Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A04059g1366134567770.0
Kwal_26.70831400143521320.0
ACR292W1439147420590.0
Scas_505.31364142519940.0
YAL024C (LTE1)1435148219630.0
CAGL0G06226g1318141717500.0
YLR310C (CDC25)15892232112e-16
CAGL0E03476g15642122102e-16
Kwal_14.231315172082003e-15
Sklu_2189.415262081914e-14
YLL016W (SDC25)10482211871e-13
Scas_621.1*13232101772e-12
Scas_604.1516762111753e-12
KLLA0D09306g15371761682e-11
ADL038W15091721646e-11
CAGL0D06512g13081771224e-06
Kwal_33.1359814122231153e-05
KLLA0C03410g13601851072e-04
CAGL0B01287g1247108840.12
Scas_476.21330207820.24
YDR427W (RPN9)39354731.9
YCR038C (BUD5)64298705.4
Sklu_2291.5100085706.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04059g
         (1345 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04059g complement(361328..365428) similar to sp|P07866 Sac...  2615   0.0  
Kwal_26.7083                                                          825   0.0  
ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH] complement(...   797   0.0  
Scas_505.3                                                            772   0.0  
YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exch...   760   0.0  
CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces c...   678   0.0  
YLR310C (CDC25) [3699] chr12 complement(752226..756995) Guanine-...    86   2e-16
CAGL0E03476g complement(318956..323650) similar to sp|P04821 Sac...    86   2e-16
Kwal_14.2313                                                           82   3e-15
Sklu_2189.4 YLR310C, Contig c2189 8340-12920                           78   4e-14
YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown...    77   1e-13
Scas_621.1*                                                            73   2e-12
Scas_604.15                                                            72   3e-12
KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharo...    69   2e-11
ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W...    68   6e-11
CAGL0D06512g complement(617453..621379) some similarities with s...    52   4e-06
Kwal_33.13598                                                          49   3e-05
KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030...    46   2e-04
CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyce...    37   0.12 
Scas_476.2                                                             36   0.24 
YDR427W (RPN9) [1250] chr4 (1322193..1323374) Non-ATPase subunit...    33   1.9  
YCR038C (BUD5) [572] chr3 complement(197616..199544) GTP/GDP exc...    32   5.4  
Sklu_2291.5 YGL094C, Contig c2291 9283-12280                           32   6.5  

>KLLA0A04059g complement(361328..365428) similar to sp|P07866
            Saccharomyces cerevisiae YAL024c LTE1 GDP/GTP exchange
            factor, start by similarity
          Length = 1366

 Score = 2615 bits (6777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1306/1345 (97%), Positives = 1306/1345 (97%)

Query: 1    MSEVVEKADENVVPLFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKV 60
            MSEVVEKADENVVPLFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKV
Sbjct: 1    MSEVVEKADENVVPLFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKV 60

Query: 61   DYSMLTDFFLVYRNFMSSQKLLDLIQERFQWAIDLRQSDPSSQEKITSEVILVRMFVLVR 120
            DYSMLTDFFLVYRNFMSSQKLLDLIQERFQWAIDLRQSDPSSQEKITSEVILVRMFVLVR
Sbjct: 61   DYSMLTDFFLVYRNFMSSQKLLDLIQERFQWAIDLRQSDPSSQEKITSEVILVRMFVLVR 120

Query: 121  HWLSNYFAQDFVVDTSLRRQFLQFINGYSPVDRFLDNIIISLKKLWVQNVQIMWEDLENL 180
            HWLSNYFAQDFVVDTSLRRQFLQFINGYSPVDRFLDNIIISLKKLWVQNVQIMWEDLENL
Sbjct: 121  HWLSNYFAQDFVVDTSLRRQFLQFINGYSPVDRFLDNIIISLKKLWVQNVQIMWEDLENL 180

Query: 181  IVENNVVSRDDWLKWEIEDVPXXXXXXXXXXXXXXXRLSFIALQNINNPVLRNESLLSLL 240
            IVENNVVSRDDWLKWEIEDVP               RLSFIALQNINNPVLRNESLLSLL
Sbjct: 181  IVENNVVSRDDWLKWEIEDVPSGSSSETGEGSTKGKRLSFIALQNINNPVLRNESLLSLL 240

Query: 241  HTREKIPLPQQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQ 300
            HTREKIPLPQQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQ
Sbjct: 241  HTREKIPLPQQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQ 300

Query: 301  EREITDPKNSKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTS 360
            EREITDPKNSKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTS
Sbjct: 301  EREITDPKNSKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTS 360

Query: 361  YMETDLPEQSNGSDSTNTVNGNNTNHKGILGLLSKWKLNHQRKPTVNPVQNPPRVENLIK 420
            YMETDLPEQSNGSDSTNTVNGNNTNHKGILGLLSKWKLNHQRKPTVNPVQNPPRVENLIK
Sbjct: 361  YMETDLPEQSNGSDSTNTVNGNNTNHKGILGLLSKWKLNHQRKPTVNPVQNPPRVENLIK 420

Query: 421  YVFSISSLDNHANPLPDSLSSMFDILSARTIDEVEYLVSVESDXXXXXXXXXXXXXISKL 480
            YVFSISSLDNHANPLPDSLSSMFDILSARTIDEVEYLVSVESD             ISKL
Sbjct: 421  YVFSISSLDNHANPLPDSLSSMFDILSARTIDEVEYLVSVESDLLAKLEAKKLTTEISKL 480

Query: 481  ETNEDESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRTNKSTTHLLSPSTSALERKNI 540
            ETNEDESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRTNKSTTHLLSPSTSALERKNI
Sbjct: 481  ETNEDESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRTNKSTTHLLSPSTSALERKNI 540

Query: 541  RNSAPMLYSYNNSRYSITNALMGLPNTNDNSSPKRLVFHDPTRNSPTKKAILANNLNNIG 600
            RNSAPMLYSYNNSRYSITNALMGLPNTNDNSSPKRLVFHDPTRNSPTKKAILANNLNNIG
Sbjct: 541  RNSAPMLYSYNNSRYSITNALMGLPNTNDNSSPKRLVFHDPTRNSPTKKAILANNLNNIG 600

Query: 601  EYNGERDSITSIVTYDSAFSDISSSGNILSQHKGSSNIFMESAPTLKRKLNVNDLRRFNF 660
            EYNGERDSITSIVTYDSAFSDISSSGNILSQHKGSSNIFMESAPTLKRKLNVNDLRRFNF
Sbjct: 601  EYNGERDSITSIVTYDSAFSDISSSGNILSQHKGSSNIFMESAPTLKRKLNVNDLRRFNF 660

Query: 661  EKSDSTDDRSCSPQNREATETSATSMESDANDNAIQDEYENENEDIASLITAYEESTSEI 720
            EKSDSTDDRSCSPQNREATETSATSMESDANDNAIQDEYENENEDIASLITAYEESTSEI
Sbjct: 661  EKSDSTDDRSCSPQNREATETSATSMESDANDNAIQDEYENENEDIASLITAYEESTSEI 720

