGHATNTSLQPWKLIFLVFGI 244
                  F    E+      F S   GV   VG  +AYG+ H T+TS+  WK+  ++ G 
Sbjct: 199 LNTTMGQFLTAEEKAATAPIFYSTCLGVTIPVG-FIAYGVLHITSTSVPTWKIFCIIIGA 257

Query: 245 MNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQ-MGIKDTKIKPDQFKEAMLDL 303
           ++L+ + + + I P++P +AKFLT EEK+ VI  V       I+  + K  Q KEA+LD 
Sbjct: 258 ISLLVTILVVLIYPNNPTDAKFLTKEEKVWVIRRVQHTTGSSIEQKQFKKYQVKEALLDP 317

Query: 304 NSWIL-AFIGLGCGVINGSTSNFISSLIKGF-GFSGLNATLLQLPTGAIELVVVFAAGMV 361
            +W+  AF  L     N +     + L KG  G S L+ATL+ + +GA ++     A   
Sbjct: 318 ITWLFGAFFLLQQLANNLAYQQ--NLLFKGIGGISNLDATLVSVASGAFDVACAILASWF 375

Query: 362 ALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLIN 421
            L   KN+    +    IP+    IG   +P S K  L+    L    G P I+ +   +
Sbjct: 376 -LSYKKNMTAFSVVFWTIPSFVGSIGSIALPWSNKMGLLATMCLATPFGVPWILMFSWNS 434

Query: 422 VTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITC-YSGMMFLCIV 480
            T +G +K  T       +Y   NI   ++   + APRY       I C +     L +V
Sbjct: 435 TTCSGYTKKLTRNAFVMFWYGIANIISPQLWQESSAPRYYPAWIVQIVCSFFTAPALALV 494

Query: 481 YYFLMYYRNKKRDA------EYGELTPEDEKEGVINGFKDLTDFQ 519
            ++++  RNK+R A        G +  + +K  V     DLTD++
Sbjct: 495 IWYILNKRNKERAAALATEDTVGVVEHDGQKVKVNVAMLDLTDYE 539

>YLL055W (YLL055W) [3368] chr12 (30109..31704) Member of the
           allantoate permease family of the major facilitator
           superfamily (MFS) [1596 bp, 531 aa]
          Length = 531

 Score =  158 bits (400), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 117/439 (26%), Positives = 206/439 (46%), Gaps = 6/439 (1%)

Query: 64  KEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNV 123
           ++  K++RK+   +   +    +L ++DK +L+Y S     ED GL  N Y  +  +F V
Sbjct: 46  EQEKKLKRKLFLTIFTFVSAINLLLYMDKATLSYDSILGFFEDTGLTQNTYNTVNTLFYV 105

Query: 124 GYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASIS 183
           G+ IG  P  Y+ QKLP+ K+ G  L  W IL+     A N+S ++ALRF LGL E+ + 
Sbjct: 106 GFAIGQFPGQYLAQKLPLGKFLGGLLATWTILIFLSCTAYNFSGVVALRFFLGLTESVVI 165

Query: 184 PSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFG 243
           P  +    MF++  E+      F +    + +    +AYG+ H TN S+  WK+  ++ G
Sbjct: 166 PILITTMGMFFDASERAAAQPFFFAACMGSPIPTGFIAYGVLHITNPSISLWKIFTIIIG 225

Query: 244 IMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKI-KPDQFKEAMLD 302
            +  + + V +   P++PA+ KF + +E++ +I  V  +     + K+ K  QF+EAM D
Sbjct: 226 GLTFIMTVVVILWFPNNPADVKFFSIQERVWIIRRVQASTGSSIEQKVFKKSQFREAMKD 285

Query: 303 LNSWILAFIGLGCGVINGSTSNFISSLIKGF-GFSGLNATLLQLPTGAIELVVVFAAGMV 361
             +W+     L   + N       + L +G  G   L +TL+ +      +V  F A ++
Sbjct: 286 YITWLFGLFFLLQQLANNLPYQ-QNLLFEGMGGVDALGSTLVSVAGAGFAVVCAFIATLM 344

Query: 362 ALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWS-LVGCCWLLYIIGGPVIMCWVLI 420
            L   KN+  +      +P L   I    +P   K   L   C    I G P I+     
Sbjct: 345 -LAKWKNISALTAIFWTLPALVGSIAAAALPWDNKIGILANICMAGQIFGIPFIIALSWA 403

Query: 421 NVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRY-DSGMKGLITCYSGMMFLCI 479
           + + +G +K  T   V        NI   +I    ++PR+  + +  ++  +S    + +
Sbjct: 404 SSSASGYTKKLTRSSVSLFAMGIANIISPQIWREKDSPRFLPAWIVQIVLSFSLAPAILL 463

Query: 480 VYYFLMYYRNKKRDAEYGE 498
           + +F++  RN +R   Y E
Sbjct: 464 LIHFILKRRNNQRLKNYDE 482

>Scas_630.15
          Length = 550

 Score =  158 bits (399), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 141/518 (27%), Positives = 245/518 (47%), Gaps = 32/518 (6%)

Query: 5   IKEKEQFEIGVVGDTETGSIEV-YDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYDD 63
           +K K+  ++ VV ++   S+E  + GE K + S+  + T         +E   S  +   
Sbjct: 26  LKNKDD-KVKVVNESSQVSVESKHSGEYKIITSKDADAT-----FTFMEENDASVPEITP 79

Query: 64  KEYSKIRRKIDTWLLPVLCITY-MLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFN 122
           ++  ++RRK+  W++  L  T   L + DK +L+YAS + + +D  L  N Y N   +F 
Sbjct: 80  EQEKRLRRKV-AWIIVSLTATIDFLLYSDKATLSYASIFELWDDTHLTQNRYNNANTLFY 138

Query: 123 VGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASI 182
           VGY+IG +   +V QK  + K        W I++  H  A NY  + ALRF LG +EA  
Sbjct: 139 VGYIIGLVNLIWV-QKFSIRKVMAFMCTTWTIIIFLHCVAYNYQGIYALRFFLGFVEAIA 197

Query: 183 SPS-NMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLV 241
            P+ N+ M        +  +    + S  G    V +L+AYG+ HA ++ +  WKL  ++
Sbjct: 198 VPTLNISMNQFLTPDEKNAYAPIFYSSCIGCGVFV-SLIAYGILHA-HSHVHTWKLFMII 255

Query: 242 FGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSK-NQMGIKDTKIKPDQFKEAM 300
            G M  + +AV  YI P +P +AKFL  EEK+ VI  V K +   I+   IK  Q  EA+
Sbjct: 256 IGGMTFLMTAVVYYIYPSNPTDAKFLNKEEKVWVIRRVQKSSNSSIEQKVIKKYQIIEAL 315

Query: 301 LDLNSWILAFIGLGCGVINGSTSNFISSLI-KGFG-FSGLNATLLQLPTGAIELVVVFAA 358
            D  SW+ +   L   + N  T  ++ +L+ +  G  + L+ T++ + +G    V    A
Sbjct: 316 KDPVSWLFSAFFLLQQLANNLT--YMQNLLFENIGHITNLDTTIVSIASGGFASVCAIIA 373

Query: 359 GMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWS-----LVGCCWLLYIIGGPV 413
            +  L+  KN     +    +P+L A I +    +S +W      L   C    + G P 
Sbjct: 374 TIFLLY-KKNFTAFSVVFWTLPSLAACIAM----VSIRWGDNIPLLTMLCLASPLFGIPW 428

Query: 414 IMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRY-DSGMKGLITCYS 472
           ++ +     + +G +K  T   +   +Y   NI   ++   ++APR+  + +  ++  + 
Sbjct: 429 VLMFSWSVTSCSGYTKRVTRNAMVMFWYCIANIISPQLWQEHDAPRFVPAWITQIVLSFF 488

Query: 473 GMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVIN 510
               L +V YF++  RN KR      +    ++EG I+
Sbjct: 489 LAPSLALVIYFILRRRNVKR---LQNIQNSKDEEGFID 523

>KLLA0C18678g complement(1655735..1657387) similar to sgd|S0003978
           Saccharomyces cerevisiae YLL055w, start by similarity
          Length = 550

 Score =  155 bits (391), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 138/525 (26%), Positives = 237/525 (45%), Gaps = 31/525 (5%)

Query: 19  TETGSIEVY-----DGEIKNVKSQQLEGTEHAVGLDL---FQEVLDSDLKYDDKEYSKIR 70
           +E  +IE Y     D E+++ K++       +   D    F E  D  +     E  K  
Sbjct: 25  SEGHAIEHYSEDSDDTELRDDKTKSKYAVVSSRDADATLGFLEEFDPQVPAITAEQEKRL 84

Query: 71  RKIDTWLLPVL-CITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGS 129
            +  TW++  L     ++ + DK + +YAS   + E++G+  N+Y N   +F VG+++G 
Sbjct: 85  SRKVTWIIVSLTAFINLILYSDKATASYASILGLWEEVGITQNQYNNSNTLFYVGFIVGQ 144

Query: 130 IPAN-YVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMM 188
             AN Y +Q  P+     V   +W I++  H   TNY S   LRF LG +E+   P    
Sbjct: 145 --ANLYFVQTYPLKYVVSVMTALWTIVIFLHCACTNYRSFYVLRFFLGFVESVAIPCLNT 202

Query: 189 MCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLV 248
               F    E+      F S     T+    +AYG+ + T+TS+  WK+  ++ G    +
Sbjct: 203 TMGQFLTADEKAASAPMFYSTCVGVTIPVGFIAYGVLNITSTSVSLWKIFMMIIGACTFL 262

Query: 249 WSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQ-MGIKDTKIKPDQFKEAMLDLNSWI 307
            + + L+I P++P +AKFL   EK+ VI  V +     I+   +K  Q KEA+LD  SW+
Sbjct: 263 LTILVLFIYPNNPTDAKFLNTNEKVWVIRRVQQTTGSSIEQKVVKKHQIKEALLDPISWL 322

Query: 308 LAFIGLGCGVINGSTSNFISSLIKGFG-FSGLNATLLQLPTGAIELVVVFAAGMVALFTN 366
            A   L   + N       + L K  G  S L++TL+ + +G   +     A    L+  
Sbjct: 323 FAAFFLLQQLANNLPYQ-QTLLFKSIGNISSLDSTLVSVASGGFAVACCILATTFLLYFK 381

Query: 367 KNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVG-CCWLLYIIGGPVIMCWVLINVTVA 425
                 ++F T IP+    I +  IP  +  +L+   C      G P I+ +   + T +
Sbjct: 382 NYTAFSVVFWT-IPSFVGSIAMVSIPFDKHIALLAMLCMASPAFGVPWILMFSWNSTTCS 440

Query: 426 GSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRY-DSGMKGLITCYSGMMFLCIVYYFL 484
           G +K  T   +   F+   N+   ++    + PRY  + +  ++  +S    + IV +++
Sbjct: 441 GYTKKLTRNAIVMFFFCVANLISPQLWQEKDGPRYIPAWIVQIVLSFSIAPSIAIVIWYI 500

Query: 485 MYYRNKKRDAEYGELTPEDEKEGVI--NG--------FKDLTDFQ 519
           +  RN++R      L  E++K G+I  NG          DLTD +
Sbjct: 501 LRKRNQERAI---NLEAEEKKFGLIEVNGESIKANIAMLDLTDHE 542

>KLLA0F00286g 14519..16138 some similarities with sp|Q9C0U9
           Schizosaccharomyces pombe Putative membrane transporter,
           hypothetical start
          Length = 539

 Score =  149 bits (375), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 126/452 (27%), Positives = 217/452 (48%), Gaps = 33/452 (7%)

Query: 89  FLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVA 148
           F+DK ++ Y +   +  D G+   ++ N+ +IF  GYLI   P + ++QKLP+ KY   +
Sbjct: 92  FMDKSTIGYTTILGIYTDTGISKGDFNNLNSIFYAGYLIAQWPCHILMQKLPLGKYLAGS 151

Query: 149 LFVWAILLIGHIG-ATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFL 207
           +F WAI ++G  G   NY S+MA RF LG  EA + P+  +   MF    ++      F 
Sbjct: 152 IFSWAI-IVGLTGICNNYGSLMACRFFLGATEAVVVPACEITLGMFLTTEQREIVQPVFW 210

Query: 208 SMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFL 267
           +    A ++ + +++GL H TNTS  PW++   +   ++L+ + + L + PD+PANAKFL
Sbjct: 211 AATAAAPLLSSFISFGLMH-TNTSTYPWRIFMAINAGLSLILAIIVLLLYPDNPANAKFL 269

Query: 268 THEEKLKVIDHVSKN-QMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFI 326
           + +EK+ +I  V ++ +  I+   IK  Q  E   D  SW+  F      + N  T    
Sbjct: 270 STKEKVYLIKQVQRSTESSIEQKTIKKYQIYETFKDPVSWLFFFQSFTLMLSNSLTYQ-Q 328

Query: 327 SSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALI 386
           + L    G   L ++L+       ++++      V L        I      +P + + I
Sbjct: 329 NQLYVDIGVDNLGSSLVSAAGSVWDILLYLIFAFVILNYPNQSGYIAAGCLILP-IASSI 387

Query: 387 GIRLIPLSEKWSLVGCCWL-------LYIIGGPVIMCWVLINVTVAGSSKISTVKIVWFI 439
            +  I  S K++L+ C  L        YII     + W     + AG +K     +++ +
Sbjct: 388 AMVTIDWSNKYALLACMILAGSSKGITYIIA----LGWT--TSSAAGYTKKLYRNVMFML 441

Query: 440 FYTAGNICGSKIMYANEAPRYDSG--MKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYG 497
            Y A NI   ++    +APRY     ++ +++ +  ++ L  + Y L   RNK+R  ++ 
Sbjct: 442 AYGAANIISPQLWNPKDAPRYYPSWIIQIVVSFFLNIVILLTIRYILA-KRNKER-YQWV 499

Query: 498 ELTPEDE------KEGV---IN-GFKDLTDFQ 519
           +  PED        EGV   +N    DLTDF+
Sbjct: 500 QEHPEDNFGIVSFTEGVNERVNLAMLDLTDFE 531

>KLLA0C19019g 1689555..1691090 weakly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1}, start by
           similarity
          Length = 511

 Score =  135 bits (340), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 131/524 (25%), Positives = 237/524 (45%), Gaps = 45/524 (8%)

Query: 6   KEKEQFEIGVV-GDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYDDK 64
           K K   E+G   G+ E+GSI  +  E ++++++ LE                     D K
Sbjct: 20  KGKSVIEVGECDGEGESGSIASFSIEQESLENENLE--------------------IDPK 59

Query: 65  EYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVG 124
           E +   RK+DT LLP+L   Y L  LD+ ++  A    M+EDL L   +Y N  ++F   
Sbjct: 60  EEAAFVRKLDTRLLPMLAFMYFLSSLDRSNIGNAYTSGMREDLQLTSKQYSNAVSVFYST 119

Query: 125 YLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISP 184
           YL   +P   +++K     Y    +  W+I+ + +    +Y+S++ALR LLG  E    P
Sbjct: 120 YLAAELPTTLILKKTKPKYYMSFLVLSWSIITLCNAFVQSYASLIALRVLLGAFEGGFFP 179

Query: 185 SNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNT-SLQPWKLIFLVFG 243
           +  ++ ++ Y K+EQ  R+  F   + ++   G L+A GL        L+ W+ ++++ G
Sbjct: 180 AMTLIISILYKKQEQGKRIAFFFGSSALSGAFGGLIATGLASMKPAGGLEGWRWLYIIEG 239

Query: 244 IMNLVWSAVFLYIA-PDSPANAKFLTHEEK--LKVIDHVSKNQMGIKDTKIKPDQFKEAM 300
           +++ V ++V+L++  P    N  +L+  E   LK+        MG  D + +     +A+
Sbjct: 240 LIS-VCASVWLFLELPKDFDNIPYLSARETEILKIRAKQRVAYMG--DGRFEWSYVFDAL 296

Query: 301 LDLNSWILAFIGLGCGVINGSTSNFISSLIK-GFGFSGLNATLLQLPTGAIELVVVFAAG 359
            D  ++I   I     VI    S F+++++K G G++   A  + +P   +  +V     
Sbjct: 297 KDFKTYISFTIQFCQDVILYGFSTFVTAILKLGLGYTSREAQYMSVPVYILAAIVF---- 352

Query: 360 MVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYI---IGGPVIMC 416
           +++ + +  ++V      C   +GA+  I L+ +         C+L+      G  + + 
Sbjct: 353 LISAYISDRLKVRAPIFVCYNVIGAVGYILLLSVHNNSVKYFACYLITFSLYTGTGLNIA 412

Query: 417 WVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMF 476
           W+  N  VA   K +T      +  T GN+ G+          Y  G    + C      
Sbjct: 413 WLTNN--VAPHYKRAT---ALGLNQTLGNVSGAVAGQIYTTAPYTFGHSFSLGCIVLSNL 467

Query: 477 LCIVYYFLMYYRNKKRDA-EYGELTPEDEKEGVINGFKDLTDFQ 519
           L I   F++   N+KR     GE++  D+  GV NG   L DF+
Sbjct: 468 LAITQMFILKRINRKRQRILSGEIS--DDHRGVRNGDNAL-DFK 508

>KLLA0A09449g 825574..827106 similar to sp|P53322 Saccharomyces
           cerevisiae YGR260w TNA1, start by similarity
          Length = 510

 Score =  126 bits (316), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 128/511 (25%), Positives = 214/511 (41%), Gaps = 32/511 (6%)

Query: 14  GVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYDDKEY------S 67
            VV   E+   EV +G I   K + +   EH           D +  YD+         S
Sbjct: 11  AVVSKDESLGEEVVEGNIDACK-ESVRSHEH-----------DDNASYDEPPSLTHPMES 58

Query: 68  KIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYL- 126
           ++ RK+D +L+P++C+ Y L  LDK ++  A    + E L L GN+YGN   +F   Y+ 
Sbjct: 59  RVVRKMDLYLVPLMCMLYFLSNLDKSNIGNAEVAGLSESLNLTGNQYGNCVTVFYATYIF 118

Query: 127 IGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSN 186
              I AN +    P    TG  L  +  + +G     +Y  ++ +R LLG  EA+I PS 
Sbjct: 119 FDPIGANLLKIIGPKYMMTG-CLICFGAISLGTAWVKDYGHLLLVRVLLGAFEATIYPSI 177

Query: 187 MMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMN 246
            M  ++ Y + +   R         +++  G L++YG     N SL  W+ I++V G ++
Sbjct: 178 NMYLSICYRREQYAIRFAWVFFAACISSSFGGLISYGCSK-INGSLNAWQYIYIVEGCIS 236

Query: 247 LVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLNSW 306
           L ++  +     ++   + F T EE+  ++D            K +  Q   A+ DL +W
Sbjct: 237 LGFAPFYALGLANNLEESWFWTAEERQYIVDRYETMSTFNPADKFEWSQVWLAVKDLKTW 296

Query: 307 ILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTN 366
           + A       +     + F+  +I   GFS +NA L+ +P   +  +  FA   V+    
Sbjct: 297 VSAVALFCIDMTAFGLTVFMPIIITSMGFSSVNAQLMTVPVYFLTAITFFACAYVS--DR 354

Query: 367 KNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWL-LYIIGGPVIMCWVLINVTVA 425
             +R   +   CI     L  I L        L G   L L I     + C  L      
Sbjct: 355 IRIRSPFIVGACISCATGL-AIVLGSDVHGVRLFGIFVLALGIYVNASMNCLWLSGNNGN 413

Query: 426 GSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLM 485
              + + + I  F+  ++G + G +I  A + PRY  G+   +        L +V Y++ 
Sbjct: 414 YFKRATALGINLFVGSSSGLVSG-QIFRAEDKPRYALGLAICLGLQVFAAMLTVVQYYMY 472

Query: 486 YYRNKKRDA------EYGELTPEDEKEGVIN 510
              NK++ A      E  E  P DE    +N
Sbjct: 473 RRLNKQKQALIKRCEELDEPIPHDEHLSDMN 503

>Kwal_14.782
          Length = 491

 Score =  123 bits (308), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 88/358 (24%), Positives = 164/358 (45%), Gaps = 9/358 (2%)

Query: 53  EVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGN 112
           +  +++   D +E   +  K+D  LLP+L   Y L  LD+ ++  A    MKEDL L   
Sbjct: 28  DFFEAEYYIDPREERALVSKLDRRLLPMLAFMYFLSSLDRSNIGNAYTSGMKEDLRLTSR 87

Query: 113 EYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALR 172
           +Y N  ++F   YL   +PA ++++      Y    +F W+++ +      +Y S++A R
Sbjct: 88  QYSNAVSVFYSTYLAAELPAVWLLKIAKPRYYMSTLVFCWSVITLSSGFVQSYGSLLATR 147

Query: 173 FLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTS- 231
            LLG  E    P+  ++  M Y  +EQ  R+  F   + ++   G L+A GL    +TS 
Sbjct: 148 ILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAFFFGSSALSGAFGGLIATGLASVKSTSG 207

Query: 232 LQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFLTHEE--KLKVIDHVSKNQMGIKDT 289
           L+ W+ ++++ G++++  +A   +  PD+    KFL   E   +K+ +      MG  + 
Sbjct: 208 LEGWRWLYIIEGLISVCATAWLFFGLPDNLDEMKFLNDRELAVMKIREKQRVQYMG-ANP 266

Query: 290 KIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIK-GFGFSGLNATLLQLPTG 348
                Q   A  D  ++    I     +I    S F+++++K G G++   A  + +P  
Sbjct: 267 AFSWSQVLLAFKDFKTYFAFVIQFCQDIILYGFSTFLTAILKLGLGYTSREAQYMSVPVY 326

Query: 349 AIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLL 406
            +  +V     MV+ + +   +V      C   LGA   I L+ +         C+L+
Sbjct: 327 ILAAIVF----MVSAYVSDRFQVRGPVFFCYNILGATGYIILLAVKNNAVKYFACYLI 380

>Kwal_27.12832
          Length = 508

 Score =  123 bits (308), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 151/318 (47%), Gaps = 11/318 (3%)

Query: 52  QEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVG 111
           ++   SDL  D  E   + RK+D   +PVL   Y LQ LDK ++  A    MKEDL L  
Sbjct: 44  EQTASSDLYIDPDEEKALMRKLDRRFVPVLAFAYFLQSLDKTNIGNAYTSGMKEDLQLTP 103

Query: 112 NEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMAL 171
           ++Y N  ++    +L+  +P    ++ +P   +    +F W+++ +G+    +Y S++AL
Sbjct: 104 HQYSNAVSVLYSTFLVAQVPTVLYLKIIPSRYFLSAMVFCWSVITLGNGFIQSYHSLIAL 163

Query: 172 RFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTS 231
           R LLG  E    P+ +++ +M Y   EQ  R+  F     +A   G L+A GL      S
Sbjct: 164 RVLLGAFEGGYFPAMILLVSMIYKPEEQAKRIALFFGCAALAGAFGGLIATGLATVNGAS 223

Query: 232 -LQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTK 290
            L  W+ ++++ G++++  S    +  P       FL  +E  + I H+   Q  ++   
Sbjct: 224 GLNGWRWLYIIEGLISITASIWIYFGLPTDIEKPAFLNEQE--QAIMHIRAKQR-LQYVG 280

Query: 291 IKPDQFK-----EAMLDLNSWILAFIGLGCGVINGSTSNFISSLIK-GFGFSGLNATLLQ 344
            KPD F      +A+ D   +    I     +I  + + F+ +++K G G++   A  + 
Sbjct: 281 SKPD-FSWTFVWDALKDYKVYTGLVIQFCQNIILYAFTTFLPAILKLGMGYTSREAQYMS 339

Query: 345 LPTGAIELVVVFAAGMVA 362
           +P   +  +V  ++  ++
Sbjct: 340 VPVYILAAIVFLSSAYLS 357

>Kwal_47.16586
          Length = 502

 Score =  122 bits (307), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 153/313 (48%), Gaps = 16/313 (5%)

Query: 32  KNVKSQQLEGTEHAVGLDLFQE----VLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYML 87
           +NV++  LEG   A       +     +D D+ +DD     I  K D  +LP++ + Y+ 
Sbjct: 7   ENVEAIPLEGKGSASLRGSVSDRELVAIDHDVLFDDALERSICWKFDVRILPMIAVMYLF 66

Query: 88  QFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGV 147
             LDK +++ A    + +DLG+ G E+ N+ +IF + +++ + P + VI+K   A     
Sbjct: 67  NALDKGNISNAKTDHIDKDLGIEGQEWNNMLSIFYIPFVLFAFPLSLVIKKYNAANVIPA 126

Query: 148 ALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFL 207
            +F +  + +      NY S+MA R+ LG+ E++  P  +   + FY + E   R+  F 
Sbjct: 127 LMFTFGSISLLSATVFNYGSLMAARWFLGICESAFFPGIIYYLSTFYRRHELARRLSIFY 186

Query: 208 SMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAV-FLYIAPDSPANAKF 266
           +   +A     LL++G+    N+ L+ W+++FLV G + ++++ V FLY+ P SP  + F
Sbjct: 187 AAANIANAFSGLLSFGIFQIKNSKLKGWQILFLVEGSLTVIFAVVAFLYL-PRSPEKSHF 245

Query: 267 LTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLN-----SWILA--FIGLGCGVIN 319
           L+  EK      +  +     D K+    FK+A+         +W+     IG+    IN
Sbjct: 246 LSENEKECARWRIEIDSSAKSDEKV---SFKDAIKVFKHPVAIAWMFQEILIGVPLNSIN 302

Query: 320 GSTSNFISSLIKG 332
                 + SL KG
Sbjct: 303 NWFPQIVQSLGKG 315

>ACL203C [846] [Homologous to ScYIL166C - NSH; ScYOL162W - NSH]
           (4853..6466) [1614 bp, 537 aa]
          Length = 537

 Score =  118 bits (296), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 108/481 (22%), Positives = 205/481 (42%), Gaps = 38/481 (7%)

Query: 55  LDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEY 114
            D +LK+   E  ++ R++D  +  + CI +     D+ +    ++  M E+L +  N+Y
Sbjct: 55  FDPELKWSKDEEKRLVRRLDFKVAFIACILFCAMEADRFNYFQGTSDEMLEELNVTTNDY 114

Query: 115 GNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFL 174
                +FNV +L+G++P   + ++  V +     + +W  + +   G  N   ++ LR  
Sbjct: 115 NLGNQLFNVFHLLGTVPVQLIAKRYGVERVVPCQMIIWGCVAMAQAGMRNKVGLIILRVF 174

Query: 175 LGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN-TSLQ 233
           +GL EA  +   +     FY  +E   R+  F    G+   V  L +YG+        L 
Sbjct: 175 MGLAEAGFAAIMVTWLTSFYTAKELGMRVSYFWVAQGLMNSVLPLASYGIFRMRGICGLS 234

Query: 234 PWKLIFLVFGIMNLVWSAV-FLYIAPDSPANAKFLTHE-----EKLKVI-------DHVS 280
            W+ +FL  G++  V     F Y  P S    K L H      E+ ++I       D  S
Sbjct: 235 GWQWLFLFEGVITCVMGIFGFFYFVP-SIVETKSLLHPKGWFTERQELIAVNRLLRDDPS 293

Query: 281 KNQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNA 340
           K  M  K T +    F EA+LD + W L  + L       +   ++  ++K  GFS    
Sbjct: 294 KGDMNNK-TGVSAKLFIEALLDYDLWPLYLLALVHFFPEAAAGPYMLIILKDVGFSTFTV 352

Query: 341 TLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLI--PLSEKWS 398
            LL +       V +    M+ ++   + R +L  ++C+  L  L  +R        +W 
Sbjct: 353 QLLSISNFFSNTVAILV--MLKIYEVVDERSLLSLVSCVWKLVLLGFLRWWKGAFETRWE 410

Query: 399 -------LVGCCWLLYIIGGPVIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKI 451
                  L+ C ++      P++  W   N     +  +S   +   +F   G +CG++I
Sbjct: 411 TYALMVVLLACPYIF-----PMMFSWASRNSHSIKTRSVSAAVLQ--VFNVIGFVCGNQI 463

Query: 452 MYANEAPRYDSGMKGL--ITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVI 509
              ++AP Y  G   L  +   +  +F+ +  Y++  +RN++R+  +  +T +D +  + 
Sbjct: 464 YRMDDAPLYHRGNTILFFLMLANIPIFIGVKLYYM--WRNRRRELVWNAMTEQDRQSYIE 521

Query: 510 N 510
           N
Sbjct: 522 N 522

>ABR113C [705] [Homologous to ScYLL055W - NSH] (601035..602474)
           [1440 bp, 479 aa]
          Length = 479

 Score =  115 bits (289), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 116/465 (24%), Positives = 209/465 (44%), Gaps = 11/465 (2%)

Query: 63  DKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFN 122
           + E  K+ RK+  +++ +      + ++DK  L+Y++     ED+ +  N Y N+  +F 
Sbjct: 10  EAEEKKLARKVMWYIVGLTASINFITYIDKAQLSYSTLLGFFEDVNMSLNRYNNVNTLFY 69

Query: 123 VGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASI 182
           VGY+ G I   + IQK P+     V L +W I+++     T+Y  +  LR  LG  EA I
Sbjct: 70  VGYITGQINLLF-IQKFPLKNVVIVLLTIWCIIMMVQCAMTDYKGVYVLRLCLGFTEAII 128

Query: 183 SPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVF 242
            P+      MF  + E+      F+      ++   +L+Y +    N ++  WK++ ++ 
Sbjct: 129 IPALNNTMLMFLTENEKAATAPIFVIATVSVSIPMGVLSYLILLIKNPAISHWKILSIII 188

Query: 243 GIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQ-MGIKDTKIKPDQFKEAML 301
           G +  V + V LY+ P++P +AKFL+ +EK+ VI  V       I+  KIK  Q  E + 
Sbjct: 189 GSLTFVVALVALYLYPNNPTDAKFLSLKEKVWVIRRVQDTTGSSIEQKKIKKHQIIEGLR 248

Query: 302 DLNSWILAFIGLGCGVINGSTSNFISSLIKGFG-FSGLNATLLQLPTGAIELVVVFAAGM 360
           D  SW L  +      +  + S   + L+K  G    ++A+L+   +G + ++    A  
Sbjct: 249 DPISW-LFLLFFATQQLANNLSYQRNLLLKSAGHIDDMHASLISSSSGGLAVIGSLVASF 307

Query: 361 VALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSL-VGCCWLLYIIGGPVIMCWVL 419
           + +F  KN     + L  IP+    + +  +P +   ++ V  C      G P IM    
Sbjct: 308 I-MFKKKNFTAYTVVLWSIPSFIGCVAMMALPDNAHIAMVVMICIASSTDGIPWIMMISW 366

Query: 420 INVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPR-YDSGMKGLITCYSGMMFLC 478
              + +G SK  T   +  + Y+  N+   ++      PR Y +    L   +     L 
Sbjct: 367 STTSTSGYSKRLTRIGMVMVGYSISNLISPQLWQEAHGPRYYPAWAVQLSLSFFFAPALA 426

Query: 479 IVYYFLMYYRNKKRDAEYGELTPEDEKEGVIN----GFKDLTDFQ 519
           I+   ++  RNK+R A   +     E +G +        DLTD +
Sbjct: 427 ILIRIILARRNKERLALASDNLGAVEIDGDLVKTNLAMLDLTDLE 471

>KLLA0D07370g complement(630095..631894) similar to
           ca|CA4956|IPF4583 Candida albicans putative allantoate
           permease (by homology), start by similarity
          Length = 599

 Score =  115 bits (289), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 121/533 (22%), Positives = 228/533 (42%), Gaps = 43/533 (8%)

Query: 18  DTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYDDK------------E 65
           D +  SI  +D EI++  S   +       +  +   L  D KY+ +            E
Sbjct: 68  DVKRVSISSFDVEIRSQDSLTSDNPFSDPKIAEYYRALYDDSKYESRSAFDPEFTWTKEE 127

Query: 66  YSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGY 125
             K+ RK++  +  V C  ++   LD+ +L+ A   ++ EDLG+  N+Y     IF + +
Sbjct: 128 EQKVVRKLNIRVALVACYLFVALQLDRGNLSQAVVDNLLEDLGMNRNDYNLGNQIFYISF 187

Query: 126 LIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPS 185
           L+  IP+  + ++L    +  + +  W+++ +      N +     R L+G +E      
Sbjct: 188 LLAEIPSQLISKRLGPDIFIPIQICSWSVVAMAQAAMHNKTGFFICRCLIGALEGGFIAD 247

Query: 186 NMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNT-SLQPWKLIFLVFGI 244
            ++    F+  +E   R+  F +   +  ++ A+LAYG+        L  W+ +FL+ GI
Sbjct: 248 LVLWLTYFFTSKEFSIRLSWFWTSLSLVQILSAILAYGILRMRGIGGLAGWQYLFLLEGI 307

Query: 245 MNLVWSAVFLYIAPDSPANAK--------FLTHEEKLKVIDHVSKNQMGIKDTKIK-PDQ 295
           +         Y+   S    K        F   EEK+ V++ V ++     D   + P  
Sbjct: 308 LTFFIGLTGFYLMVPSAVQTKNWMHPKGWFTEREEKI-VVNRVLRDDPSKGDMHNRQPIS 366

Query: 296 FK---EAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIEL 352
           FK    A+ D + W + FIGL   V     + +++  +K  GFS  N  LL +P   I  
Sbjct: 367 FKLIWSAISDYDLWPIYFIGLIAYVPTNVLTTYLTLTLKSVGFSTFNVQLLSIPYQVIH- 425