Query: 721  DTQCQNNAQIRRPTSGRISITRNYSVASPNSLRSILPKSPLILGNEVFIERDKALAANQD 780
            DTQCQNNAQIRRPTSGRISITRNYSVASPNSLRSILPKSPLILGNEVFIERDKALAANQD
Sbjct: 721  DTQCQNNAQIRRPTSGRISITRNYSVASPNSLRSILPKSPLILGNEVFIERDKALAANQD 780

Query: 781  IIXXXXXXXXXXXNDNDRKFTVSRGSVCNDSDSQSISTNLLFSSAQASPQKLVIKEVDVI 840
            II           NDNDRKFTVSRGSVCNDSDSQSISTNLLFSSAQASPQKLVIKEVDVI
Sbjct: 781  IISELEETTSLLLNDNDRKFTVSRGSVCNDSDSQSISTNLLFSSAQASPQKLVIKEVDVI 840

Query: 841  QEKSEHPDVPTPVLCKQPISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTTLREK 900
            QEKSEHPDVPTPVLCKQPISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTTLREK
Sbjct: 841  QEKSEHPDVPTPVLCKQPISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTTLREK 900

Query: 901  YHLEKQATNDIFEEDVENLNPENNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQT 960
            YHLEKQATNDIFEEDVENLNPENNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQT
Sbjct: 901  YHLEKQATNDIFEEDVENLNPENNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQT 960

Query: 961  SLDEEEIATQDNENKDHGIDKKKLEDIMNGIDDTADTSMDPVNLALMKLEGTYDKGEKEI 1020
            SLDEEEIATQDNENKDHGIDKKKLEDIMNGIDDTADTSMDPVNLALMKLEGTYDKGEKEI
Sbjct: 961  SLDEEEIATQDNENKDHGIDKKKLEDIMNGIDDTADTSMDPVNLALMKLEGTYDKGEKEI 1020

Query: 1021 DDKSPSINSELAREVENFQIVQTAALPESARKRQSMFIQRRRNTMIDFSVRDSLIDKDSS 1080
            DDKSPSINSELAREVENFQIVQTAALPESARKRQSMFIQRRRNTMIDFSVRDSLIDKDSS
Sbjct: 1021 DDKSPSINSELAREVENFQIVQTAALPESARKRQSMFIQRRRNTMIDFSVRDSLIDKDSS 1080

Query: 1081 CTRLENTDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQLTLIEKEILSEV 1140
            CTRLENTDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQLTLIEKEILSEV
Sbjct: 1081 CTRLENTDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQLTLIEKEILSEV 1140

Query: 1141 DWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWIISEIVMTQDIRLR 1200
            DWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWIISEIVMTQDIRLR
Sbjct: 1141 DWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWIISEIVMTQDIRLR 1200

Query: 1201 RNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLTWETLKAIP 1260
            RNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLTWETLKAIP
Sbjct: 1201 RNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLTWETLKAIP 1260

Query: 1261 SLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEVLNYNKFQTNVQI 1320
            SLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEVLNYNKFQTNVQI
Sbjct: 1261 SLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEVLNYNKFQTNVQI 1320

Query: 1321 VKNFVQKMQWSKFYNIDIDHELLSK 1345
            VKNFVQKMQWSKFYNIDIDHELLSK
Sbjct: 1321 VKNFVQKMQWSKFYNIDIDHELLSK 1345

>Kwal_26.7083
          Length = 1400

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1435 (39%), Positives = 791/1435 (55%), Gaps = 176/1435 (12%)

Query: 15   LFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFLVYRN 74
            +FS  E YP PS   ++   R     I+K  L AL+++L+SPLD +DY  L DFFL YR 
Sbjct: 16   VFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFLSYRK 75

Query: 75   FMSSQKLLDLIQERFQWAIDLRQSDPSSQEKITSEVILVRMFVLVRHWLSNYFAQDFVVD 134
            F++  +LL L++ R QWA +        ++KI  +V  VR FV++RHW+ NYFAQDF+ D
Sbjct: 76   FLAPNELLRLLESRLQWAFNESLQADKERQKI-GQVTSVRTFVVIRHWILNYFAQDFLAD 134

Query: 135  TSLRRQFLQFINGYS-----PVDRFLDNIIISLKKLWVQNVQIMWEDLENLIVENNVVSR 189
              LRRQF+  IN  S        + +  I++S+KK WV  +++MWED+     EN+  + 
Sbjct: 135  QELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDV---TFENSPSNV 191

Query: 190  DDWLKWEIEDVPXXXXXXXXXXXXXXXRLSFIALQNINNPVLRNESLLSLLHTREKIPLP 249
            D+WL ++I+D+                RLSF ALQ+  NP  RN S+LSL    E   LP
Sbjct: 192  DEWLDFKIQDI-----DTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGIENFQLP 246

Query: 250  QQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREITDPKN 309
            + S   +++   +IKQRT SM LFP++                 P A  K   E ++P N
Sbjct: 247  ENSAQINRRLGAKIKQRTASMFLFPQDNL---------------PSARLKASSESSEPAN 291

Query: 310  SKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYMETDLPEQ 369
            S  + H     S+  +   +MKDL+YP++PSVD  +PPTPAK +EFIL++SY+ +D P +
Sbjct: 292  SHSSGH-----SKSESGPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTE 346

Query: 370  ----SNGSDSTNTVNGNNTNHKGILGLLSKWKLNHQ-RKPTVNPVQNPPR---VENLIKY 421
                +N        + N++ +KG++GLLSKWK NH  R          P+   +ENLIK 
Sbjct: 347  EADPANAKTDKVKKHNNHSYNKGMVGLLSKWKKNHNLRSENHKAHSESPKNQEIENLIKL 406

Query: 422  VFSISSLDNHANPLPDS---LSSMFDILSARTIDEVEYLVSVESDXXXXXXXXXXXXXIS 478
            VFSI+SL++  +   D+   LSS FDILSARTIDEVEY +++E+D               
Sbjct: 407  VFSITSLEHKQDQSEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGLFNFE 466

Query: 479  KLETNEDESQD---YSVIDNLNLYKTVSSIANSVISLSKTLNVRTNKSTTHLLSPSTSAL 535
            ++     ++Q     S +DNLNLYKTVSSIA+SVISLSKTL         H +SPS +A 
Sbjct: 467  RIHHENPQTQSPEAVSAMDNLNLYKTVSSIASSVISLSKTLQYH------HAVSPSAAAQ 520

Query: 536  ERKNIRNSAPMLYSYNNSRYSITNALM----GLPNTNDNSSPKRLVFHDPTR-------- 583
            ER+ ++++   ++  NNS  + T+AL+      P T  N  P++LVFH P          
Sbjct: 521  ERRRVKSAE--VFFRNNSVLNFTDALLTRDIKTPATG-NDGPRKLVFHGPMGMERIRKEE 577

Query: 584  ------NSPTKKAILANNLN------NIGEYNGERDSITSIVTYDSAFSDISSSGNILSQ 631
                   +PTK  + +++        N  E N E  S  S        S I+   +  S+
Sbjct: 578  FRFHHYKTPTKTGLTSHSTPSVMQSVNTKEVNTEDRSRYSPTKGIRISSVITEVDDTFSK 637

Query: 632  HKGSSN-------IFMESAPTLKRKLNVNDLRRFNFEK----SDSTDDRSCSPQNREATE 680
            H+ S N       + +++   LKRK  + +LR FNFE+     + TD +  + Q +E  E
Sbjct: 638  HENSMNSAQSVNSVSLDTELPLKRKEGLKNLREFNFEEVADHPEVTDQQEVTDQ-QELGE 696

Query: 681  TSATSMESDANDNAIQDEYENENEDIASLITAYE-----ESTSEIDTQCQNNAQIRRPTS 735
                   S A+   +Q++ E++N   AS  T ++     ES     T   + AQ    +S
Sbjct: 697  GENGERLSSAD---LQNDAEDDN---ASFFTTFDDVSVRESIKRF-TPASSVAQKSVTSS 749

Query: 736  GRISI--TRNYSVASPNSLRSILPKSPLILGNEVFIERDKALAANQDIIXXXXXXXXXXX 793
            GRISI  +R  SV+ P +  S+L    LI+    F   D+ L  N++ +           
Sbjct: 750  GRISIRKSRGQSVSQPRT--SVL--GGLIVQEGAFSRLDEELLNNEEEMKNLEERTSALV 805

Query: 794  NDNDRKFTVSRGSVCNDSDSQ--------SISTNLLFSSAQASPQKLVIKEVDVIQEKSE 845
                        S C + D+         S+ST LLF+S   SP K+ +KE   + +   
Sbjct: 806  LSAKEDEKEKERSDCEEEDAADDRASNATSVSTQLLFTSQNNSPNKMDLKE---LLDNDR 862

Query: 846  HPDVPTPVLCKQPISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTTLREKYHLEK 905
             P  P   L +     LS  PS+ SI S DS  SF  T+     +    T  R       
Sbjct: 863  FP--PGNKLIR-----LSSIPSMHSIVSGDSFSSFQTTNTFGLHSTNSKTGARAVVTPSM 915

Query: 906  QATNDIFEEDVENLNPEN-----NKYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQT 960
             A     ++ +  L PE      NKYLFSPD+DS+DFASPEKN++DLK +FI     E  
Sbjct: 916  DAEFSGPKDSL--LGPEGDDREANKYLFSPDSDSLDFASPEKNMEDLKNKFISPIVSEAP 973

Query: 961  SLDEEEIAT-----QDNENKD-------------HGIDKKKLEDI----------MNGID 992
            SL+EE+ +      Q+ E  D             H   ++ +  I          +N   
Sbjct: 974  SLNEEQTSREFDDDQEGEPNDSQLSSTTQPERLPHEHHRRSITPIVSPYKANDSRLNKFA 1033

Query: 993  DTADTSM--DPVNLALMKLEGTYDKGEKEIDDKSPSINSELAREVENFQIVQTAALPESA 1050
               D S+  DPVN+ALMKLEGT+ K  KE  +    I     R +              +
Sbjct: 1034 KLTDESLHGDPVNVALMKLEGTFSKENKEKGENDADIEKLKERRLTGL----------GS 1083

Query: 1051 RKRQSMFIQRRRNTMIDFSVRDSLIDKDSSCTRLENTDEQIRNLLNQYTLTDSRLKIDNL 1110
            R+R+S  I++RR    +  +     +K      +  TD +I  LL  Y + D RL + N 
Sbjct: 1084 RERRSFLIEKRRQIKSEIPLTPRSKEKVKQEEEVRATDLEITELLENYKIQDKRLNVSNA 1143

Query: 1111 EQHIPFILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENL 1170
            +QH+PFILMYDS+S+A QLTL+E+EIL+E+DWKDLLDL +  ++P  TSWLQLL+QNE L
Sbjct: 1144 QQHVPFILMYDSRSIAEQLTLVEREILNEIDWKDLLDLKLKREVPSVTSWLQLLLQNERL 1203

Query: 1171 SGIDLAIARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILAL 1230
            SGIDLAIARFNLTVDWIISEIVMT D +LRRNTIQR IH+AEHCK  QNYNTLM+IILAL
Sbjct: 1204 SGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILAL 1263

Query: 1231 NSIVVQKFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYL 1290
            +S+VVQ + + WRL+EPGDLLTWE+LK +PSLEKNY NIR L++++ P+ GCIPFIVVYL
Sbjct: 1264 SSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYL 1323

Query: 1291 SDLSLNIEKRTWIVHDEVLNYNKFQTNVQIVKNFVQKMQWSKFYNIDIDHELLSK 1345
            SDL+LN EK  WIV ++VLNY+KFQTNVQIVKNF+Q+ QWSKFY   ++ ELLSK
Sbjct: 1324 SDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLSK 1378

>ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH]
            complement(891524..895843) [4320 bp, 1439 aa]
          Length = 1439

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1474 (37%), Positives = 798/1474 (54%), Gaps = 210/1474 (14%)

Query: 15   LFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFLVYRN 74
            +FS  + YP PS  V+T        +I+   + AL+  L+SP+D V+Y +  DFFLVYRN
Sbjct: 15   VFSAADYYPAPSGRVITYAAGGRGRQIMAADVTALVAALTSPVDGVEYELFADFFLVYRN 74

Query: 75   FMSSQKLLDLIQERFQWAIDLRQSDPSSQEKITSEVILVRMFVLVRHWLSNYFAQDFVVD 134
            F+ +++LL+L++ RF W++    +   ++ ++  E+ LVR FVL+RHW+ NYFAQDF+ D
Sbjct: 75   FLEARRLLELLEARFDWSLGEIGAG-RAKARVVGEITLVRTFVLLRHWVINYFAQDFLPD 133

Query: 135  TSLRRQFLQFINGYSPV-----DRFLDNIIISLKKLWVQNVQIMWEDLENLIVENNVVSR 189
             +LR +FL F+NG          + + NI++SLKK W   V+++W+DL+ L  E  + S 
Sbjct: 134  VALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDLD-LEREFELRSA 192

Query: 190  DDWLKWEIEDVPXXXXXXXXXXXXXXXRLSFIALQNINNPVLRNESLLSLLHTREKIPLP 249
            D WL+++I DV                RLSF A Q+  NP  RNES+LSL   ++   LP
Sbjct: 193  DAWLQFQIPDV---TQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLYRPKDNFQLP 249

Query: 250  QQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREITDPKN 309
             ++ D + KQ TRIK+RT SM L+P+++ N  S N+K   S   P       R+I+    
Sbjct: 250  VRNNDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSHVRKIS---- 305