Query: 353 VVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLI--PLSEKWSLVGCCWLLYIIG 410
            ++F  G+         R  +  ++ +     L  +R     L E W     C LL  +G
Sbjct: 426 -IIFLLGITWFSERVKQRAYMGIISAVWNAFFLAILRWWKGSLVEAWPTFALCTLL--LG 482

Query: 411 GPVI----MCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKG 466
            P +    + WV  N     +  +S+   ++ +    G I  ++I   N+ P Y +G   
Sbjct: 483 SPYVHAICVSWVSRNSNSIKTRALSSA--LYNMAVQVGAIYSAQIYRENDKPLYHTGNTV 540

Query: 467 L--ITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTD 517
           L  +   +  +FL + +Y+  + RNK ++A + +++ EDE+   I+   D  +
Sbjct: 541 LFSLAVVTTPIFLFVKWYY--HKRNKDKEAIWSKMS-EDERIEYIHNTTDTAN 590

>ADR330W [2071] [Homologous to ScYGR260W (TNA1) - SH]
           complement(1283989..1285470) [1482 bp, 493 aa]
          Length = 493

 Score =  115 bits (287), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 128/490 (26%), Positives = 216/490 (44%), Gaps = 20/490 (4%)

Query: 22  GSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKYDDKEYSKIRRKIDTWLLPVL 81
           G +EV       ++    E  E  +G D  ++V +  L  D     +I RK+D  LLP++
Sbjct: 2   GMMEVDRSNTGPLRKANNEEFEIEIGSD--EDVAEPGL--DHPMERRIVRKMDLCLLPLM 57

Query: 82  CITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYL-IGSIPANYV-IQKL 139
           CI Y L  LDK ++  A+   M EDL LVGN+YGN   +F   Y+    I AN + I   
Sbjct: 58  CILYFLSNLDKSNIGNAAIAGMTEDLKLVGNQYGNCVTVFFATYITFDPIGANLMNIVGA 117

Query: 140 PVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQ 199
           PV   TG  +  + ++ +      NY  ++ +R LLG  E +I P+  M  ++ Y + + 
Sbjct: 118 PVMM-TG-CIIGFGLISLCTAWVKNYWQLLLIRILLGAFEGNIYPAINMYLSVCYRREQY 175

Query: 200 PFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPD 259
             R         V++  G L++YG  H    SL  W+ I++V G + L     + +    
Sbjct: 176 AIRFAWVFFAACVSSSFGGLISYGCAHIKG-SLNAWQYIYIVEGALTLAVVPFYWFGLSK 234

Query: 260 SPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGC-GVI 318
           +  ++ F   EE+  +I           + + +  Q   A+ D+ +WI A I L C  + 
Sbjct: 235 NLQDSWFFNKEEREYIIRRYETMYTYNPNERFEWRQLWLAVRDVKTWISA-ISLFCIDLT 293

Query: 319 NGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNK-NVRVILLFLT 377
               + F+  +I G GF+ + A L+ +P      +  F   + A  ++K  +R   +   
Sbjct: 294 TFGLTIFMPIIISGMGFTHIRAQLMTVPVYFFTAITFF---ICAYLSDKLRLRSPFIVGA 350

Query: 378 CIPTLGALIGIRLIPLSEKWSLVGCCWL-LYIIGGPVIMC-WVLINVTVAGSSKISTVKI 435
           C+ T    + I L   S      G   L L I       C W+  NV+     + + + I
Sbjct: 351 CV-TCAIGLAIVLGSHSNAVKFFGIFVLALGIYVNASTNCLWLSGNVS-NYYKRATALGI 408

Query: 436 VWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAE 495
             F   ++G + G +I    E P Y +G+   ++     +FL ++  F  Y  NKK+ A 
Sbjct: 409 NLFSGSSSGLVAG-QIFTEAEKPGYKTGLTLCMSLQIAAIFLTLLQLFCYYRLNKKKKAM 467

Query: 496 YGELTPEDEK 505
             +   E+ K
Sbjct: 468 LAQSDKEELK 477

>Scas_645.7
          Length = 546

 Score =  115 bits (288), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 107/458 (23%), Positives = 208/458 (45%), Gaps = 28/458 (6%)

Query: 68  KIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLI 127
           +I +K+D +L+P++ I Y L  LDK ++  A    + +D+GLVG +Y     +F   Y++
Sbjct: 95  QILKKMDIFLIPLMGILYFLSNLDKSNIGNAEVAGLSDDIGLVGTQYNTCVTVFFGTYIL 154

Query: 128 GSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNM 187
                + +++ +       + LF + ++ +G     NY+ ++ +R LLG  E  I P+  
Sbjct: 155 FDPIGSNLLKIMGPPTMMSICLFCFGVISLGTAWIKNYAQLIVVRLLLGAFEGMIYPAIN 214

Query: 188 MMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNL 247
           M  ++ Y + +   R     S   +++  G L+AYG     + SL  W+ I++V G +++
Sbjct: 215 MYLSVCYRREQYAMRFAFVFSAAALSSSFGGLIAYGCSQ-IHGSLHSWQYIYIVEGAISI 273

Query: 248 VWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLNSWI 307
            +   + +    +  +  F   EE+  +++          D K +  Q   A+ D+ +W+
Sbjct: 274 GFVPFYYFGLNKNLEDTWFFNKEEREYIVERYKTMNTYNPDEKFEWFQVWLAVKDIKTWV 333

Query: 308 LAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNK 367
            A    G  +     + F+  +I   GF+ + A L+ +P   +   V F     AL+++K
Sbjct: 334 SAVALFGIDLTTFGLTVFLPIIITSLGFTNVRAQLMTVPVYFLTAFVFFGC---ALWSDK 390

Query: 368 -NVRVILLFLTCIPTLGALIGIRLIPLSE-----KWSLVGCCWLLYIIGGPVIMCWVLIN 421
             +R   +   C+ T    +GI ++  S+      + +   C  +Y+       C  L  
Sbjct: 391 LRLRSPFIIGACLTT---AVGISIVLGSKVHGVRYFGVFILCMGIYV--NAACNCLWLSG 445

Query: 422 VTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVY 481
                  + + + I  FI   +G + G +I  A + P Y   +KGL  C +  +   I+ 
Sbjct: 446 NNGNYFKRATALGINLFIGSGSGLVSG-QIFVAADKPGY---VKGLSICLAFQILSIIMT 501

Query: 482 Y--FLMYYR-NKKRDA------EYGELTPEDEKEGVIN 510
           +  F++Y R N K++A      E GE  P DE+   +N
Sbjct: 502 FIQFILYKRANAKKEAIIIHCEEIGEPIPYDERLSDMN 539

>CAGL0F08371g 835733..837322 highly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1, hypothetical
           start
          Length = 529

 Score =  113 bits (283), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 111/468 (23%), Positives = 208/468 (44%), Gaps = 36/468 (7%)

Query: 62  DDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIF 121
           D     KI +K+D +++P+L + Y L  LDK ++  A    + + +GL G EY     +F
Sbjct: 72  DHPMEKKILKKMDLFIIPLLGLMYFLSNLDKSNIGNAEVAGLSKSIGLKGKEYNIAVTVF 131

Query: 122 NVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEAS 181
              Y++       +++ +   +     L  +  + +      NY  ++A+R LLG+ E  
Sbjct: 132 FGTYIVFDPVGANLLKIMGPNRMMSSCLLCFGAISLATAFIKNYGQLLAVRLLLGMFEGM 191

Query: 182 ISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLV 241
           I P+  M  ++ Y + +   R     +   +++  G L+AYG     + SL+ W+ I++V
Sbjct: 192 IYPAINMYLSVCYRREQYAVRFAFVFTAAALSSAFGGLIAYGCSK-IHGSLEAWQYIYIV 250

Query: 242 FGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAML 301
            G +++ +  V+++       ++ F T EE+  VI+  +       D K +  Q   A+ 
Sbjct: 251 EGAISIGFVPVYIWGLGRKLEDSWFFTEEEREYVIERYNTMNTFNPDEKFEWFQVWLAVK 310

Query: 302 DLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMV 361
           D+ +W+ A    G  +     + F+  ++   GFS + A L+ +P   +  VV F   + 
Sbjct: 311 DIKTWVSAIALFGIDLTTFGLTVFLPIIVTSLGFSHVRAQLMTVPVYFLTAVVFF---VC 367

Query: 362 ALFTNK-NVRVILLFLTCIPT-------LGALI-GIRLIPLSEKWSLVGCCWLLYIIGGP 412
           A++++K  +R   +   C+ T       LG+ + G+R       + +   C  +Y+    
Sbjct: 368 AIWSDKLKLRSPFIIGACLTTSIGLAIVLGSTVHGVRY------FGVFILCMGIYV--NA 419

Query: 413 VIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYS 472
              C  L         + + + I  FI   +G + G +I  A + PRY   + GL  C  
Sbjct: 420 ACNCLWLSGNNGNYFKRATALGINLFIGSGSGLVSG-QIFLAKDKPRY---IMGLSLCL- 474

Query: 473 GMMFLCIV---YYFLMYYRNKKRDA-------EYGELTPEDEKEGVIN 510
           G   L IV     F +YYR+ ++         E GE  P DE+   +N
Sbjct: 475 GFQVLSIVMTALQFYLYYRSNQQKQKIIDHCHEIGEPIPYDERLSDLN 522

>YGR260W (TNA1) [2206] chr7 (1012490..1014094) Nicotinic acid
           permease, member of the allantoate permease family of
           the major facilitator superfamily (MFS) [1605 bp, 534
           aa]
          Length = 534

 Score =  113 bits (283), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 102/455 (22%), Positives = 204/455 (44%), Gaps = 32/455 (7%)

Query: 68  KIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLI 127
           ++ RK+D +L+P++ + Y L  LDK ++  A    + +D+ LVG +Y     +F   Y++
Sbjct: 83  RVLRKMDIYLIPLMGMLYFLSNLDKSNIGNAEVAGLSKDIHLVGTQYNTCVTVFFATYVL 142

Query: 128 GSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNM 187
                  +++ +       + L  +  + +G     NY+ ++ +R LLG  E  I P+  
Sbjct: 143 FDPIGTNLLKIMGPPLMMSICLTCFGAISLGTAWVKNYAQLIVVRLLLGAFEGMIYPAIN 202

Query: 188 MMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNL 247
           M  ++ Y + +   R     S   +++  G L+AYG    +  SL+ W+ I++V G ++L
Sbjct: 203 MYLSVCYRREQYALRFAFVFSAACLSSSFGGLIAYGCSKISG-SLKDWQYIYIVEGCISL 261

Query: 248 VWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLNSWI 307
            +   + +    +  ++ F   EEK  + +          D K +  Q  +A+ D+ +W 
Sbjct: 262 GFVPFYAFGLSKNLEDSWFFNKEEKEYISERYKTMNTFDPDEKFEWFQVWQAVKDVKTWA 321

Query: 308 LAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNK 367
            A    G  +     + F+  +I   GF+ + A L+ +P   +  +V F   + A+++++
Sbjct: 322 SAVALFGIDLTTFGLTVFLPIIITSMGFTNVRAQLMTVPIYFLTAIVFF---ICAVWSDR 378

Query: 368 -NVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCW-VLINVT-- 423
             +R   +   C+ T    IGI ++  S+   + G  +      G  I+C  + +N    
Sbjct: 379 IKLRSPFILGACLTT---SIGIAIVLGSQ---VHGVRYF-----GVYILCMGIYVNAACN 427

Query: 424 ---VAGSS----KISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMF 476
              ++G++    K +T   +   F +   +   +I  A + PRY  G+   +      +F
Sbjct: 428 CLWLSGNTGNYFKRATALGINLFFGSGSGLVSGQIFVAKDKPRYIKGLSISLAFQVFSIF 487

Query: 477 LCIVYYFLMYYRNKKRDA------EYGELTPEDEK 505
           + +V  FL    N K+ A      E GE  P DE+
Sbjct: 488 MTVVQIFLYKRENDKKKAIIDRCNELGEPIPYDER 522

>YIL166C (YIL166C) [2512] chr9 complement(30938..32566) Member of
           the allantoate permease family of the major facilitator
           superfamily (MFS) [1629 bp, 542 aa]
          Length = 542

 Score =  111 bits (277), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 124/532 (23%), Positives = 234/532 (43%), Gaps = 50/532 (9%)

Query: 4   EIKEKEQFEIG---VVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLK 60
           +I EK Q  +    +  D+E+ S   +D   K  + +++  +    GL  F    D +  
Sbjct: 9   DIVEKAQLSVSAESLTSDSESISHNPFDDFHKAERWRKVYESSGYEGLSKF----DPEFT 64

Query: 61  YDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMK--EDLGLVGNEYGNIA 118
           +   E  K+ RK+D  L   L +  M  FLD +  N A A S     DL +  N+Y    
Sbjct: 65  WTKDEEKKLVRKMD--LKIFLWVFIMFAFLDLIRKNIARAVSDNFIVDLKMNTNDYNLGQ 122

Query: 119 AIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLM 178
            ++ V +L   +P N + ++    +   V + +W+++ I   G  N    +A R LLG++
Sbjct: 123 TVYLVIFLASELPGNLLSKRFGPERVIPVQIVLWSVICITQAGLKNRGQFIATRCLLGMV 182

Query: 179 EASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNT-SLQPWKL 237
           +    P N++  + +Y   E  FR+  F     +  ++G+LLA G+       +L  W+ 
Sbjct: 183 QGGFIPDNILYLSYYYTGAELTFRLSFFWCAIPLFQILGSLLASGIIEMRGIHNLAGWQY 242

Query: 238 IFLVFGIMNLVWSAVFLYIAPDSPAN----------AKFLTHEEKLKV----IDHVSKNQ 283
           +F++ G ++L       Y+    P            + F  +EEK+ V     D  SK  
Sbjct: 243 LFIIEGFLSLSVGVASFYLMRRGPTQTGESAFHKGKSLFTEYEEKIMVNRILRDDPSKGD 302

Query: 284 MGIKDTKIKPDQFKEAMLDLNS---WILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNA 340
           M  +    +P  FKE +  L     W L   G+   +   +  +++S ++K   +S   +
Sbjct: 303 MSNR----QPVTFKEILYTLTEFDLWPLFIQGITAFISLQTVGSYLSLILKSLNYSTFLS 358

Query: 341 TLLQLPTGAIELV-VVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSL 399
            +L +P  A+ L+ +  AA +      K++ V +  +  +P + +L+   L   +  W  
Sbjct: 359 NILAIPGQALLLINLPLAALLSRKLKEKSLCVGIANVWVLPFIVSLVA--LPTDTNPW-- 414

Query: 400 VGCCWLLYIIGGP----VIMCWVLINVTVAGSSKISTVKIVWF-IFYTAGNICGSKIMYA 454
           +    L  I+G P    ++  WV     ++ S +  TV    + +    G I  S +   
Sbjct: 415 IKYILLTGILGLPYTHSILAGWV---SEISNSVRSRTVGTALYNMSAQVGAIIASNMYRN 471

Query: 455 NEAPRYDSGMKGLI--TCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDE 504
           ++ P Y  G K L+  TC++  M +   +Y++   RNK +D ++  +T E++
Sbjct: 472 DDKPYYTRGNKILLGFTCFNICMAVATKFYYIS--RNKYKDRKWNSMTKEEQ 521

>CAGL0F00209g complement(22109..23731) weakly similar to sp|P53322
           Saccharomyces cerevisiae YGR260w TNA1, hypothetical
           start
          Length = 540

 Score =  110 bits (276), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 93/379 (24%), Positives = 171/379 (45%), Gaps = 36/379 (9%)

Query: 7   EKEQFEIGVVGDTETGSIEVY------DGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLK 60
            K++ EI  V D+    + V+      D  ++NV   + +  E A+ L + ++ +   LK
Sbjct: 10  SKKRNEISHVEDSSKYDLTVHLSSKDEDSSLQNVDDIKGDFEEEAIPLFVSKDEIPESLK 69

Query: 61  -YDDKEYS----KIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYG 115
            Y  +E      K RRK+D  +L +LC  Y+  +LD+ ++  A    ++EDL L   +Y 
Sbjct: 70  DYTTEELEILDKKTRRKMDLRILIMLCWIYICNYLDRSNIASARLGGLEEDLHLSSQQYQ 129

Query: 116 NIAAIFNVGYLIGSIPANYVIQKL-PVAKYTGVALFVWAILLIGHIGATNYSSMMALRFL 174
              +I  VGY+   IP N ++ +L   + +  V +  W I+        +Y  ++A+R +
Sbjct: 130 TAISILFVGYITMQIPCNIILNRLGRPSVFLSVIMTAWGIVSTCTGAVQSYGGLLAIRVI 189

Query: 175 LGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYG-LGHATNTS-L 232
           LG +E+     ++   + +Y K+E   R     S + ++     L++ G + H   T  L
Sbjct: 190 LGFVESGFFGCSLYYLSCWYTKKELGLRNSILYSGSLISGAFSGLISAGIIEHMDGTRGL 249