Query: 310  SKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYMETDLPEQ 369
                      +S+VTNVS ++K++ YP++P+V+ F PPTP+K +EF + ++Y+     E 
Sbjct: 306  ---------HISKVTNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAEC 356

Query: 370  SNGSDSTNTVNGNNTNHKGILGLLSKWKLNH-------QRKPTVNPVQNPPRVENLIKYV 422
            S    +       N  ++ + GLLSKW++NH        R  TV P      ++NLIKYV
Sbjct: 357  SREPSAQKKPRSPN-GYRAVTGLLSKWRMNHLSRHKACDRTSTVEPA-----MDNLIKYV 410

Query: 423  FSISSLDNHANPLPDSLS---SMFDILSARTIDEVEYLVSVESDXXXXXXXXXXXXXISK 479
            FSISSL++    + +      S FDILSARTI+EVE+L++VE++             I+ 
Sbjct: 411  FSISSLESPKGDIQEEREISPSKFDILSARTIEEVEHLITVENEVLQKVTAHEGKVPITS 470

Query: 480  LETNE------------------DESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRTN 521
                E                     Q+YSVIDNLNLY+TVS+IA SVI L++T + R  
Sbjct: 471  SSAREARFPPLLNEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLTRTASQRQT 530

Query: 522  KSTTHLLS------PSTSALERKNIRNSAPMLYS-------YNNSRYSITNALMGLPNTN 568
            K T            S SA    + R    ML S       Y NS+ S+   L  L + +
Sbjct: 531  KVTLPPPPPLRQRPTSLSAFRGSSSR----MLLSDSLRRDGYQNSKASL--HLRPLASAD 584

Query: 569  DN--------SSPKRLVFHDPTR-NSPTKKAILANNLNNIGE---------YNGERDSIT 610
            +N        S+P +++FH      +PT K   A  + +             +    S  
Sbjct: 585  ENAEGSSVQASNPPQVIFHTHALIKTPTDKVFDAKAVEDTSPKTSLVSTQVTDARPPSYE 644

Query: 611  SIVTYDSAFSDIS----SSGNILSQHKGSSNIFMESAPTLKRKLNVNDLRRFNFEKSDS- 665
            S +TYDS   DI+    ++ N    H   +     + P L RK N ++LR F FE S S 
Sbjct: 645  STITYDSDLQDITMRDYNTSNQTENHNDGT--LDTNQPILNRKTNHSNLREFLFEASTSG 702

Query: 666  ----------TDDR-----SCSPQNREATETSATSMESDANDN--AIQDEYENENED--- 705
                      TD+      +C    R  +E   T M S+  D     + E+  ++ D   
Sbjct: 703  SPAAHTTQEPTDESTGRLGACPTVMRSISEPIPTVMRSNNGDTHTKAKPEFNIQSHDDTF 762

Query: 706  -----IASLITAYEESTSEIDTQCQNN--AQIRRPTSGRISITRNYSVASPNSLRSILPK 758
                   SL++         DT  + N  A I  P +    +T+N SV+  +   SI+ K
Sbjct: 763  SRKPMRPSLLSPPINIRGSFDTLHRKNVPAPISVPPN---PVTKNASVSPASGRISIIKK 819

Query: 759  S----------PLILGNEVFIERDKALAANQDIIXXXXXXXXXXXNDNDRKF----TVSR 804
            S          PL+     F+E+  + A  +  +            +ND +     T  R
Sbjct: 820  SGNRTSPTTRSPLLDTTSAFMEKTDSFAKQEASLNAL---------ENDLQAILITTGRR 870

Query: 805  GSVCNDSDSQS-ISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPTPVLCKQPISKLS 863
             S  + S + S I+TN+L  S Q SPQK      ++ ++ S       P+          
Sbjct: 871  SSTFSKSGTDSTIATNVLLESIQTSPQKNTHLMTNISEDDSASNTDTKPM---------- 920

Query: 864  ETPSIKSIGSRDSE-----------ESFDLTSIASKPNRAQSTTLREKYHLEKQATNDIF 912
                  S+G   S            E  + +S +  P   Q TT+ ++Y   + A+    
Sbjct: 921  ---EFSSVGIESSASNSSSFADALCEPANRSSPSHNPYSGQCTTIEDRYRRSRFASQP-- 975

Query: 913  EEDVENLNPENNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQT---SLDEEEIAT 969
            +  +  +N   NKY+FSP   + D ASP+K+++ LK +F+  +T E     S ++ ++A 
Sbjct: 976  DSLLGYINENGNKYIFSPGETAED-ASPKKDMETLKTKFM--TTKEPPVCPSGNDADLAL 1032

Query: 970  QDNENKDHGIDKKKLE-----DIMNGIDDTA------DTSMDPVNLALMKLEGTYDKGEK 1018
              ++ K+     +++E     D  N +   A      + S DPV +ALMKLEGT+ K  K
Sbjct: 1033 IISKLKETNPSAERIETENPNDDANNLTPPATSSSNNENSSDPVAVALMKLEGTFAKPAK 1092

Query: 1019 EIDDKSPSINSE----LAREVENFQIVQTAALPESA--RKRQSMFIQRRRNTMID-FSVR 1071
            E D+ +  +NS     LA+EVE     Q    P S    KRQSMFI+RRR TM D FS  
Sbjct: 1093 E-DNTASKLNSPRSSVLAKEVEKLDF-QKWRFPSSKTMNKRQSMFIERRR-TMTDIFSSA 1149

Query: 1072 DSLIDKDSSCTRLENTDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQLTL 1131
                  +    +L  +D +IR LL  Y L D RL I N+E H+PFILMYDS S+A Q+TL
Sbjct: 1150 TEDTSSEEQSPKL--SDREIRELLETYKLQDPRLNIKNVEHHVPFILMYDSCSIAKQMTL 1207

Query: 1132 IEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWIISEI 1191
            IE+E+++E+DWKDLLDL M + LP+ TSWLQLL+ NE LSGIDLAIARFNLTVDWIISE+
Sbjct: 1208 IEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLLLHNEELSGIDLAIARFNLTVDWIISEL 1267

Query: 1192 VMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLL 1251
            VMT DI+LRRN IQR IH+AEHC+  QNYNT+MEI+LALNS+VVQKFT +WRL+EP D+L
Sbjct: 1268 VMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVMEIVLALNSVVVQKFTSSWRLIEPADML 1327

Query: 1252 TWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEVLNY 1311
            TWE LK+IPSL++NY N+R L++ ++P+ GCIPF+VVYLSDL+LN EKR WIV +E++NY
Sbjct: 1328 TWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIPFLVVYLSDLALNSEKRDWIVPNEIVNY 1387

Query: 1312 NKFQTNVQIVKNFVQKMQWSKFYNIDIDHELLSK 1345
            NKFQTNVQIVKNF+Q++QW++FY+I  D +LLSK
Sbjct: 1388 NKFQTNVQIVKNFIQRVQWARFYDIRADEDLLSK 1421