Query: 233 QPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIK 292
           + W+  F++ G + +    +  +I PD+P N+KFLT  E+  V+    K +M + D+   
Sbjct: 250 RAWRWCFIIEGAITVGTVPLAYFILPDNPDNSKFLTETERDLVM---WKLRMEVGDSDSD 306

Query: 293 PDQFKE------------AMLDLNSWILAFIGLGC---GVINGSTSNFISSLIKGFGFSG 337
            +   E            A+ D   W+L     GC    V     +NF  S++K   +  
Sbjct: 307 KEMLGESGHNSFWYALKLALTDTKVWLLT----GCLTFLVAAAGVTNFFPSVVKTLNYGR 362

Query: 338 LNATLLQLPTGAIELVVVF 356
           +    L  P   I ++  F
Sbjct: 363 IKTLCLTAPPYLIAIITTF 381

>AER444W [2944] [Homologous to ScYIL166C - NSH]
           complement(1487859..1489502) [1644 bp, 547 aa]
          Length = 547

 Score =  110 bits (276), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 111/481 (23%), Positives = 198/481 (41%), Gaps = 23/481 (4%)

Query: 52  QEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVG 111
           +   D  L +  +E  +I RK+D  +  V CI      +D  +L+ A A +M +DL +  
Sbjct: 62  RHAFDPKLTWTKEEERRIVRKLDIHVALVACILLGAFQIDSGNLSQAVADNMLDDLNMDT 121

Query: 112 NEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMAL 171
           N+Y     +F++  L+  IP   + +++ +       +  W+++ +      NY+     
Sbjct: 122 NQYNLGNQLFSIIVLLAEIPVQLLSKRIGLDIVIPSQVVCWSVVAMSQTAMKNYTGFFIT 181

Query: 172 RFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN-T 230
           R  +GL E     +  +  + FY  RE   R+  F +    A M+ +L A+G+       
Sbjct: 182 RMFIGLFEGGFMSNLTLWLSYFYTSRELAVRVSLFFATMSTAHMMTSLGAFGIFRMRGLC 241

Query: 231 SLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAK-------FLTHEEKLKVIDHVSKNQ 283
           +L  W+ +FL+ G++ L    +   +   S    K       + +  E L  ++ V ++ 
Sbjct: 242 NLAGWQWMFLLEGLITLCIGMIGYMLVVPSIVQTKNKLYRKGWFSESEMLIAVNRVLRDD 301

Query: 284 MGIKDTKIKP----DQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLN 339
               D   +       F   + D + W +  IGL   +   + S ++   ++  GFS LN
Sbjct: 302 PSKGDMHNRQGLSLGAFLNTLRDYDLWPVYLIGLIQYITEATVSPYLLLTLRNAGFSRLN 361

Query: 340 ATLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIP--LSEKW 397
             L+ LP  A   + V      A   ++  R ++  + C+     L  +R  P      W
Sbjct: 362 VQLMALPNSASYSIGVLVITKFAQIIDE--RALVGLIPCVWKAVLLGMLRWWPGTFVNAW 419

Query: 398 SLVGCCWLLYI--IGGPVIMCWVLINVTVAGSSKISTVKIVWF-IFYTAGNICGSKIMYA 454
                  +L       P+ + WV  N   A S K  TV    F +FY  G I  ++I  A
Sbjct: 420 GTYAIMIVLLAAPFTNPICVGWVSKN---ANSIKTRTVACATFQMFYRTGIIAATQIYRA 476

Query: 455 NEAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKD 514
           ++AP Y  G   L       + + I       +RNK RD  +  ++ EDE+   I+   D
Sbjct: 477 DDAPLYHRGNSILFWIIIANIPVIISTKLYYIWRNKSRDKIWDAMS-EDERRNYIHTTTD 535

Query: 515 L 515
           L
Sbjct: 536 L 536

>KLLA0F09405g 867882..869513 similar to sp|P40445 Saccharomyces
           cerevisiae YIL166c, start by similarity
          Length = 543

 Score =  109 bits (272), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 108/487 (22%), Positives = 213/487 (43%), Gaps = 37/487 (7%)

Query: 52  QEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVG 111
           +   D    +  +E  K+  K++  +  V C  ++   LD+ +L+ A A ++ EDL +  
Sbjct: 58  RSAFDPAFTWTKEEEKKLLWKLNFRVAFVACFLFIALQLDRGNLSQAVADNLLEDLHMDT 117

Query: 112 NEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMAL 171
           N++     +F + + +  +P+  + ++L    +  + +  W+++ +      N +  +  
Sbjct: 118 NDFNLGNQLFYLSFFLAELPSQLISKRLGPDIFIPIQICAWSVVAMAQAAMHNKAGFLIC 177

Query: 172 RFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNT- 230
           R L+G +E       ++    F+  +E   R+  F +   +  +V ALLAYG+       
Sbjct: 178 RCLIGALEGGFIADLVLWLTYFFTSKELSIRLSWFWTSLSIVQVVSALLAYGILRMRGIG 237

Query: 231 SLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAK--------FLTHEEKLKVIDHVSKN 282
            L  W+ +FL+ GI+  +      Y+        K        F   EEK+ V++ V ++
Sbjct: 238 GLAGWQYLFLLEGILTFLIGLSGFYLMVPGAVQTKNWMHPKGWFTEREEKI-VVNRVLRD 296

Query: 283 QMGIKDTKIK-PDQFK---EAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGL 338
                D   + P  FK    A+ D + W +  IGL   V   + S +++  +K  GFS L
Sbjct: 297 DPSKGDMHNRQPISFKLLWSAISDYDLWPIYLIGLIAYVPMNTVSTYLTLTLKSVGFSTL 356

Query: 339 NATLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLI-----PL 393
           N  LL +P   I + ++      A   ++       ++  I ++   + + ++      L
Sbjct: 357 NVQLLSIPYQVIHITLLIGVTWYAERIDQRA-----YMGVIASIWNALFLGVLRWWKGSL 411

Query: 394 SEKWSLVGCCWLLYIIGGPVI----MCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGS 449
            E W     C LL  +GGP +    + WV  N     +  +S+   ++ +    G I  +
Sbjct: 412 VEAWPTFALCTLL--LGGPYVHAICVSWVSRNSNSIKTRALSSA--LYNMAVQVGAIYST 467

Query: 450 KIMYANEAPRYDSGMKGL--ITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEG 507
           +I   N+AP Y +G   L  I+     +FL   +Y+    RNK+++A + +++ EDE+  
Sbjct: 468 QIYRKNDAPLYHTGNTVLFAISIAGIPVFLFAKWYYRT--RNKRKEAIWSQMS-EDERVE 524

Query: 508 VINGFKD 514
            I    D
Sbjct: 525 YIQTTSD 531

>AFR229C [3421] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH]
           (853001..854608) [1608 bp, 535 aa]
          Length = 535

 Score = 99.0 bits (245), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 109/481 (22%), Positives = 210/481 (43%), Gaps = 32/481 (6%)

Query: 52  QEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVG 111
           ++  D  L +  +E  K+ RK+D  +    C+ +    +D+ +L  A A +M +D+ +  
Sbjct: 50  RKAFDPQLTWTHEEERKLVRKLDLRVALTSCVLFAALQIDRGNLGQAVADNMLDDIKMNT 109

Query: 112 NEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMAL 171
           N+Y     +F V +L+  +P+  + +KL    +  + +  W+++ +     +N +  +  
Sbjct: 110 NDYNLGNQLFYVFFLLAEVPSQLISKKLGPDIFIPIQMVAWSVVAMSQAALSNKTGYLIT 169

Query: 172 RFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTF-LSMNGVATMVGALLAYGLGHATNT 230
           R ++GL+E       ++  + FY   E P R+  F  +M+ V      L           
Sbjct: 170 RSVIGLLEGGFIADLVLWLSYFYTATELPIRLSFFWTTMSLVEVCTSLLAFLLFRLRGIA 229

Query: 231 SLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAK-------FLTHEEKLKVIDHVSKNQ 283
            L  W+ +FL+ G++ L+      Y+   S    K       + T  E+L V++ V ++ 
Sbjct: 230 GLTGWQWLFLLEGLLTLIIGLSGFYLMVPSAVQTKNMLHPQGWFTEREELIVVNRVLRDD 289

Query: 284 MGIKD----TKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLN 339
               D      + P    +A+ D + W +  IGL   + +G+ S +++  +K  GFS   
Sbjct: 290 PSKGDMHNRQALTPKLIWQALTDYDLWPIYVIGLVHYLPDGTVSPYLTLTLKSVGFSKFT 349

Query: 340 ATLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKW-- 397
             LL +P      + +     +  F+ K  +  LL L  IP++       L+ L   W  
Sbjct: 350 VQLLAIPRSI---IFIIFLLGITRFSEKISQRALLGL--IPSVW---NTTLLGLLRWWSG 401

Query: 398 SLVGCCWLLYII-----GGPVIMCWVLINVTVAGSSKISTVKI---VWFIFYTAGNICGS 449
           SLV   W  Y I     G P I   + ++     S+ I T  I   V+ +F   G+I  +
Sbjct: 402 SLVK-AWPTYTILTLLLGAPYIHA-ICVSWASRNSNSIKTRAISAAVYNMFVQMGSIISN 459

Query: 450 KIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVI 509
           ++   ++AP Y  G + L    +  + L I+      +RNK RD ++  +T   ++  ++
Sbjct: 460 QLYREDDAPLYHRGNEILFWIMATNIPLFILVKLYYMHRNKSRDKKWNSMTECQQRAYIV 519

Query: 510 N 510
           N
Sbjct: 520 N 520

>AGL026W [4285] [Homologous to ScYGR260W - NSH]
           complement(664335..665975) [1641 bp, 546 aa]
          Length = 545

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 105/466 (22%), Positives = 197/466 (42%), Gaps = 40/466 (8%)

Query: 6   KEKEQFEIGVVGDTETGSIEVY--------DGEIKNVKSQQLEGTEHAVGLDLFQEVLDS 57
           K  E+     VG+ E   + +         D +    +S+Q    +     +  +++ DS
Sbjct: 15  KLDEKVRAEYVGNIEPQDVSLKYTDPNGFDDSKASESESEQAVPVKPKSIFETREQIPDS 74

Query: 58  DLKYDDKEY----SKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNE 113
                 +E     SK R ++D  +L +LC  Y+   LD+ ++  A    ++EDL L   +
Sbjct: 75  LAHLTTEELEKLASKTRLRMDFRILIMLCWIYICNQLDRTNIASARLGGLEEDLKLTSLQ 134

Query: 114 YGNIAAIFNVGYLIGSIPANYVIQKLPVAK-YTGVALFVWAILLIGHIGATNYSSMMALR 172
           Y    +I  VGY I  +P+N V+ +L   + +  V + +W  +      A +++S+  LR
Sbjct: 135 YQTAVSILFVGYTIFQVPSNIVLNRLGKPRLFISVLMTLWGGISACCAAAHSFASLAVLR 194

Query: 173 FLLGLMEASISPSNMMMCAMFYNKREQPFRMCT-FLSMNGVATMVGALLAYGLGHATNTS 231
            L+G++E+      +   + +Y K+E  FR    F        +     A   G      
Sbjct: 195 VLIGVVESGFFVCCLYYLSCWYTKKELTFRNAILFSGSLLSGALSLLASAIIRGMEGVGG 254

Query: 232 LQPWKLIFLVFGIMNLVWSAVFLYIA-PDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTK 290
           LQPW+  FL+ G++ +V +  F YI  PD+P+N +FL+  EK  VI  +  +     D +
Sbjct: 255 LQPWRWCFLLEGLLTVV-TVPFSYIVLPDNPSNTRFLSQMEKDIVIWKLKMDVGEYDDDE 313

Query: 291 IKPDQ-------FKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLL 343
               +        K A+ D   W++A   + C V +    NF  S+++   +S     LL
Sbjct: 314 AVLHEHNNYRFALKLAVRDPKVWLIAG-TVSCLVASSGVQNFYPSVVETLNYSRTKTLLL 372

Query: 344 QLPTGAIELVVVFAAGMVALFTNKN-----------VRVILLFLTCIPTLGALIGIRLIP 392
             P   I ++  +     +  T +            +   L+ +    T      + L+P
Sbjct: 373 TAPPFFIAMICTWCWARHSDITQERFFHMLIPVPVAIMTYLVAMLSTKTAPRYFAMCLMP 432

Query: 393 LSEKWSLVGC-CWLLYIIGGPVIMCWVLINVTVAGSSKISTVKIVW 437
            S   S + C  W+ +I+  P +       V++A  + ++ V ++W
Sbjct: 433 ASIYSSYIICISWISHIVPRPPLK----RAVSLAMMNTVANVMLIW 474

>Kwal_33.13267
          Length = 550

 Score = 96.3 bits (238), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 113/486 (23%), Positives = 203/486 (41%), Gaps = 35/486 (7%)

Query: 52  QEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVG 111
           +   D   K+ ++E  KI RK+D  +    C  +    +D+ +L  A A +M EDL +  
Sbjct: 65  RNAFDPGFKWTEQEEKKIIRKLDWRVAIPACFMFAALQIDRGNLGQAVADNMLEDLKMTT 124

Query: 112 NEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMAL 171
           N+Y     IF   ++I  +P+  + +K+    +  + +  W+++ +     TN       
Sbjct: 125 NDYNAGMQIFYACFVIAEVPSQLMSKKIGPDLFIPMQMMGWSVVAMAQSAITNKGGYFVT 184

Query: 172 RFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNT- 230
           R LLGL+E       ++  + FY  +E   R+  F +   +  +  ALLA+ +       
Sbjct: 185 RALLGLLEGGFIADLVLWLSYFYTSKELTIRLSWFWTSYSLVQICTALLAFAILRMRGIG 244

Query: 231 SLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAK--------FLTHEEKLKV----IDH 278
            L  W+ + L+ G + L+  A   Y+   S    +        F   EEKL V     D 
Sbjct: 245 GLTGWQWLLLLEGALTLLMGASAFYLMVPSAVQTRNWLHPKGWFTEREEKLVVNRVLRDD 304

Query: 279 VSKNQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGL 338
            SK  M  +   +   +   A+ D + W +  IG+   +   + + +++  +K  GFS  
Sbjct: 305 PSKGDMNNRQA-LSFRKLWAALTDFDLWPIYAIGIIAYIPVNTLTPYLTLNLKHLGFSTF 363

Query: 339 NATLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWS 398
           N  LL +P      + +    +V   T +     L+ L+  P   +      + L   W 
Sbjct: 364 NVQLLTIPYNI---LHIILLLLVTWITERFQERALVCLSA-PVFSSF----FLALIRWWP 415

Query: 399 LVGC-CWLLYII-----GGPVI----MCWVLINVTVAGSSKISTVKIVWFIFYTAGNICG 448
             G   W  Y+I     G P I    + WV  N     S  IS+   ++ +F   G+I  
Sbjct: 416 GSGTKAWPTYVITTLFLGQPYIHAICVSWVSRNSNSIKSRSISSA--LYNMFVQLGSIAA 473

Query: 449 SKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGV 508
           ++I  A++ P Y  G   L      ++ + ++      YRNKK+D  +  ++ EDE+   
Sbjct: 474 NQIYRADDKPLYHRGNMQLFFISVALIPILLLTKLYYVYRNKKKDEIWNTMS-EDERANY 532

Query: 509 INGFKD 514
           I   +D
Sbjct: 533 ILTSRD 538

>Kwal_33.13713
          Length = 500

 Score = 92.4 bits (228), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 115/481 (23%), Positives = 204/481 (42%), Gaps = 57/481 (11%)

Query: 52  QEVLDSDLKYDDK-----EYSKIRR---KIDTWLLPVLCITYMLQFLDKLSLNYASAYSM 103
           Q   DS+ + +D      E    RR   KID ++L  +C+ Y + ++D++  + A    M
Sbjct: 23  QSKEDSNFQEEDAPETLLESINERRLLFKIDLFVLSFVCLQYWINYVDRVGFSNAYVSGM 82

Query: 104 KEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGAT 163
           KEDLGL G+++  I   F VGY++G IP N ++  +    +       W +L       T
Sbjct: 83  KEDLGLKGDQFNLINTCFTVGYVLGMIPNNLILLVVQPRIWLSFCTLAWGLLTFSMYKVT 142

Query: 164 NYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYG 223
           ++    A+RF   + E+       ++   +Y +RE   R   F S   V ++    +   
Sbjct: 143 SFQQCCAIRFFQAVFESCTFSGTHLILGSWYKERELTIRTAIFTSSGLVGSIFSGFMQVA 202

Query: 224 LGHATN--TSLQPWKLIFLVFGIMNL---VWSAVFLYIAPDSPANAKF---LTHEEKLKV 275
           +  + +    L  W+ +F+V  ++ L   V+  +F    PD     +    L  E++L+ 
Sbjct: 203 IHKSLDGHRGLAGWRWLFIVDFLITLPVAVYGFIFFPTTPDHINRKRHGPSLFSEQELQ- 261