>Scas_505.3
          Length = 1364

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1425 (38%), Positives = 796/1425 (55%), Gaps = 183/1425 (12%)

Query: 15   LFSRPELYPVPSESVLTV-DLRDGTVR--ILKCTLPALLVQLSSPLDKVDYSMLTDFFLV 71
            +FS  + YPVPS SV+T  + R   +R  + K  + AL+  LSSP+D VDY++ +DFFL+
Sbjct: 10   IFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDYTIFSDFFLI 69

Query: 72   YRNFMSSQKLLDLIQERFQWAI--DLRQSDPSSQEKITSEVILVRMFVLVRHWLSNYFAQ 129
            YR+F+S  +L +L+  RF+W I   L   +   +++   EV L+R FVL+RH + NYF Q
Sbjct: 70   YRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLRHSILNYFVQ 129

Query: 130  DFVVDTSLRRQFLQFING--YSPVDRFLDNIIISLKKLWVQNVQIMWEDLENLIVENNVV 187
            DF+ D+ LR   L F+N   Y    R +   I++LK+ W+ + +  WE++     E + V
Sbjct: 130  DFLPDSHLRYMLLNFLNDNVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIP--FNEPSSV 187

Query: 188  SRDDWLKWEIEDVPXXXXXXXXXXXXXXXRLSFIALQNINNPVLRNESLLSLLHTREKIP 247
              ++WL +EI+DV                RLS  A+Q  ++P  RN S+LSL ++ +   
Sbjct: 188  DFNEWLLFEIKDV-----IQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDNFK 242

Query: 248  LPQQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREITDP 307
            LP+  +      S R KQ T SM+L+P + SN   I          P    K+  +IT  
Sbjct: 243  LPESLD----FNSNRTKQ-TASMMLYPNDNSNIPKI----------PIPKGKEPLKITLI 287

Query: 308  KNSKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYMETD-- 365
             ++K++   +  LS++ ++S ++KD++YP++P+++  +PPTPAK +EFIL + Y+  D  
Sbjct: 288  NDNKNDIRKISHLSKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDND 347

Query: 366  -LPEQSNGSDSTNTVNGNNTNHKGILGLLSKWKLNHQR-------KPTVNPVQNP---PR 414
               E +    ST     ++   +G +GLL++WK NH R       K T + V  P   P 
Sbjct: 348  ETIEDNPRVKSTPPPIQSSLLQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPD 407

Query: 415  VENLIKYVFSISSLDN---HA-NPLPDSLSSMFDILSARTIDEVEYLVSVESDXXXXXXX 470
            ++N +KYV SI+SL+N   HA   + D ++S FDILSARTIDEVEYL+S+E++       
Sbjct: 408  MDNFVKYVISITSLENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRG 467

Query: 471  XX----------XXXXISKLETNEDESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRT 520
                                E  +D + ++S +DNL+LYKTVSS+A SVISLS TLN  T
Sbjct: 468  QANLNNNNLKSIGLENTMPFEPPKD-TANFSAMDNLDLYKTVSSLAQSVISLSNTLNKST 526

Query: 521  NKSTTHLLSPSTSALERKNIRNSAPMLYSY--NNSRYSITNALM--GLPNTNDNSSPKRL 576
                 +  SPS SALER+ + +S P L     ++S+  I + L+    P    N  P+RL
Sbjct: 527  KLKIVN--SPSLSALERRMVMSSFPALNGKVSSSSKIGIEDELVINITPPRAKNDGPQRL 584

Query: 577  VFHDPTRN-----SPTK---------KAILANNLNNIGEYN------GERDSITSIVTYD 616
            VFHD         +PTK          + L N L N+ E +       + +S  S ++YD
Sbjct: 585  VFHDDGSTLSLPQTPTKSNRKSNIRHSSPLKNVLPNLNEVDLSDSVCSDDESFVSTISYD 644

Query: 617  SAFSDISSSGNILSQHKGSSN--IFMESAPTLKRKLNVNDLRRFNFEKSD-STDDRSCSP 673
            S  S  S       +    S    F     TLK+K    +LR F FE S  S    + S 
Sbjct: 645  SLLSSKSFKHKSSRRSNLYSRPLTFKNEEQTLKKKTASKNLREFTFETSKLSLPSPTKSQ 704

Query: 674  QNREATETSATSMESDANDNAIQDEYENENEDIASLITAYEESTSEIDTQCQNNAQIRRP 733
             + +AT        +     +  D  + E ED  S +      T+             RP
Sbjct: 705  GSPKATHIRQQHHLTPPVSLSPTDPLKMEAEDHLSPLNKLTPQTA------------IRP 752

Query: 734  TSGRISITRNYSVASPNSLRSILPKSPL--ILGNEVFIERDKALAANQDIIXXXXXXXXX 791
             SGRISI R  S++   + R+     P   +L +  FI+++++L  ++  +         
Sbjct: 753  ASGRISILRK-SLSITQARRNTYAGPPKADLLRDPDFIKKERSLIESEHQLQELQDDL-- 809

Query: 792  XXNDNDRKFTVSRGSVCNDSDSQSISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPT 851
                      + R S+       S++T+ LF+S + SP+K V  E  V            
Sbjct: 810  ----------LERTSL-----QSSVATDNLFNSRKNSPKK-VTAENKV------------ 841

Query: 852  PVLCKQPISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTT-----LREKYH---L 903
                     +LS TPSI SI    S  S + +      +  Q T      LRE +H   +
Sbjct: 842  ---------RLSTTPSIYSILDDSSLSSGNTSYNDPARDSMQFTNDKRIDLREVFHNGSV 892

Query: 904  EKQATNDIFEEDVENL--------NPENNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQS 955
            +   +ND+  + +  L        N  +NKYLFSP+ D+ D  SP K+++ LK +F+   
Sbjct: 893  QNVISNDLSSDAISGLSELKDNGINGVSNKYLFSPEEDNTDLISPGKDVEVLKNKFLKNE 952

Query: 956  TDEQTSLDEEEIATQDNENKDHG------IDKKKLEDIMNGIDDTADTSMDPVNLALMKL 1009
            T E+ S   E I     E  D G      +DK+KL+DI +  DDT   S DP+++A+MKL
Sbjct: 953  TFEEES---ESIIDGIQEASDEGAMPNVDLDKEKLKDIADIPDDTG--SGDPISIAMMKL 1007

Query: 1010 EGTY---DKGEKEIDDKSPSINSELAREVENFQIVQTAALPESA-RKRQSMFIQRRRNTM 1065
            EGTY   D   K  +D S     +L +EVE   + +    P+S   KR+S+ I+RRR T+
Sbjct: 1008 EGTYKTNDDDNKTHEDSSSV--QDLIKEVEMLNLKKLPTFPKSPLEKRKSLMIERRRQTI 1065