Query: 276 IDHVSKNQMGIKDTKIKPDQ--FKEAMLDLNSWILAFIGL--GCGVINGSTSNFISSL-I 330
               +K ++ I++   + D    K  +   + W+ + + +  G  +   S S F   L  
Sbjct: 262 ---FAKRRLPIRNESTRLDWSVIKRVLGRWHWWLFSLVWILGGENISLASNSTFALWLQA 318

Query: 331 KGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNK-------NVRVILLFLTCIPTLG 383
           +G+  S  N      P G I  V + +  + AL+ +K       +V V++  + C+    
Sbjct: 319 QGYSLSQKN----HYPMG-IFGVGIASTCLAALYMDKVRRARHWHVAVVIGIVMCV---- 369

Query: 384 ALIGIRLIP-----LSEKWSLVGCCWLLYIIGGPVIMCWVLINVTVAGSSKISTVKIVWF 438
             I IR+ P     L     + G C+     G  V   W  I V      + + V     
Sbjct: 370 VAIMIRVQPTRPAVLFTAQYIGGICY----AGQTVFFAWANI-VCRDDLQERAVVLASMN 424

Query: 439 IFYTAGNICGSKIMY-ANEAPRYDSGMKGLI--TCYSGMMFLCIVYYFLMYYRNKKRDAE 495
           +F  A N   S + Y A  APRY+ G   LI  +  SG++ + I  + L   R K++  E
Sbjct: 425 MFSGAVNAWWSLLFYSATMAPRYEKGCYALIATSVASGLVSILIRVFQL---REKRQKLE 481

Query: 496 Y 496
           Y
Sbjct: 482 Y 482

>CAGL0L08052g complement(878996..880450) similar to sp|P25621
           Saccharomyces cerevisiae YCR028c FEN2 high affinity
           H+/pantothenate symporter, start by similarity
          Length = 484

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 87/189 (46%), Gaps = 2/189 (1%)

Query: 55  LDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEY 114
            D + K +      +  KID ++L  +C+ Y + ++D++    A    MK DL +VG + 
Sbjct: 14  FDPESKKEPVNKRWVIAKIDLFVLSFVCLQYWINYVDRIGFTNAYVSGMKADLKMVGKDL 73

Query: 115 GNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFL 174
                 F VGY++G IP N ++ K+P   +     F W IL +G    T++  +  LRF 
Sbjct: 74  SIANTCFTVGYVVGMIPHNLILLKVPPRIWLSFCTFAWGILTLGMYHVTHFHQVCVLRFF 133

Query: 175 LGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN--TSL 232
             L E+       ++   +Y ++E P R   F S   V +M    +   + H  N    L
Sbjct: 134 QALFESCTFSGTHLILGSWYLEKELPIRSAIFTSSGLVGSMFSGFMQSSIFHHLNGRNGL 193

Query: 233 QPWKLIFLV 241
             W+ +F++
Sbjct: 194 AGWRWLFII 202

>AFL158C [3037] [Homologous to ScYAL067C (SEO1) - NSH]
           (137788..139482) [1695 bp, 564 aa]
          Length = 564

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 149/326 (45%), Gaps = 22/326 (6%)

Query: 64  KEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNV 123
           K   K+  K+D  L    C+ Y +++LD ++LN A    MKE+LG+ GN+  N  A+F V
Sbjct: 109 KAEKKLLFKLDVLLAFYSCLAYWVKYLDTVNLNNAYVSGMKEELGMSGNDLVNTQAMFTV 168

Query: 124 GYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASIS 183
           G +I  +P  +++ K+P+          W++L +G     N   + A+RFL+G+ EA   
Sbjct: 169 GAVIFQLPFIFILNKVPLNYVLPALDLGWSVLTLGAAHVNNVGQLKAIRFLIGVFEAPAY 228

Query: 184 PSNMMMCAMFYNKREQPFRMCTF---------LSMNGVATMVGALLAYGLGHATNTSLQP 234
            S   +   FY K ++  R   F         LS  G+ + V A L    G      L  
Sbjct: 229 LSYQYLFGCFY-KHDEIVRRSAFYYLGQYAGILSSGGIQSAVSATLDGKNG------LSG 281

Query: 235 WKLIFLVFGIMNLVWSAVFLYIAPDSPAN--AKFLTHEEKLKVIDHVSKNQMGIKD--TK 290
           W+  F++  I++++   +  Y+ P  P N  + FLT +E       + ++ +   D  +K
Sbjct: 282 WRWSFIIDAIISIIVGIIGFYMLPGDPNNCYSIFLTDDEIRLARRRLEESNIDKSDFSSK 341

Query: 291 IKPDQ-FKEAMLDLNSWILAFIGLGC-GVINGSTSNFISSLIKGFGFSGLNATLLQLPTG 348
           I   Q +K  M D   +IL+   + C    NG    ++  +     FS  N   L + T 
Sbjct: 342 IFDKQLWKNIMTDWKIYILSIWNIFCWNNNNGPAGAYLLWMKSLERFSTPNLNRLSMITP 401

Query: 349 AIELVVVFAAGMVALFTNKNVRVILL 374
           A+ +V +    ++A   +  +  ILL
Sbjct: 402 ALGMVYLILTSLIADLGHSRLAAILL 427

>YCR028C (FEN2) [562] chr3 complement(170881..172419) High affinity
           H[+]/pantothenate symporter, member of the allantoate
           permease family of the major facilitator superfamily
           (MFS) [1539 bp, 512 aa]
          Length = 512

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/350 (22%), Positives = 154/350 (44%), Gaps = 40/350 (11%)

Query: 72  KIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIP 131
           KID ++L  +C+ Y + ++D++    A    MKEDL +VGN+      +F +GY++G +P
Sbjct: 32  KIDLFVLSFVCLQYWINYVDRVGFTNAYISGMKEDLKMVGNDLTVSNTVFMIGYIVGMVP 91

Query: 132 ANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCA 191
            N ++  +P   +     F W +L +G    T++  + A+RF   L E+        +  
Sbjct: 92  NNLMLLCVPPRIWLSFCTFAWGLLTLGMYKVTSFKHICAIRFFQALFESCTFSGTHFVLG 151

Query: 192 MFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN--TSLQPWKLIFLVFGIMNL-- 247
            +Y + E P R   F     V +M    +   +    N    L  W+ +F++   + L  
Sbjct: 152 SWYKEDELPIRSAIFTGSGLVGSMFSGFMQTSIFTHLNGRNGLAGWRWLFIIDFCITLPI 211

Query: 248 -VWSAVFLYIAPDSPAN------AKFLTHEEKLKVIDHVSKNQMGIKD--TKIKPDQFKE 298
            ++  +F    PD  +        +++ +E++L    H ++ ++  +D  T++       
Sbjct: 212 AIYGFIFFPGLPDQTSAVSKFSMTRYIFNEQEL----HYARRRLPARDESTRLDWSTIPR 267

Query: 299 AMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQ---LPTGAIELVVV 355
            +   + W+ + +     V+ G    F S+            TL Q    P+G      +
Sbjct: 268 VLKRWHWWMFSLV----WVLGGENLGFASNSTFALWLQNQKYTLAQRNNYPSG------I 317

Query: 356 FAAGMV-----ALFTNKNVRV----ILLFLTCIPTLGALIGIRLIPLSEK 396
           FA G+V     A++ +K  R     + +F++ +  + A++ IR  PL+ K
Sbjct: 318 FAVGIVSTLCSAVYMSKIPRARHWHVSVFISLVMVIVAVL-IRADPLNPK 366

>KLLA0A06193g 566780..568096 similar to sp|P25621 Saccharomyces
           cerevisiae YCR028c FEN2 high affinity H+/pantothenate
           symporter, hypothetical start
          Length = 438

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 102/242 (42%), Gaps = 7/242 (2%)

Query: 72  KIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIP 131
           ++D  +L  +C+ Y + ++D++    A    MKEDLG   N++      F VGYL+G IP
Sbjct: 6   RVDLTVLSFVCLQYWINYVDRIGFTNAYVSGMKEDLGFKSNQFNIANTCFTVGYLLGMIP 65

Query: 132 ANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCA 191
            N ++ ++    +     F W IL +      +      +RF     E+       ++  
Sbjct: 66  HNLILLRIKPRIWLSFCTFAWGILTLSMFSIDSVWQCYVIRFFQAWFESCTFSGTHLILG 125

Query: 192 MFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN--TSLQPWKLIFLVFGIMNLVW 249
            +Y   + P R   F S   +  M    L   +  + N    L  WK +F++ G++ +  
Sbjct: 126 SWYTPSQLPIRTAIFTSSGLLGAMTSGFLQVAIHDSLNGKAGLPGWKWLFIIDGLITIPI 185

Query: 250 SAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLNSWILA 309
           +   L+  P+  A+A+   H+    +     K Q+   D  I    FK      + W+ +
Sbjct: 186 ALYGLFFFPEPDADARESNHKNSW-IFTGKHKQQIDTLDWSI----FKRCGSRWHWWLFS 240

Query: 310 FI 311
           F+
Sbjct: 241 FV 242

>Scas_689.11
          Length = 508

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/349 (21%), Positives = 157/349 (44%), Gaps = 42/349 (12%)

Query: 52  QEVLDSDLKYDDKEYSK--IRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGL 109
           Q+V+ +    + K+ +K  +  KID ++L  +C+ Y + ++D++  N A    MKEDL +
Sbjct: 14  QDVVSTQEPEEKKQINKRFLLFKIDVFVLSFVCLQYWINYVDRVGFNNAYVSGMKEDLNM 73

Query: 110 VGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMM 169
             ++       F VGY++G +P N ++  +P   +     F W +L +G    T++    
Sbjct: 74  KKDDLNVTLTCFTVGYVVGMLPNNLILLVVPPRLWLSFCTFSWGLLTLGMFKITSFEQAC 133

Query: 170 ALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN 229
           A+RF   L E+       ++   +Y + E P R   F S    + ++G++ +  +  A +
Sbjct: 134 AIRFFQALFESCTFSGTHLILGSWYKEDELPLRSAIFTS----SGLIGSIFSGFMQVAIH 189

Query: 230 T------SLQPWKLIFLVFGIMNL---VWSAVFLYIAPDSPANA------KFLTHEEKLK 274
           T      +L+ W+ +F++   + +   ++  +F    PD  +++      +++  E++L+
Sbjct: 190 TRLDGVGNLEGWRWLFIIDFCITIPISIYGLIFFPGVPDHTSSSSKFSMTRYIFTEQELQ 249

Query: 275 VIDHVSKNQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFG 334
                ++ ++  +D   K D +      L  W   F  L   V+ G   +F S+      
Sbjct: 250 ----YARRRLPARDESTKLD-WSVIPRVLKRWHWWFFSL-VWVLGGENLSFASNSTFALW 303

Query: 335 FSGLNATLL---QLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIP 380
               N +L      P+G      ++A G+V+   +        +++CIP
Sbjct: 304 LQNQNYSLSNRNNFPSG------IYAVGIVSTLLSA------FYMSCIP 340

>Sklu_1875.1 YAL067C, Contig c1875 643-2361 reverse complement
          Length = 572

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 103/431 (23%), Positives = 183/431 (42%), Gaps = 31/431 (7%)

Query: 82  CITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPV 141
           C+ Y +++LD ++LN A    MKE+L   GN+      +F VG +I  IP  + + K+P+
Sbjct: 131 CMAYWVKYLDTVNLNNAYVSGMKEELKFKGNDLVQTQVMFTVGNIIFQIPFLFFLNKVPL 190

Query: 142 AKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPF 201
                     W+IL IG     +   + A+RF +G  EA    +   +   FY K ++  
Sbjct: 191 NYLLPALDICWSILTIGASQVDSVPHLKAIRFFIGAFEAPAYLAYQYLFGCFY-KHDEMV 249

Query: 202 RMCTFLSMNGVATMVGALLAYGLGHATNTSLQ------PWKLIFLVFGIMNLVWSAVFLY 255
           R   F  +   A   G L A G+  A   SL        W+  F++  I+++V   +  Y
Sbjct: 250 RRSAFYYLGQYA---GILSAGGIQSAVFASLDGVNGLSGWRWNFIIDAIVSIVIGILGFY 306

Query: 256 IAPDSPAN--AKFLTHEEKLKVIDHVSKNQMGIKDTKIKP---DQFKEAMLDLNSWILAF 310
           + P  P N  + FLT +E       + +N     D   K    + +K  + D   +IL  
Sbjct: 307 MLPGDPYNCYSIFLTDDEIRLARKRLKENNTEKSDFASKVFDLEVWKRIVFDWKVYILTL 366

Query: 311 IGLGC-GVINGSTSNFISSL--IKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNK 367
             + C    NGS+  ++  L  +K +    LN   L + T  + +V +F  G+ A  ++ 
Sbjct: 367 WNIFCWNNNNGSSGAYLLWLKSLKKYSIPKLNK--LSMITPGLGMVYLFVTGVFADKSHS 424

Query: 368 NVRVILLFLTCIPTLGALI-GIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLINVTVAG 426
               I +F      +G +I  +  +P   KW      +  + +  PV+  W         
Sbjct: 425 RWGAI-IFTQVFNFMGNVILAVWDVPEGAKWYAFMLQYFGWAM-APVLYSWQNDICRKDA 482

Query: 427 SSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLM- 485
            ++  T+ I+  +  T+       +    EAPRY   +KG    ++ +   C+  + L+ 
Sbjct: 483 QARAVTLVIMNMLAQTSTAWISVLVWKTPEAPRY---LKGF--TWTAVASFCLSVWTLVV 537

Query: 486 --YYRNKKRDA 494
             +Y+  +R A
Sbjct: 538 LWFYKRDERKA 548

>Sklu_2010.5 YCR028C, Contig c2010 7036-8589
          Length = 517

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 132/304 (43%), Gaps = 28/304 (9%)

Query: 72  KIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIP 131
           K+D ++L  +C+ Y + ++D+++   A    MK+DLGL GN++  I   F VGY+IG +P
Sbjct: 46  KVDLFVLSFVCLQYWINYVDRVAFANAYVSGMKQDLGLHGNDFNLINTCFTVGYVIGMVP 105

Query: 132 ANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCA 191
            N ++  +P   +       W +L +     ++++   A+RF   L E+       ++  
Sbjct: 106 NNLMLLVVPPRIWLSFCTLAWGVLTLSMYRVSSFNQCCAIRFFQALFESCTFSGTHLILG 165

Query: 192 MFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN--TSLQPWKLIFLVFGIMNLVW 249
            +Y + E   R   F S   V ++    +   +  + +    L  W+ +F++  ++ L  
Sbjct: 166 SWYREDELSVRSAIFTSSGLVGSLFSGFMQVSIHSSLDGRRGLAGWRWLFIIDFLITLPI 225

Query: 250 SAVFLYIAPDSP------ANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQ--FKEAML 301
           +       PD+P      A+    T  E    + H ++ ++  +D     D    +  + 
Sbjct: 226 AVYGFVCFPDTPDHINKGASGLIFTEAE----LRH-ARRRLPARDESTALDWSVVRRVLC 280

Query: 302 DLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQ---LPTGAIELVVVFAA 358
             + W+ +F+     V+ G   +F S+       S    TL Q    P G      +FA 
Sbjct: 281 RWHWWLFSFV----WVLGGENISFASNSTFALWLSDQGYTLAQRNHYPMG------IFAV 330

Query: 359 GMVA 362
           G+VA
Sbjct: 331 GVVA 334

>YAL067C (SEO1) [2] chr1 complement(7236..9017) Member of the
           allantoate permease family of the major facilitator
           superfamily (MFS) [1782 bp, 593 aa]
          Length = 593

 Score = 87.0 bits (214), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 106/461 (22%), Positives = 194/461 (42%), Gaps = 42/461 (9%)

Query: 72  KIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIP 131
           K+D  L    CI Y +++LD +++N A    MKEDLG  GN+  +   ++ VG +I  +P
Sbjct: 134 KLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQVMYTVGNIIFQLP 193

Query: 132 ANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCA 191
               + KLP+          W++L +G     +   + A+RF +G  EA    +   +  
Sbjct: 194 FLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAFEAPSYLAYQYLFG 253

Query: 192 MFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTS------LQPWKLIFLVFGIM 245
            FY K ++  R   F  +      +G L A G+  A  +S      L+ W+  F++  I+
Sbjct: 254 SFY-KHDEMVRRSAFYYL---GQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIV 309

Query: 246 NLVWSAVFLYIAPDSPAN--AKFLTHEEKLKVIDHVSKNQMGIKDTKIKP---DQFKEAM 300
           ++V   +  Y  P  P N  + FLT +E       + +NQ G  D + K      +K   
Sbjct: 310 SVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVFDIKLWKTIF 369

Query: 301 LDLNSWILAFIGLGC----GVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVF 356
            D   +IL    + C     V +G+   ++ SL K +    LN   L + T  + +V + 
Sbjct: 370 SDWKIYILTLWNIFCWNDSNVSSGAYLLWLKSL-KRYSIPKLNQ--LSMITPGLGMVYLM 426

Query: 357 AAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLV-GCCWLLYIIG----- 410
             G++A     + R   +  T +     +IG  ++     W +  G  W  +++      
Sbjct: 427 LTGIIA--DKLHSRWFAIIFTQVFN---IIGNSILA---AWDVAEGAKWFAFMLQCFGWA 478

Query: 411 -GPVIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLIT 469
             PV+  W          ++  T+  +  +  ++       +    EAPRY   +KG   
Sbjct: 479 MAPVLYSWQNDICRRDAQTRAITLVTMNIMAQSSTAWISVLVWKTEEAPRY---LKGFTF 535

Query: 470 CYSGMMFLCIVYYFLMYY--RNKKRDAEYGELTPEDEKEGV 508
                  L I  + ++Y+  R+++ +A+   +   + K GV
Sbjct: 536 TACSAFCLSIWTFVVLYFYKRDERNNAKKNGIVLYNSKHGV 576

>Kwal_56.24353
          Length = 582

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 117/534 (21%), Positives = 218/534 (40%), Gaps = 64/534 (11%)

Query: 14  GVVGDTETGSIEVYDGEIKNVKS----QQLEGTEHAVGLDLFQEVLDSDLKYDDKEYSKI 69
           GVVG+   G +E  D   +   S    Q+    E       + +   SD+   +K   K+
Sbjct: 73  GVVGEI-AGEVEYRDEAGRKWWSFFNEQEYRMNEKQASDRKWYQWFGSDVSPQEK---KL 128

Query: 70  RRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGS 129
             K+D  L    C+ Y +++LD  +LN A    +KE+L   GN+      ++ +G ++  
Sbjct: 129 LVKLDILLAFYSCLAYWVKYLDTANLNNAYVSGLKEELNFKGNQLVETQVMYTIGNIVFQ 188

Query: 130 IPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMM 189
           +P  + + K+P+          W+IL IG         +  +RF +G+ EA    +   +
Sbjct: 189 LPFIFFLDKVPLNFVLPALDICWSILTIGAAKVDTVPHLKVIRFFIGVFEAPAYLAYQYL 248

Query: 190 CAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHAT------NTSLQPWKLIFLVFG 243
              FY K ++  R   F  +   A   G L A GL  A          L  W+  F++ G
Sbjct: 249 FGSFY-KHDEMVRRSAFYYLGQYA---GILSASGLQSAIYAVLDGKRGLSGWRWNFIIDG 304

Query: 244 IMNLVWSAVFLYIAPDSPAN--AKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAML 301
           ++++V   +  Y+ P  P N  + FLT +E       +++ ++   +T+ KPD F   + 
Sbjct: 305 VISVVVGIIGFYVLPGDPYNCYSIFLTDDEI-----RLARKRLRENNTE-KPD-FASKVF 357

Query: 302 DLNSWILAFIGLGCGVI-----------NGSTSNFISSLIKGFGFSGLNATLLQLPTGAI 350
           D   WI         V+           NG++  ++  L     +S  +   L + T A+
Sbjct: 358 DKKVWIRILTNWKIYVLTLWNIFCWNNNNGTSGAYLLWLKSLKRYSIPHVNRLGMVTPAL 417

Query: 351 ELVVVFAAGMVALFTNK-NVRVILLFLTCIPTL--GALIGIRLIPLSEKWSLVGCCWLLY 407
            +V +F   + +LF +K + R   + +T +       ++    +P   KW      ++L 
Sbjct: 418 GMVYLF---LTSLFADKLHSRWGAIIVTQVFNFIGNVILAAWNVPEGAKW----FAFMLQ 470

Query: 408 IIG---GPVIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGM 464
             G    PV+  W         S++  T+ I+  +  T        +    EAPR+  G 
Sbjct: 471 YFGWAMAPVLYSWQNDICRRDASARAITLVIMNMLAQTTTAFMSVLVWKTTEAPRFLKGY 530

Query: 465 KGL-ITCYSGMMFLCIVYYFLMYYRNKKRDA----------EYGELTPEDEKEG 507
               +  +S   +  +V +  +Y R +++ A          + GE  P +E++ 
Sbjct: 531 TWTAVAAFSLSAWTMLVLW--LYKREERQHAKENGIILYNSKTGENYPPEEQKA 582

>AGR235W [4546] [Homologous to ScYIL166C - NSH; ScYOL163W - NSH]
           complement(1187805..1189493) [1689 bp, 562 aa]
          Length = 562

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 107/479 (22%), Positives = 198/479 (41%), Gaps = 36/479 (7%)

Query: 52  QEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVG 111
           ++  D  L +  +E  ++ RK+D  ++ ++ I Y    LD  SL  A+A +M  +L +  
Sbjct: 77  RQFFDPTLTWTKEEERQVLRKLDIHIVGLIVIVYFACQLDYGSLGQATADNMLNELHMDA 136

Query: 112 NEY--GNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMM 169
           N+Y  GN  +IF    L   +P   VI++    K     + +W  +++   G  N     
Sbjct: 137 NQYNLGNQLSIFVA--LAFELPMQLVIRRYGADKAIPYQMLIWGAIVLCQAGMKNCYGFY 194

Query: 170 ALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN 229
           A R L G+  A +  +  +    FY   E  FR     + + +  +  AL+AYG+     
Sbjct: 195 ATRVLSGIAAAGLLTTVTVWLTYFYTSGELAFRTAFLFATSTMDQVFSALIAYGVLRLRG 254

Query: 230 T-SLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAK-------FLTHEEKLKVI----- 276
             +L  W+ +F+V GI+         +    S A  K       +L+  ++L  +     
Sbjct: 255 VCNLSGWQWLFIVEGIITFSAGLYVCFTMVPSIAQTKGVMYPKGWLSERQQLIAVNRLLR 314

Query: 277 DHVSKNQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFS 336
           D  SK  M  +   I   +F  ++ D + W L  I L   +   +   ++   ++  GFS
Sbjct: 315 DDPSKGTMNNRQ-GITIREFLRSLSDYDFWPLYAISLIVSIPEAAVVPYLPLNLRSLGFS 373

Query: 337 GLNATLLQLPTGAIELV-VVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLS- 394
            L   +L +P   I  + ++    +  ++  + +  I   +    TLG L   R    S 
Sbjct: 374 SLKVQILIIPAFFIHAISMLIFTKLSDVWDERALMEIFPLIWKGITLGCL---RWWSGSF 430

Query: 395 -EKWSLVGCCWLLYIIG--GPVIMCWVLINVTVAGSSKISTVKIVWFIFYTA-GNICGSK 450
            +KW        L  +    P+   W   N   A S +   V      F+   G I  ++
Sbjct: 431 VDKWGTYALLITLRAVPSYSPIYTGWSSKN---ANSVRTRAVAAAAGQFFNKIGYILANQ 487

Query: 451 IMYANEAPRYDSGMKGLITCYSGMMFLCIV---YYFLMYYRNKKRDAEYGELTPEDEKE 506
               ++AP Y  G   L+ C + +    ++    YF+  +RNK+RD  + ++T ++ + 
Sbjct: 488 TYRKDDAPAYHRG-NLLLFCINLITIPLMIGSKLYFV--WRNKRRDELWNKMTEKERQH 543

>Scas_630.25
          Length = 582

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 100/436 (22%), Positives = 185/436 (42%), Gaps = 38/436 (8%)

Query: 82  CITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPV 141
           CI Y +++LD ++LN A    MKE+L   GN+  +   ++ VG +I  +P  + + K+P+
Sbjct: 140 CIAYWVKYLDTVNLNNAYVSGMKEELNFKGNDLVHTQVMYTVGNIIFQLPFLFYLNKIPL 199

Query: 142 AKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPF 201
                     W++L IG     +   + A+RF +G  EA    +   +   FY K ++  
Sbjct: 200 NYLLPGLDMAWSLLTIGAAYVNSVPHLKAIRFFIGGFEAPSYLAYQYLFGCFY-KHDEMV 258

Query: 202 RMCTFLSMNGVATMVGALLAYGLGHATNTSLQ------PWKLIFLVFGIMNLVWSAVFLY 255
           R   F  +      VG L + G+  A  ++L        W+  F++  I+++    +  Y
Sbjct: 259 RRSAFYYL---GQYVGILSSGGIQSAVYSNLDGRNGLSGWRWSFIIDAIISVFVGILGFY 315

Query: 256 IAPDSPAN--AKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQF---KEAMLDLNSWILAF 310
           + P  P N  + FLT +E       +SKNQ    +   K   F   K  + D   ++L+ 
Sbjct: 316 VLPGDPDNCYSIFLTDDEIRLARKRISKNQTAGANFSSKVFDFKTWKNILCDWKIYVLSL 375

Query: 311 IGLGCGVINGSTSN----FISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTN 366
             + C   N  +S     ++ SL K +    +N   L + T  + ++ +   G++A    
Sbjct: 376 WNIFCWNNNNVSSGAYLLWLKSL-KRYSIPRVND--LSMITPGLGMIYLAVTGVIA--DK 430

Query: 367 KNVRVILLFLTCIPTL--GALIGIRLIPLSEKWSLVGCCWLLYIIG---GPVIMCWVLIN 421
            + R   +  T +       ++    +  S KW      ++L  +G    PV+  W   +
Sbjct: 431 SHCRWFAIVGTQVFNFIGNVILAAWNVTESAKW----FAFMLQCMGWAMAPVLYSW-QND 485

Query: 422 VTVAGSSKISTVKIVWFIFYTAGNICGSKIMY-ANEAPRYDSGMKGLITC-YSGMMFLCI 479
           +    S + S + +   I         S +++   EAPRY  G      C +    +  +
Sbjct: 486 ICRRNSEERSIILVTMNIMAQTSTAWLSVLVWKTEEAPRYLKGFTFTACCAFCLSAWTFV 545

Query: 480 VYYFLMYYRNKKRDAE 495
           V YF  Y R+++R A+
Sbjct: 546 VLYF--YKRDERRHAK 559

>YGR065C (VHT1) [2027] chr7 complement(618079..619860) H+/biotin
           symporter, member of the allantoate permease family of
           the major facilitator superfamily (MFS) [1782 bp, 593
           aa]
          Length = 593

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 127/544 (23%), Positives = 218/544 (40%), Gaps = 82/544 (15%)

Query: 34  VKSQQLEGTEHAVGLDLFQEVLDSD----LKYDD-------KEYSKIRR----------- 71
            ++  +E   H +  DL  EV D       KY D       KEY K R+           
Sbjct: 54  AETTAVEPHPHNLRHDLPYEVRDEAGRKWWKYFDEFEYRVNKEYKKSRKWYEFLYPNHTT 113

Query: 72  --KIDTWLLPVLCIT-----YMLQFLDKLSLN-YASAY--SMKEDLGLVGNEYGNIAAIF 121
             K +  LL  L I      +ML +   + LN Y +AY  +MKEDL + GN+Y   + I 
Sbjct: 114 QTKAERRLLYKLDIIIALYFFMLCWSKSVDLNNYTNAYVSNMKEDLNMKGNDYVYTSTIA 173

Query: 122 NVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEAS 181
           NVG ++  +P  Y++ + P      V    W         A + + + A RF+L    A+
Sbjct: 174 NVGAIVFQLPFMYLLPRFPSHIILPVMDLGWTWFTFACYRANSLAELRAYRFILSAFGAA 233

Query: 182 ISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN--TSLQPWKLIF 239
             P +  +   +Y   E   R+C F     + ++   LL   +  + N    L  W+ +F
Sbjct: 234 YYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRIFKSLNGVHGLAGWRWMF 293

Query: 240 LVFGI-MNLVWSAVFLYIAPDSPAN--AKFLTHEEKLKVIDHVSKNQM--GIKDTKIKP- 293
           L+  I ++L  + +  ++ P  P+   + FLT EE         +NQ+  G+  +K+ P 
Sbjct: 294 LIDAIAISLPTAIIGFFVIPGVPSKCYSLFLTDEEIRIARARNKRNQIKDGVDKSKLAPL 353

Query: 294 ---DQFKEAMLDLNSWILAFIGLGCGVIN-----GSTSNFISSLIKGFGFSGLNATLLQL 345
                +K+       W+L      C   N     GS + ++ S  K +  + +N  L  +
Sbjct: 354 WSRKLWKKVFCTPAFWVLVVFD-TCSWNNMTAYSGSYTLWLKSNTK-YSIAQVN-NLSVI 410

Query: 346 PTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRL-IPLSEKWSLVGCCW 404
           P       V+F A    LF  K   + ++F   + T+   + I+  IP   KW      +
Sbjct: 411 PACLGFAYVIFCAFGADLFRCK--WIFMVFAAIMNTVSCALLIKWDIPSKAKWYAFFTTY 468

Query: 405 LLYIIGGPVIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKI----MYANEAPRY 460
              +   P +  W  IN  +    ++    I W   Y+      + I        E+PR+
Sbjct: 469 FS-VAASPCL--WSFINDFLRFDPQVKA--ITWIAIYSFSQSTYAWIPTLAWPTVESPRF 523

Query: 461 DSGMKGLITCYSGMMFLCIVYYFLMYY-RNKKR----------DAEYGELTPE------D 503
            +G    ++   G ++    +  L +Y RN+K+          D+  GE  PE      +
Sbjct: 524 KTGYT--VSLIFGAIYGLWTFVVLFFYKRNEKKHALGNGIILYDSNKGEELPEFVKKNME 581

Query: 504 EKEG 507
           E++G
Sbjct: 582 ERDG 585

>CAGL0K04609g complement(437799..439628) highly similar to sp|P53241
           Saccharomyces cerevisiae YGR065c H+/biotin symporter,
           hypothetical start
          Length = 609

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 102/425 (24%), Positives = 171/425 (40%), Gaps = 36/425 (8%)

Query: 94  SLNYASAY--SMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFV 151
           S NY +AY   MKEDL   GN+Y   + I NVG ++  +P  Y++ + P      +  F 
Sbjct: 159 SSNYTNAYVSHMKEDLHFKGNDYIYTSTIANVGSIVFQLPFIYILPRFPAHYVLPIMDFG 218

Query: 152 WAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNG 211
           W+        A +   + A RF+L    A+  P    +   +Y   E   R+C F     
Sbjct: 219 WSWFTFACYRAKSLPELRAYRFILSSFGAAYYPVAQYLMGCWYAPDEISSRVCLFFCGQL 278

Query: 212 VATMVGALLAYGLGHATN--TSLQPWKLIFLVFGIMNLVWSAVF-LYIAPDSPAN--AKF 266
           + ++   LL   +  + N    L  W+ +FL+  I   + +A+   ++ P  P+   + F
Sbjct: 279 LGSVTSGLLQARIFKSLNGVHGLAGWRWMFLIDAIAISIPTAILGFFVIPGIPSKCYSLF 338

Query: 267 LTHEEKLKVIDHVSKNQM--GIKDTKIKP----DQFKEAMLDLNSWILAFIGLGCGVIN- 319
           LT EE         +NQ+  G+  +K+        +K+       W+L    L C   N 
Sbjct: 339 LTDEEIRIARARNKRNQIVDGVDRSKLPHIWSWKVWKKVFFTPTFWVLVIFDL-CSWNNM 397

Query: 320 ----GSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLF 375
               GS + ++ S    +    +N  L  LP       V F A    LF NK     ++F
Sbjct: 398 TAYSGSYTLWLKSNT-SYSIEKVN-NLSVLPACLGFAFVFFCAFGSDLFRNK--WPFMVF 453

Query: 376 LTCIPTLGALIGIRL-IPLSEKWSLVGCCWLLYIIGGPVIMCWVLINVTVAGSSKISTVK 434
             C+  +   I I+  +  S KW      +   +   P +  W  IN  +    ++    
Sbjct: 454 SQCMNCISCAILIKWDVASSTKWFAFLITYFS-VAASPCL--WSFINDFLRHDPQVKA-- 508

Query: 435 IVWFIFYTAGNICGSKIMYAN----EAPRYDSG-MKGLITCYSGMMFLCIVYYFLMYYRN 489
           I W   Y+      + I        +APR+ +G +  LI  +S +  L        Y RN
Sbjct: 509 ITWIAIYSISQSTYAWIPTLTWKTVDAPRFKTGYIASLI--FSAIYGLWTFVVLFFYKRN 566

Query: 490 KKRDA 494
           +K++A
Sbjct: 567 EKKNA 571

>KLLA0D12716g complement(1084062..1085849) similar to sp|P39709
           Saccharomyces cerevisiae YAL067c SEO1 suppressor of
           sulfoxyde ethionine resistance, start by similarity
          Length = 595

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 120/581 (20%), Positives = 222/581 (38%), Gaps = 101/581 (17%)

Query: 4   EIKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHAVGLDLFQEVLDSDLKY-- 61
           E  E++  EI    +++ G + V  G      S+ +E  + +   D F+   D D +Y  
Sbjct: 34  EDDEEDVPEIANTAESDAG-LSVTTG------SELVESGKKSSQSDTFEVTSDDDTEYEY 86