Query: 1066 --IDFSVRDS---LIDKDSSCTRLENTDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMY 1120
              I F+ ++S   L  +D   + L     Q++ L+  Y + DS L+I N E HIPFILMY
Sbjct: 1066 MNIPFTPQNSEEGLAIEDKCVSPL-----QVQTLVMNYEVQDSSLQISNNEHHIPFILMY 1120

Query: 1121 DSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARF 1180
            DSKS+A Q+TLIEKE+LSE+DWKDLL+L +  +    TSWLQLL+QNE LSG+DLAIARF
Sbjct: 1121 DSKSIAEQMTLIEKELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARF 1180

Query: 1181 NLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTE 1240
            NLTVDWI+SEI +T+D+++RRNTIQRFIH+A++C+E QNYNTLMEIILAL+SIVVQKFT+
Sbjct: 1181 NLTVDWIVSEITLTRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTD 1240

Query: 1241 TWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKR 1300
             WRL+EPGD+L WE LK IPSL++NYS IR L++ ++P  GCIPFIVVYLSDLSLN EKR
Sbjct: 1241 AWRLIEPGDMLLWEELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKR 1300

Query: 1301 TWIVHDEVLNYNKFQTNVQIVKNFVQKMQWSKFYNIDIDHELLSK 1345
             WIV  +V+NY+KF+T+VQIVKNF+Q++QW+KFYNI++DHELLSK
Sbjct: 1301 NWIVDRKVVNYHKFETSVQIVKNFIQRVQWAKFYNIEVDHELLSK 1345

>YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exchange
            factor, required for termination of M phase [4308 bp,
            1435 aa]
          Length = 1435

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1482 (37%), Positives = 805/1482 (54%), Gaps = 217/1482 (14%)

Query: 15   LFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFLVYRN 74
            +FS+ + YP PS +V++ +    +  +    LPAL+V LSSPL+ VDY+   DFFL+YRN
Sbjct: 3    IFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIYRN 62

Query: 75   FMSSQKLLDLIQERFQWAI-DLRQSDPSSQEKITSEVILVRMFVLVRHWLSNYFAQDFVV 133
            F++ Q L DL+  RF+W I ++  +   ++ +   EV LVR FVL+RH + NYF QDF+ 
Sbjct: 63   FITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDFLP 122

Query: 134  DTSLRRQFLQFIN--GYSPVDRFLDNIIISLKKLWVQNVQIMWEDLENLIVENNVVSRDD 191
            + +LR + ++F+N        + + + II+LKK WV   +++WE++E  + E + +  D 
Sbjct: 123  NITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIE--LNEPDKLDFDA 180

Query: 192  WLKWEIEDVPXXXXXXXXXXXXXXXRLSFIALQNINNPVLRNESLLSLLHTREKIPLPQ- 250
            WL + ++D                 RLS  A Q+  +P  RN+S+LSL  T +   LP+ 
Sbjct: 181  WLHYSLKDF-----TQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEK 235

Query: 251  -QSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREITDPKN 309
             QS + SK       QR+ SMLLFP+N SN  S +       ++ E +   E E     +
Sbjct: 236  LQSSNSSK------NQRSPSMLLFPDNTSNVYSKHR------IAKEPSVDNESE-----D 278

Query: 310  SKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYMETDLPEQ 369
              D+K  +  LS+VT VS +MK ++YPS+ +VD  +PPTPAK +EFIL + Y+  DL EQ
Sbjct: 279  MSDSKQKISHLSKVTLVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEQ 338

Query: 370  SNGSDSTNTVNGNNTN---------------HKGILGLLSKWKLNHQRKPTVN------- 407
            S     T+T +  + N               H+  +GLL+KW  NH R  + N       
Sbjct: 339  SGTLQGTSTTSSLDNNSNSNSRSNTSSMSVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSA 398

Query: 408  --PVQNPPRVENLIKYVFSISSLDN-----HANPLPDSLSSMFDILSARTIDEVEYLVSV 460
              P    P ++  +KYV SISSL+            +S SS FDILSARTIDEVE L+ +
Sbjct: 399  IKPANQKPEMDAFVKYVVSISSLNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHL 458

Query: 461  ESDXXXXXXXXX----------------XXXXISKLETN--EDESQDYSVIDNLNLYKTV 502
            ++                              I  L+ N  +  + ++S +DNL+LY+TV
Sbjct: 459  QNQLIEKVQTHSNNNRGPTVNVDCERREHIHDIKILQQNSFKPSNDNFSAMDNLDLYQTV 518

Query: 503  SSIANSVISLSKTLNVRTNKSTTHLL-SPSTSALERKNIRNSAPMLYSYNNSRYSITNA- 560
            SSIA SVISL+ TLN +   + +++  SPS  AL+R+ +++     Y+  +  YS  +  
Sbjct: 519  SSIAQSVISLTNTLNKQLQNNESNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMR 578

Query: 561  LMGLPNTN---DNSSPKRLVFHD-------------PTR--NSPTKKAILANNLNNI--- 599
            L    N++   D + P+RL+FH+             P R  +S ++K++ ++ L N+   
Sbjct: 579  LFDKDNSSSRTDENGPQRLLFHETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPD 638

Query: 600  ----GEYNGERDSITSIVTYDSAFSDISSS---GNILSQHKGSSNIFMES-APTLKRKLN 651
                   N  R+   SI TY       SSS     +  + +   NI   + +PTLK K  
Sbjct: 639  LKESSPLNDSREDTESI-TYSYDSELSSSSPPRDTVTKKSRKVRNIVNNTDSPTLKTKTG 697

Query: 652  VNDLRRFNFEKSDSTDDRSCSPQNREATETSATSMESDANDNAIQDEYENENE-----DI 706
              +LR F FE + S D++  +    E    +  + ES         EYE+  +     D 
Sbjct: 698  FLNLREFTFEDTKSLDEKKSTIDGLEKNYDNKENQES---------EYESTKKLDNSLDA 748

Query: 707  ASLITAYEESTSEIDTQCQNNAQ--IRRPTSGRISITRNYSVASPNSLRSILPKSPLILG 764
            +S    Y+ +T +  + C +  +  + RP SGRISI+R  S+A       I P   L + 
Sbjct: 749  SSEANNYDITTRKKHSSCNHKIKQAVVRPASGRISISRVQSIA-------ITPTKELSI- 800

Query: 765  NEVFIERDKALAANQDIIXXXXXXXXXXXNDNDRKFTVSRGSVCNDSDSQSISTNL--LF 822
              V  E++K+ +  ++I                      + ++ +D+ S  IS +   LF
Sbjct: 801  --VDPEQNKSNSVIEEISEIEPLNLEYN----------KKSALYSDTSSTVISISTSKLF 848