Query: 62  ------------DDKEYSKIRRKIDTW-----LLPVLC-------------------ITY 85
                       D++EY   +++ D W       P +                    I Y
Sbjct: 87  RDEANRKWWKFFDEQEYRINKKQNDNWKWYNWFAPDMSTQEKKLLLKLDVLLAFYSMIAY 146

Query: 86  MLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVG---------YLIGSIPANYVI 136
            +++LD ++LN A    MKE++G  GN+  N   ++ VG         +++  +P NYV+
Sbjct: 147 WVKYLDTVNLNNAYVSGMKEEIGFKGNDLVNTQVMYTVGNIIFQIPFIFILNKVPLNYVL 206

Query: 137 QKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNK 196
             L +          W++L +G         + A+RF +G  EA    +   +   FY K
Sbjct: 207 PGLDIC---------WSLLTLGAAYVDTVPHLKAIRFFIGAFEAPSYLAYQYLFGCFY-K 256

Query: 197 REQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQ---PWKLIFLVFGIMNLVWSAVF 253
            ++  R   F      A ++ +       HAT   L     W+  F++  ++++    + 
Sbjct: 257 HDEMVRRSAFYYFGQYAGVLSSGGIISAVHATMNGLHGKSGWRWNFIIDAVISVAVGLLG 316

Query: 254 LYIAPDSPAN--AKFLTHEEKLKVIDHVSKNQMGIKDTKIK---PDQFKEAMLDLNSWIL 308
            Y+ P  P N  + FLT +E       + +N     D   K    + +K  + D   ++L
Sbjct: 317 FYMLPGDPYNCYSIFLTDDEIRLARKRLRENNTEKSDFHNKFFDKEVWKRIIFDWKIYVL 376

Query: 309 AFIGLGC-GVINGSTSNF---ISSLIKGFGFSGLN---ATLLQLPTGAIELVVVFAAGMV 361
               + C    NGS+  F   ++SL    G + L+        + T  + +V +F   ++
Sbjct: 377 TLWNIFCWNNNNGSSGAFLLWLNSLKNSDGSTRLSIEKKNQFSMITPGLGMVYLFLTSLL 436

Query: 362 ALFTNKNVRVILLFLTCIPTL--GALIGIRLIPLSEKWSLVGCCWLLYIIG---GPVIMC 416
           A     + R   + +T +       ++    +P   KW      ++L   G    PV+  
Sbjct: 437 A--DKGHTRWGAIIVTQVFNFIGNVILAAWNVPEGAKW----FAFMLQYFGWAMAPVLYS 490

Query: 417 WVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLIT---CYSG 473
           W          ++   + ++  +  T+       +    EAPRY  G         C S 
Sbjct: 491 WQNDICRRDAQARAVILVVMNMLAQTSTAWISVLVWKTVEAPRYLKGFTWTAVAAFCLSA 550

Query: 474 MMFLCIVYYFLMYYRNKKR------DAEYGELTP--EDEKE 506
             F+ + +Y     RN K       +++ GE  P  +DEKE
Sbjct: 551 WTFVVLYFYKRDERRNAKANGIILYNSKTGENYPPKKDEKE 591

>KLLA0B07953g 703782..705578 similar to sp|P53241 Saccharomyces
           cerevisiae YGR065c VHT1 plasma membrane H+-biotin
           symporter, start by similarity
          Length = 598

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 102/224 (45%), Gaps = 15/224 (6%)

Query: 96  NYASAY--SMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWA 153
           NY SAY   M+EDL + GN+Y N + I NVG ++  +P  YV+ + P      +    W 
Sbjct: 143 NYTSAYVSHMREDLNMKGNDYINTSVISNVGAIVFQLPFMYVLPRFPAHIILPIMDMGWT 202

Query: 154 ILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVA 213
                   A N +S+ A RFLL    A+  P +  +   +Y   E   R+C F     + 
Sbjct: 203 WFTFACFRANNLASLRAYRFLLSAFGAAYYPVSQYVLGSWYAPDEISSRVCLFFFGQLLG 262

Query: 214 TMVGALLAYGLGHATNTSL--QPWKLIFLVFGI-MNLVWSAVFLYIAPDSPAN--AKFLT 268
            +   LL   +  + N  L    W+ +FL+  + ++L  + +  ++ P  P+   + FLT
Sbjct: 263 GVTSGLLQARIFKSLNGVLGHAGWRWMFLIDSMAISLPTAFIGFFVIPGIPSKCYSLFLT 322

Query: 269 HEEKLKVIDHVSKNQM--GIKDTKIKPDQFKEAMLDLNSWILAF 310
            EE +       +NQ+  G++ +++       ++L L  W   F
Sbjct: 323 DEEIVIARRRNLRNQIKDGVQKSQLP------SLLSLKLWKKVF 360

>AEL143W [2363] [Homologous to ScYCR028C (FEN2) - SH]
           complement(358539..360098) [1560 bp, 519 aa]
          Length = 519

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/303 (20%), Positives = 133/303 (43%), Gaps = 18/303 (5%)

Query: 72  KIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIP 131
           KID ++L  +C+ Y + ++D++S   A    M ++LGL GN++  I   F VGY++G +P
Sbjct: 63  KIDLFVLSFVCLQYWINYVDRVSFGNAYVSGMDKELGLHGNQFNVINTCFTVGYILGMLP 122

Query: 132 ANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCA 191
            N ++  LP   +  V    W +L +    AT++    A+RF   + E+       ++  
Sbjct: 123 NNLLLLVLPPRIWLSVCTLGWGLLTLAMYRATSFEYCCAVRFFQAVFESCTFSGTHLILG 182

Query: 192 MFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATN--TSLQPWKLIFLVFGIMNLVW 249
            +Y + E   R   F +   + +M   ++   +  A +    +  W+ +F++  ++ +  
Sbjct: 183 SWYKENELALRSAVFTASGLIGSMCSGMMQVAIFDAMDGRRGISGWRWLFIIDFLVTVPI 242

Query: 250 SAVFLYIAPDSPANAKFLTHEEKLKVID-HVSKNQMGIKDTKIKPD--QFKEAMLDLNSW 306
           +       P +P + +  T        +   ++ ++  +D + + D   F   +   + W
Sbjct: 243 AIYGFIFFPGTPDHNRADTSALVFSKAELRYARARLPARDERARLDLSVFHRVLGRWHWW 302

Query: 307 ILAFIGLGCGVINGSTSNFISSLI---KGFGFSGLNATLLQLPTGAIELVVVFAAGMVAL 363
           + + + +  G      SN   SL    +G+  +  N    + P G      +FA G+ A 
Sbjct: 303 LFSLLWVAGGENISFASNSTFSLWLANRGYSLAQRN----RYPMG------IFAVGIAAT 352

Query: 364 FTN 366
           F +
Sbjct: 353 FAS 355

>Kwal_26.9264
          Length = 614

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 99/431 (22%), Positives = 169/431 (39%), Gaps = 52/431 (12%)

Query: 96  NYASAY--SMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWA 153
           NY++AY   M++DL +  N+Y N  AI NVG ++  +P  Y + + P           W+
Sbjct: 163 NYSNAYFAGMEKDLKMTKNDYINTTAISNVGAIVLQLPFMYFLPRFPAHYILPFMDLGWS 222

Query: 154 ILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLS---MN 210
           +  +    A +   + A RF +    ++  P +  +   +Y   E   R+C F     + 
Sbjct: 223 MFTLACYRAQSLPELRAYRFFVSAFGSAYYPVSQYVLGSWYAPDEISSRVCLFFCGQLLG 282

Query: 211 GVATMVGALLAYGLGHATNTS-LQPWKLIFLVFGIMNLVWSAVF-LYIAPDSPAN--AKF 266
           G+ +  G L A    H      L  W+ +FL+  +   +  AV   ++ P  P+   + F
Sbjct: 283 GITS--GLLQASTFKHLNGVRGLAGWRWMFLIDAVAISIPCAVIGFFVIPGVPSKCYSLF 340

Query: 267 LTHEEKLKVIDHVSKNQMGIKDTKIK------PDQFKEAMLDLNSWIL-AFIGLGCGVIN 319
           LT EE         +NQ+  K  K K         +K+   +   W+L  F       + 
Sbjct: 341 LTDEEIRVARARNKRNQIHDKVDKEKLLSLFSLKIWKKVFFNPVFWVLVVFDTCSWNNMT 400

Query: 320 GSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVA-LFTNKNVRVIL-LFLT 377
             + +F+  L     FS +    L +    +  V VF     A LF  K V +++   + 
Sbjct: 401 AFSGSFLFWLRNDHKFSVVQIQNLSVLPACLGFVFVFICACGADLFRCKWVFMVMSQIMN 460

Query: 378 CIPTLGALIGIRLIPLSEKWSL-VGCCWLLYII------GGPVIMCWVLINVTVAGSSKI 430
           CI +   L+         KW + VG  W  ++I        P +  W  IN  +    ++
Sbjct: 461 CI-SCAILV---------KWDVPVGAKWFAFLITYFSVAASPCL--WSFINDFLRMDPQL 508

Query: 431 STVKIVWFIFYTAGNICGSKIMYAN----EAPRYDSGMKGLI---TCYSGMMFLCIVYYF 483
             V   W   Y+      + I        E PR+ +G    +     Y    F  +V YF
Sbjct: 509 RAV--TWIAIYSFSQSTYAWIPTLTWKTVEQPRFKTGYTASLIFSAVYGSWTF--VVLYF 564

Query: 484 LMYYRNKKRDA 494
             Y R +K++A
Sbjct: 565 --YKRCEKKNA 573

>CAGL0K04565g complement(431909..433771) similar to sp|P53241
           Saccharomyces cerevisiae YGR065c Vitamin H transporter,
           hypothetical start
          Length = 620

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 91/422 (21%), Positives = 175/422 (41%), Gaps = 35/422 (8%)

Query: 94  SLNYASAY--SMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFV 151
           S NY +AY  +MKEDL + GN+Y   + I  +G ++  IP  Y++ ++P           
Sbjct: 174 SANYVNAYVSNMKEDLHMGGNDYVYTSTISTIGQIVFQIPFMYLMPRVPPHYLLPFMDLG 233

Query: 152 WAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNG 211
           W+   +    A     M   RF++G   A+  P +  +   +Y   E   R+  F     
Sbjct: 234 WSAFTLACFRAKTLKEMQGYRFMVGSFGAAYYPVSQYIFGSWYAPDELTSRVLLFSYGQL 293

Query: 212 VATMVGALLAYGLGHATN--TSLQPWKLIFLVFGIMNLVWSAVF-LYIAPDSPAN--AKF 266
           + ++   LL   +  + +    L  W+ +FL+  I   + +A+   ++ P  P+   + F
Sbjct: 294 LGSVTSGLLQAKIFKSLDGVCGLAGWRWMFLIDAIAISIPTAIMGFFLIPGIPSKCYSLF 353

Query: 267 LTHEEKLKVIDHVSKNQM--GIKDTKI----KPDQFKEAMLDLNSWILA-FIGLGCGVIN 319
           LT EE         +N +  G+  +K+    KP  +K+ + +   WILA F  L   V+ 
Sbjct: 354 LTDEEIRIARARNRRNNITDGVDKSKLVPLYKPALWKKVLFNPTFWILAIFDMLSWNVMT 413

Query: 320 GSTSNFISSLIKGFGFSGLNA-TLLQLPTGAIELVVVFAAGMVALFTNKNVRVILL-FLT 377
             T ++   L     +S +    L  LP     + +   A    LF +K   ++    + 
Sbjct: 414 IYTGSYTQWLKSNPNYSIVKVNNLSALPACLGFIYITVCALGSDLFRSKWFFMVFAQAMN 473

Query: 378 CIPTLGALIGIRLIPLSEKWSLVGCC-WLLYIIG----GPVIMCWVLINVTVAGSSKIST 432
           CI + G L+         KW +     W  ++I     G     W  IN  +    +I  
Sbjct: 474 CI-SCGILM---------KWDVAESTKWFAFLISYFCIGASACLWTFINDFLRFDPQIKA 523

Query: 433 VK-IVWFIFYTAGNICGSKIMYAN-EAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNK 490
           +  I  ++F  + +     + +   ++PRY +G    ++    +++    +  L +Y+N 
Sbjct: 524 MSWICNYMFSQSSHAWIPMLAWKTVDSPRYKTGYT--VSLVFSILYGLWTFVVLFFYKNN 581

Query: 491 KR 492
           ++
Sbjct: 582 EK 583

>AFR578C [3770] [Homologous to ScYGR065C (VHT1) - SH]
           (1474397..1476274) [1878 bp, 625 aa]
          Length = 625

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 111/252 (44%), Gaps = 19/252 (7%)

Query: 72  KIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIP 131
           K+D +L     I    + LD  +L       M+EDLG+ GN+    + I  +G ++  +P
Sbjct: 153 KLDIFLGLYFLILCWCKSLDSNNLTNTYISGMREDLGMHGNDLIYTSTISKIGAIVFQLP 212

Query: 132 ANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCA 191
             Y++ + P      +    W+   I    A     + A RFL+    A+  P +  +  
Sbjct: 213 FVYLLPRYPSVYILPLMDLGWSFFTIMCAFARTVPELQAYRFLISAFGAAYYPVSQYVLG 272

Query: 192 MFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSL--QPWKLIFLVFGIMNLVW 249
           ++Y   E   R+C F     +  +   +L   +  + N ++    W+ +FL+ G+   + 
Sbjct: 273 LWYAPDELSSRVCLFFCGQLLGGVTSGVLQARIYKSLNNAMGFAGWRWMFLIDGLAISIP 332

Query: 250 SAVF-LYIAPDSPAN--AKFLTHEE---------KLKVIDHVSKNQ-MGIKDTKIKPDQF 296
           + +   ++ P  P+   + FLT EE         +  ++D+VS NQ + ++  ++    +
Sbjct: 333 TVILGFFVLPGIPSKCYSLFLTDEEIRIARQRNRQNHIVDNVSANQLLSLRSWRL----W 388

Query: 297 KEAMLDLNSWIL 308
           K+ +L    W+L
Sbjct: 389 KKVLLSPALWVL 400

>Scas_683.23
          Length = 601

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 169/424 (39%), Gaps = 34/424 (8%)

Query: 94  SLNYASAY--SMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFV 151
           S N+ +AY  +MKEDL + GN+Y +  +I NVG ++  +P  Y++ + P           
Sbjct: 155 SNNFTNAYVSNMKEDLHMEGNDYIHTTSIANVGAIVFQLPFMYLLPRYPAHIILPAMDMG 214

Query: 152 WAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNG 211
           W+        A   + +   +F+L    A+  P +  +   +Y   E   R+  F     
Sbjct: 215 WSWFTFACYRAKTLAELRGYQFILNAFGAAYYPVSQYILGCWYAPDEISSRVFLFFCGQL 274

Query: 212 VATMVGALLAYGLGHATN--TSLQPWKLIFLVFGIMNLVWSAVF-LYIAPDSPAN--AKF 266
           +  +   LL   +    +    L  W+ +FL+  I   + +A+   ++ P  P+   + F
Sbjct: 275 LGGVTSGLLQARIFENLDGVNGLAGWRWMFLINAIAISIPTAIMGFFVIPGIPSKCYSLF 334

Query: 267 LTHEEKLKVIDHVSKNQM--GIKDTKI----KPDQFKEAMLDLNSWILA-FIGLGCGVIN 319
           LT EE         +NQ+  G+  +K+    K D +K+       W+L  F       + 
Sbjct: 335 LTDEEIRIARARNRRNQINDGVDTSKLTSLFKLDVWKKVFCAPTFWVLVIFDTCSWNNMT 394

Query: 320 GSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVA-LFTNKNVRVIL-LFLT 377
             + ++   L     +S      L +    +    VF   + A LF  K + ++    + 
Sbjct: 395 AFSGSYTLWLKSNTNYSIARVNNLSVLPACLGFAYVFVCSLGADLFHCKWIFMVFSAIMN 454

Query: 378 CIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVIMCWVLINVTVAGSSKISTVKIVW 437
           CI + G LI    IP S KW      +   +   P +  W  IN  +    ++    I W
Sbjct: 455 CI-SCGLLIKWD-IPSSAKWFAFLTTYFS-VAASPCL--WSFINDFLRFDPQVKA--ITW 507

Query: 438 FIFYTAGNICGSKI----MYANEAPRYDSGMKGLI---TCYSGMMFLCIVYYFLMYYRNK 490
              Y+      + I        E+P++ +G    I   + Y    F  +V YF  Y RN+
Sbjct: 508 IAIYSFSQSTNAWIPNLAWPTKESPKFRTGYIVSIVFGSIYGAWTF--VVLYF--YKRNE 563

Query: 491 KRDA 494
           K+ A
Sbjct: 564 KKHA 567

>Sklu_2043.2 , Contig c2043 4428-5156 reverse complement
          Length = 242

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 58/130 (44%), Gaps = 4/130 (3%)

Query: 90  LDKLSLNYASAYSMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVAL 149
           LD  +++Y     MKEDL + GNE     + F  G++IG IP   +  KLP+  Y  +  
Sbjct: 96  LDSSAVSYVYVSGMKEDLRMFGNELTYQNSCFMAGFIIGQIPLTMLAMKLPIYWYLPIMD 155

Query: 150 FVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSM 209
            +  +  +      NY  + ALRF  GL  +   P    +   +  K E   R   +   
Sbjct: 156 SIRELFTLFIYKIDNYHQLCALRFCAGLFGSFFFPKVQFVIGRWCKKTEINLRSAMYF-- 213

Query: 210 NGVATMVGAL 219
             VA+ VG++
Sbjct: 214 --VASQVGSI 221

>Sklu_2358.2 YIL166C, Contig c2358 1699-2198
          Length = 167

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 46/86 (53%)

Query: 54  VLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMKEDLGLVGNE 113
           V D +  + ++E   + RK+D  L    C  ++   +D+ +L+ A A ++ +DL +  N+
Sbjct: 69  VFDPEFTWTEEEGKNLIRKLDWRLALTDCFMFVALQVDRGNLSQAVADNLLDDLNMTTND 128

Query: 114 YGNIAAIFNVGYLIGSIPANYVIQKL 139
           Y     IF V +L+  +P+  + +KL
Sbjct: 129 YNVGNQIFFVCFLVAEVPSQLISKKL 154

>Sklu_2244.6 YOL162W, Contig c2244 14189-14881 reverse complement
          Length = 230

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 101/231 (43%), Gaps = 29/231 (12%)

Query: 298 EAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVV--- 354
           EA+ D + W +  IGL   +  G+ + +++  +K  GFS  N  LL +P   + +++   
Sbjct: 3   EAISDYDLWPVCAIGLIAYIPVGTLTPYLTLTLKQLGFSTFNVQLLTIPYNVLHIILLLI 62

Query: 355 -------VFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLY 407
                  V    +V+L       +++ F+ C P  G+L+        + W     C L  
Sbjct: 63  ITWVTERVGDRSLVSLAAPVYSTILMGFIRCWP--GSLV--------QPWPTYVLCTLF- 111

Query: 408 IIGGPVI----MCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSG 463
            +G P I    + WV  N     S  +S+   ++ +F   G+I  ++I  A++ P Y  G
Sbjct: 112 -LGTPYIHAICVSWVSRNSNSIKSRAVSSA--LYNMFVQLGSIAANQIYRADDKPFYHRG 168

Query: 464 MKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKD 514
                     ++ L ++      +RNK R  ++  +T EDEKE  I   +D
Sbjct: 169 NVQSFWISFYLILLLLLVKVYYVWRNKVRARKWDPMT-EDEKETYILTTQD 218

>YOL162W (YOL162W) [4663] chr15 (10118..10765) Protein of unknown
           function [648 bp, 215 aa]
          Length = 215

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 97/210 (46%), Gaps = 13/210 (6%)

Query: 311 IGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVALFTNKNVR 370
           +GL   +     + +++ +++  GF+   A LL +P   + ++++F  G+       N R
Sbjct: 1   MGLLAYIPTNVLATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLF--GLTWSTEKCNNR 58

Query: 371 VILLFLTCIPTLGALIGIRLIP--LSEKWSLVGCCWLLYIIGGPVIMCWVLINVTVAGSS 428
           + L  L  + T+  L  +R     +  KW       L  I+  P I   + +++    S 
Sbjct: 59  LGLSLLQPLYTVPLLAVLRFWKGTMFNKWGTYAIITL--ILDNPYIHA-ICVSLCSRNSQ 115

Query: 429 KISTVKI---VWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLM 485
            + T  +   ++ +F  AG I  S I   ++AP Y  G  G++   +  MF  ++   L+
Sbjct: 116 SVKTRTVSTCLYNMFVQAGLIISSNIYAKSDAPLYRKG-NGVLFGLALFMFPILIGSKLI 174

Query: 486 Y-YRNKKRDAEYGELTPEDEKEGVINGFKD 514
           Y Y NK+RD  +  ++ E+EK+  ++   D
Sbjct: 175 YVYINKQRDKRWNAMS-EEEKDHYLSTTSD 203

>YOL163W (YOL163W) [4662] chr15 (9596..10105) Protein of unknown
           function [510 bp, 169 aa]
          Length = 169

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 9/136 (6%)

Query: 149 LFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLS 208
           +  W+++       T  SS    R L+GL E       ++  + FY+  E   R+  F  
Sbjct: 1   MIAWSLVATLQCKMTGKSSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSIRLSFFWV 60

Query: 209 MNGVATMVGALLAYGLGHATNT-SLQPWKLIFLVFGIMNLV--WSAVFLY----IAPDSP 261
              +  ++ +++A+G+ H      +  W+ +FL+  I  LV   SA FL     +    P
Sbjct: 61  TLSLTQIITSIVAFGVFHMRGIGGMAGWQWLFLIERIFTLVIGISAYFLMVPSVVQTKKP 120

Query: 262 ANAK--FLTHEEKLKV 275
            + K  F   EEK+ V
Sbjct: 121 WSKKGWFTEREEKIIV 136

>KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromyces
           lactis YGL104C, start by similarity
          Length = 528

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 77/163 (47%), Gaps = 13/163 (7%)

Query: 92  KLSLNYASAY----SMKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGV 147
           +L+  YA ++     + + + L  +++G I ++F+VG LIGS+ A       P+A   G 
Sbjct: 68  ELNPGYADSFLGRLGLAQCIPLTDSQFGLITSVFSVGGLIGSLVAG------PLADSYGR 121

Query: 148 ALFVWAILLIGHIGATN-YSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTF 206
               +    +G +GA   +SS   L  L G + A IS  ++++    +     P  +   
Sbjct: 122 KPISYWNCSVGILGAVCLFSSNNYLGMLFGRLLAGISCGSLIVVTPLFINEMSPVHLKGS 181

Query: 207 L-SMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLV 248
           L SMN V+   G L+   L       LQ W+ I L  G+++L+
Sbjct: 182 LGSMNQVSINCGILVTQSLAMLWANMLQ-WRWILLFGGLISLL 223

>CAGL0I07447g 716104..717816 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, hypothetical start
          Length = 570

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 95/238 (39%), Gaps = 29/238 (12%)

Query: 86  MLQFLDKLS---LNYASAY------SMKEDLGLVGNEYGN---IAAIFNVGYLIGSIPAN 133
           ML F+  LS     Y + Y      S+  DL      YG      A  ++G LI ++ A 
Sbjct: 75  MLTFVASLSGFLFGYDTGYISSALISIGTDLDNKELTYGEKEITTAATSLGALIFALVAG 134

Query: 134 YVIQ---KLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMC 190
           + +    + P   ++ +   + AIL    + A  +  M A RF++G      S     + 
Sbjct: 135 FSVDIFGRKPCLMFSNIMFLIGAIL---QVTAHKFWQMTAGRFIMGFGVGIGS-----LI 186

Query: 191 AMFYNKREQPFRMCTFLS-MNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVW 249
           A  Y     P  +   L+ +N +    G L+AYG G   N     W+ I +   ++  V 
Sbjct: 187 APLYISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNGWR-ILVGLSLIPTVL 245

Query: 250 SAVFLYIAPDSPANAKFLTHEEKLKVIDHVSKNQMGIKDTKIKPDQFKEAMLDLNSWI 307
             VF    PD+P         EK K +   S N  G+ D  I  D+  E +L LN  I
Sbjct: 246 QFVFFIFLPDTPRYYVMKGDYEKAKSVLKRSYN--GVSDELI--DRKIEELLALNQSI 299

>Scas_581.6
          Length = 587

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 83/198 (41%), Gaps = 27/198 (13%)

Query: 79  PVLCITYMLQFLDKLSLNYASAY------SMKEDLGLVGNEYGN---IAAIFNVGYLIGS 129
           P + I   +  +      Y + Y      S+ +DLG     YG+   I A  ++G LI S
Sbjct: 86  PFILILTFVASISGFMFGYDTGYISSALISINKDLGRTLT-YGDKEIITAATSLGALISS 144

Query: 130 I---PANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGL---MEASIS 183
           I    A  +  + P   ++ V   + AIL    I A  +  M A R ++G    + + IS
Sbjct: 145 IFAGTAADIFGRKPCLMFSNVLFVIGAIL---QITAHRFWQMNAGRLIMGFGVGIGSLIS 201

Query: 184 PSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFG 243
           P       +F ++            +N +    G L+AYG G   N     W+++  +  
Sbjct: 202 P-------LFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNGWRILVGLSL 254

Query: 244 IMNLVWSAVFLYIAPDSP 261
           I  ++  + FL++ PD+P
Sbjct: 255 IPTVLQFSFFLFL-PDTP 271

>Scas_632.14
          Length = 553

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 77/185 (41%), Gaps = 12/185 (6%)

Query: 116 NIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLL 175
            I +I + G  IGSI A  +  +    K   +  F++ I  +   G+T    ++  RF++
Sbjct: 84  TITSITSFGSFIGSIIAFPLADRCGRRKTLAICCFIFIIAALWMAGSTTLLLLVLGRFIV 143

Query: 176 GLMEASISPSNMMMCAMFYNKREQPFRMCTF-LSMNGVATMVGALLAYGLGHATNTSLQP 234
           G      +      C   Y     P  +  F L++N +A   G LL+Y   +        
Sbjct: 144 GCAVGVAA-----QCVPIYLSEISPSSIRGFILTLNSLAITGGQLLSYIAAYFLANVNHS 198

Query: 235 WKLIFLVFGIMNLVWSAVFLYIAPDSP----ANAKFLTHEEKLKVI-DHVSKNQMGIKDT 289
           W+ +F +  I  ++   +  +I P+SP    +  +F    + L +I    S  Q+ +K  
Sbjct: 199 WRYLFGISSIPAIILMLLLDFI-PESPRWLISKGEFSEAHKSLTMIYPTASHYQVNLKLR 257

Query: 290 KIKPD 294
           K+  D
Sbjct: 258 KLIID 262

>KLLA0F11077g 1021058..1022797 some similarities with sp|P53918
           Saccharomyces cerevisiae YNL125c ESBP6}, hypothetical
           start
          Length = 579

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 4/84 (4%)

Query: 107 LGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGH--IGATN 164
           +GL   +     A+FN   +IG     Y  +K+     T + +F + ILL+G       +
Sbjct: 384 IGLNSQQATVTLALFNGAQIIGRPAMGYFSEKIGRVNCTSICMF-YTILLLGPYWFNVDS 442

Query: 165 YSSMMALRFLLGLMEASISPSNMM 188
           YS+++   FLLGL  A +S  N++
Sbjct: 443 YSAILGFTFLLGL-AAGVSSVNVI 465

>YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permease
           (minor), closely related to Itr1p, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1830 bp, 609 aa]
          Length = 609

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 112/287 (39%), Gaps = 33/287 (11%)

Query: 33  NVKSQQLEGTEHAVGLDLFQEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDK 92
            +KS+Q E  +   G  + + V D D   D        + I  +++ +  +  +  F+  
Sbjct: 70  QIKSRQDEDEDD--GRIVIKPVNDED---DTSVIITFNQSISPFIITLTFVASISGFMFG 124

Query: 93  LSLNYASAY--SMKEDLGLVGNEYGN---IAAIFNVGYLIGSIPANY---VIQKLPVAKY 144
               Y S+   S+  DL      YG    I A  ++G LI S+ A     V  + P   +
Sbjct: 125 YDTGYISSALISINRDLDNKVLTYGEKELITAATSLGALITSVGAGTAADVFGRRPCLMF 184

Query: 145 TGVALFVWAILLIGHIGATNYSSMMALRFLLGL---MEASISPSNMMMCAMFYNKREQPF 201
           + +   + AIL    I A  +  M A R ++G    + + ISP       +F ++     
Sbjct: 185 SNLMFLIGAIL---QITAHKFWQMAAGRLIMGFGVGIGSLISP-------LFISEIAPKM 234

Query: 202 RMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSP 261
                  +N +    G L+AYG G   N     W+ I +   ++  V    F    PD+P
Sbjct: 235 IRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWR-ILVGLSLIPTVLQFSFFCFLPDTP 293

Query: 262 ANAKFLTHEEKLKVIDHVSKNQ-MGIKDTKIKPDQFKEAMLDLNSWI 307
              ++   +  LK    V K   +  +D  I  DQ  E +  LN  I
Sbjct: 294 ---RYYVMKGDLKRAKMVLKRSYVNTEDEII--DQKVEELSSLNQSI 335

>Kwal_23.4803
          Length = 541

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 73/158 (46%), Gaps = 10/158 (6%)

Query: 147 VALFVWAILLIGHIGATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTF 206
           V LF++ +  IG     N   ++ +RF+ G++    SP+ +   A        P R+  F
Sbjct: 170 VTLFLFMLFQIGAATVHNIGGLIVIRFISGVL---CSPA-LATGAGSMGDFIVPERVPIF 225

Query: 207 LSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKF 266
           + +  V  +   ++A  LG A   + + W+ IF +  +M LV + + + +A     +   
Sbjct: 226 IGLWAVGAVAAPVMAPLLGAAITVA-KNWRWIFWL--LMWLVAATLLVLVAFFPETHQSN 282

Query: 267 LTHEEKLKVIDHVSKNQMGIKDTKIKPDQ--FKEAMLD 302
           + H   +++      ++   K+ +I+ DQ  FK+ + D
Sbjct: 283 ILHRRAVRIRRETGDSRYYTKEERIE-DQVKFKDFLSD 319

>KLLA0B05841g complement(522241..527877) highly similar to sp|P40989
            Saccharomyces cerevisiae GR032w GSC2 1, 3-beta-D-glucan
            synthase subunit, start by similarity
          Length = 1878

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 77/195 (39%), Gaps = 19/195 (9%)

Query: 304  NSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNATLLQLPTGAIELVVVFAAGMVAL 363
            NSWI  ++ +    + G     +    +        A    L    +   +++AAG    
Sbjct: 1519 NSWI-GYVRMSRSRVTGFKRKLVGDESERAAGDAPRAHRSNLIFAELIPCIIYAAGCFTA 1577

Query: 364  FTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSLVGCCWLLYIIGGPVI-MCWVLINV 422
            FT  N +  +  ++ + +   ++   L P+     ++G C  L    GP++ MC      
Sbjct: 1578 FTFINAQTGVKDVSVVNSWLRIVICTLGPIVVNMGVLGVCLGLSCCSGPLLGMCCKKTGS 1637

Query: 423  TVAGSSK--ISTVKIVWFIFYTAGNICGSKIMYANEAPRYDSGMKGLITCY--SGMMFLC 478
             +AG +      V IV+FI           IM+  EA  +   + GLITC     ++F C
Sbjct: 1638 VMAGIAHGVAVIVHIVFFI-----------IMWVLEAFNFTKMLIGLITCIQCQRLVFKC 1686

Query: 479  IVYYFLMYYRNKKRD 493
            +  + L   R  K D
Sbjct: 1687 MTLFMLT--REFKND 1699

>Scas_637.9
          Length = 607

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 98/246 (39%), Gaps = 34/246 (13%)

Query: 39  LEGTEHAVGLDLFQEVLDSDLKYDDKEYSKIRRKIDTWLL-----PVLCITYMLQFLDKL 93
           +EGT+    ++ F    D + + D      +  + DT ++      +      L F+  +
Sbjct: 60  VEGTQSRQDINSFDHETDDENENDRIVIKPVNDEDDTSVIITFNQGISAFIITLTFVASI 119

Query: 94  S---LNYASAY------SMKEDLGLVGNEYGN---IAAIFNVGYLIGSIPANY---VIQK 138
           S     Y + Y      S+  DL      YG+   I A  ++G LI S  A     +  +
Sbjct: 120 SGFMFGYDTGYISSALVSIGTDLDNKVLSYGDKEIITAATSLGALITSTMAGTAADIFGR 179

Query: 139 LPVAKYTGVALFVWAILLIGHIGATNYSSMMALRFLLGL---MEASISPSNMMMCAMFYN 195
            P   ++ V   + AIL    I A  +  M   R ++G    + + ISP       +F +
Sbjct: 180 RPCLMFSNVMFVIGAIL---QITAHKFWQMAVGRLIMGFGVGIGSLISP-------LFIS 229

Query: 196 KREQPFRMCTFLSMNGVATMVGALLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAVFLY 255
           +            +N +    G L+AYG G   N     W+++  +  I  ++  + FL+
Sbjct: 230 EIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWRILVGLSLIPTVLQFSFFLF 289

Query: 256 IAPDSP 261
           + PD+P
Sbjct: 290 L-PDTP 294

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.140    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,779,639
Number of extensions: 725664
Number of successful extensions: 2097
Number of sequences better than 10.0: 90
Number of HSP's gapped: 2043
Number of HSP's successfully gapped: 90
Length of query: 519
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 413
Effective length of database: 12,926,601
Effective search space: 5338686213
Effective search space used: 5338686213
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)