Query: 823  SSAQASPQKLVIKEVDVIQEKSEHPDVPTPVLCKQPIS-KLSETPSIK-------SIGSR 874
             SAQ SP K         Q ++   + P      +    +LS  P+I+       SI + 
Sbjct: 849  ESAQNSPLK---------QTQNPQREFPNGTSVSETNRIRLSIAPTIESVVSDLNSITTG 899

Query: 875  DSEESFDLTSIASKPNRAQSTTLREKYHLEKQ----ATNDIFEEDVENLNPENN------ 924
             + E+F+ +     P++ +   LRE+Y    Q     T+ + E    +L+  NN      
Sbjct: 900  STVETFETSRDLPVPHQ-RIINLREEYQRGNQDIISNTSSLHELKTIDLSDSNNDLESPS 958

Query: 925  ------KYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQTSLDEEEIATQDNENKD-- 976
                  KY FSPD  SID ASP KN+++LK +F+   ++  +++    +   D +  D  
Sbjct: 959  THAKNNKYFFSPDDGSIDVASPMKNVEELKSKFLKNESETNSNISGSVLTMDDIDINDTS 1018

Query: 977  ---------------HGIDKKKLEDIMNGIDDTADTSMDPVNLALMKLEGTYDK-GEKEI 1020
                             ++KK L +I N +DD+ +   DP+ +ALMKLEGTY+K  EK  
Sbjct: 1019 SARNTRRANSESAFTGSLNKKNLNEIANMLDDSIND--DPITVALMKLEGTYEKIPEKPE 1076

Query: 1021 DDKSPSI----NSELAREVENFQIVQTAALPES-ARKRQSMFIQRRRNTMIDFSVRDSLI 1075
            + KS        S+LA EVE   +    +   S A KR+S+ I+RRR T+++        
Sbjct: 1077 NTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRRQTIMNIPFTPDQS 1136

Query: 1076 DKD----SSCTRLE---NTD-----EQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSK 1123
            +K+    SS  +++   N D      QI+ L+ QY + DSRL I N E H+PFILMYDS 
Sbjct: 1137 EKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILMYDSL 1196

Query: 1124 SVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLT 1183
            SVA Q+TLIEKEIL E+DWKDLLDL M  + PQ  SWLQLLV+NE LSGIDLAI+RFNLT
Sbjct: 1197 SVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNLT 1256

Query: 1184 VDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWR 1243
            VDWIISEI++T+  +++RN IQRFIH+A+HC+  QN+NTLMEIILAL+S VVQKFT+ WR
Sbjct: 1257 VDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDAWR 1316

Query: 1244 LVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWI 1303
            L+EPGDLLTWE LK IPSL++NYS IR L++ V PL GC+PFIVVYLSDLS N EK+ WI
Sbjct: 1317 LIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEKKDWI 1376

Query: 1304 VHDEVLNYNKFQTNVQIVKNFVQKMQWSKFYNIDIDHELLSK 1345
            + D+V+NYNKF TNVQIVKNF+Q++QWSKFY   ++HELLSK
Sbjct: 1377 LEDKVVNYNKFDTNVQIVKNFIQRVQWSKFYTFKVNHELLSK 1418

>CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces
            cerevisiae YAL024c LTE1, start by similarity
          Length = 1318

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1417 (35%), Positives = 753/1417 (53%), Gaps = 208/1417 (14%)

Query: 15   LFSRPELYPVPSESVL----TVDLRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFL 70
            +FS+ + YP+PS+ V+     V  +     +++  +P+++V LSSP+D VDY   +DFFL
Sbjct: 3    IFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDFFL 62

Query: 71   VYRNFMSSQKLLDLIQERFQWA---IDLRQSDPSSQEKI-TSEVILVRMFVLVRHWLSNY 126
             YRNF++  +L D +  RF+W    I+  Q   S   ++   +V L+R FVL+RH + N+
Sbjct: 63   FYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGILNH 122

Query: 127  FAQDFVVDTSLRRQFLQFINGYSPVD-RFLDNIIISLKKLWVQNVQIMWEDLENLIVENN 185
            FA DF+++ +LR + + F N     D + + + +ISLKK W+  +++ W+++  L  E  
Sbjct: 123  FADDFLLNENLRLRLISFFNEDIKSDMKVIVSCLISLKKAWLHAMKLNWDNV--LFNEPA 180

Query: 186  VVSRDDWLKWEIEDVPXXXXXXXXXXXXXXXRLSFIALQNINNPVLRNESLLSLLHTREK 245
              +  DW+ ++I+DV                R S+  +Q+I+NP +RN S+LS+  +   
Sbjct: 181  FSAYTDWIDYKIKDV-----SQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKSDN- 234

Query: 246  IPLPQQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREIT 305
                   +  S K S   + RT S LLF +++SN          + V       Q++ I 
Sbjct: 235  --FDHMVQSNSNKIS---RNRTPSTLLFQKDSSNS-------EMATVYSNRKGAQKKTIA 282

Query: 306  DPK---NSKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYM 362
             P    +  D K +   +S VT +S++++D +   +  V+  +P TPAK +E IL T Y 
Sbjct: 283  LPNILTSELDRKDV---MSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIY- 338

Query: 363  ETDLPEQSNGSDSTN--TVNGNNTNHKGILGLLSKWKLNHQ------RKPTVNPVQNPPR 414
              D  E  N  +S N  T +   +  KGI+ LL++WK NH+      RKP     +    
Sbjct: 339  SPDCLESENIQESLNQDTSSTQKSFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAE 398

Query: 415  VENLIKYVFSISSLDNHANPLP---DSLSSMFDILSARTIDEVEYLVSVESD-XXXXXXX 470
            ++N +KYV SISSL N    L    ++L S FDILSARTIDEVEYL  +ES         
Sbjct: 399  LDNFVKYVISISSLTNKEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTM 458

Query: 471  XXXXXXISKLETNED------ESQDYSVIDNLNLYKTVSSIANSVISLSKTLNVRTNKST 524
                  +S  E N+       +S+  S +DNL+L++TV+ +A SVISL+ ++N + N  +
Sbjct: 459  QKTTRTLSNDEFNDVNVPNNIDSKQISAMDNLDLFRTVNGVARSVISLTNSVN-KLNNLS 517

Query: 525  THLLSPSTSALERKNIRNSAPMLYSYNNSRYSITNALMGLPNTNDNS-------SPKRLV 577
             H      S L+R+ +++S P  Y+   S   ++N   GL   + +S        P++LV
Sbjct: 518  DH------SVLDRRRVKSSMPNFYNRERSLSGLSN-YAGLQFYDASSEMSAEDDKPQKLV 570

Query: 578  FHDP------------------TRNSPTKKAILANNLNNIGEYNGERDSITSIVTYDSAF 619
            FHD                   + +SP KK +L N   +    +       S VTYDS  
Sbjct: 571  FHDGVDELKNHLTQTFTKPGSISNSSPLKK-VLPNLFEHPSVDSLASGDACSYVTYDSQL 629

Query: 620  SDISSSGNILSQHKGSSNIFME-SAPTLKRKLNVNDLRRFNFEKSDSTDDRSCSP----Q 674
            S +   G +    K  ++ +     P LK+K+  ++LR F FE S        S      
Sbjct: 630  SQM---GTVKKSMKDETSRYSNYEGPVLKKKVAYDNLREFTFEDSKEIIKNDTSSLIDIL 686

Query: 675  NREATETSATSMESDANDNAIQDEYENENEDIASLITAYEESTSEIDTQCQNNAQIRRPT 734
            N   T   +   ++     ++Q + + ++E I S                        P 
Sbjct: 687  NSPVTPDLSILPQTPTGKGSVQHKKKEKSESIIS------------------------PA 722

Query: 735  SGRISITRNYSVA-SPNSLRSILPKSPLILGNEVFIERDKALAANQDIIXXXXXXXXXXX 793
            SGRISI +++ ++ SPN  +        +  ++ +++ D +L   +D +           
Sbjct: 723  SGRISIAKSHHMSLSPNLTK--------LKEDDEYVKGDNSLGQAEDEL------IRLEK 768

Query: 794  NDNDRKFTVSRGSVCNDSDSQSISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPTPV 853
            N  D K          ++ +  ++ NL   S  ++P                  D PT V
Sbjct: 769  NLRDSKL---------ENYNTVVAGNLGAGSGSSTPLG----------------DSPTNV 803

Query: 854  LCKQPISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTTLREKYHL---------- 903
                      E PS  SI   +S+   D  S  S   + Q T LRE+Y            
Sbjct: 804  F---------ELPS--SINMVESD--MDTESFESSFEQRQPTNLREQYFKSIGSPETASP 850

Query: 904  EKQATNDIFEEDVENLNPE-NNKYLFSPDTDSIDFASPEKNLDDLKQQFID------QST 956
             K  +N+ + +    ++P   NKYLFSPD +S+D ASP KN++DLK +F+        S+
Sbjct: 851  RKVNSNNAYSQVSSQMSPSLANKYLFSPDNESLDIASPVKNVEDLKSRFLKGNNQSASSS 910

Query: 957  DEQTSLDEEEIAT-QDNENKDHGIDKKKLEDIMNGIDDTADTSMDPVNLALMKLEGTYDK 1015
                S++    AT ++N+      DK  L++IM   ++    S DPV LA+MKLEGT+ K
Sbjct: 911  QIGASINTSVTATPKNNDMFGSDFDKNGLKNIMTASEEK--LSKDPVELAMMKLEGTFKK 968

Query: 1016 GEKEIDDKSPSINSELAREVENFQIVQTAALPE----SARKRQSMFIQRRRNTMIDFSVR 1071
             +      +   +S+L +EV+   I+  A LPE     + KR+S+ + RRR TM  F++ 
Sbjct: 969  NKS---GNNTGYSSDLEKEVD---ILNIANLPEMNANPSDKRKSLMLDRRRQTM--FNIG 1020

Query: 1072 DSLIDKDSSCTRLEN---TDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQ 1128
             S+   +++    +    TD++I +L+ QY + D  L   N   H+PFILMY+SK VA Q
Sbjct: 1021 PSIYPSNTNDEGYDEESITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQ 1080

Query: 1129 LTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWII 1188
             TLIE+EILSE+DWKDLLD+ +  + P  TSWLQLL+QN+  +GIDLA+ARFNLTVDW I
Sbjct: 1081 FTLIEREILSEIDWKDLLDIKLLYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAI 1140

Query: 1189 SEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPG 1248
            SEIV+T D+++RRNTI+RFIH+AEHC++LQN+NT+M+IILALNS+VVQKFTE WRL+EPG
Sbjct: 1141 SEIVLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPG 1200

Query: 1249 DLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEV 1308
            D+L WE L+ IP+L+ NY  +R ++  V+PL GCIPFIVVYLSDL++N EK TWIV   V
Sbjct: 1201 DMLLWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRV 1260

Query: 1309 LNYNKFQTNVQIVKNFVQKMQWSKFYNIDIDHELLSK 1345
            +NY+KF T VQIVKNF+QK+QWS FY+I    ELLSK
Sbjct: 1261 VNYSKFSTCVQIVKNFIQKVQWSSFYDIIPIQELLSK 1297

>YLR310C (CDC25) [3699] chr12 complement(752226..756995)
            Guanine-nucleotide exchange protein for Ras1p and Ras2p,
            has an SH3 domain [4770 bp, 1589 aa]
          Length = 1589

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 109/223 (48%), Gaps = 33/223 (14%)

Query: 1117 ILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLA 1176
            +L  D  + A QLT++E ++         L +TM E L +  +W            I   
Sbjct: 1301 LLDIDPYTYATQLTVLEHDLY--------LRITMFECLDR--AWGTKYCNMGGSPNITKF 1350

Query: 1177 IARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQ 1236
            IA  N   +++   IV   D++ R    Q F+ +A+HCKEL N++++  I+ AL S  + 
Sbjct: 1351 IANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSALYSSPIY 1410

Query: 1237 KFTETWRLV--EPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLS 1294
            +  +TW LV  E  DLL  + L  +   ++N+   R+L+  V  ++ C+PF  VYLSDL+
Sbjct: 1411 RLKKTWDLVSTESKDLL--KNLNNLMDSKRNFVKYRELLRSVTDVA-CVPFFGVYLSDLT 1467

Query: 1295 ----------------LNIEKRTWIVH--DEVLNYNKFQTNVQ 1319
                            +N  KRT I +  +E++++ +F   ++
Sbjct: 1468 FTFVGNPDFLHNSTNIINFSKRTKIANIVEEIISFKRFHYKLK 1510

>CAGL0E03476g complement(318956..323650) similar to sp|P04821
            Saccharomyces cerevisiae YLR310c CDC25 GDP/GTP exchange
            factor for RAS1P and RAS2P, start by similarity
          Length = 1564

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 102/212 (48%), Gaps = 29/212 (13%)

Query: 1126 ANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVD 1185
            A QLTLIE ++         L +TM E L +  +W            I   IA  N   +
Sbjct: 1284 AAQLTLIEHDLY--------LRITMFECLDR--AWGNKYCDMGGSPNITRFIANANSLTN 1333

Query: 1186 WIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLV 1245
            ++   IV   D++ R   IQ FI +A+HCKEL N++++  I+ AL S  + +  +TW LV
Sbjct: 1334 YVSFTIVKHADVQKRAKLIQYFITVAQHCKELNNFSSMTAIVSALYSSPIYRLKQTWNLV 1393

Query: 1246 EPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLS----------- 1294
                    + L ++   ++N+   R+L+  V+ ++ C+PF  VYLSDL+           
Sbjct: 1394 PTETKEVLDNLNSLMDSKRNFIKYRELLRSVKDVA-CVPFFGVYLSDLTFTFAGNSDYLD 1452

Query: 1295 -----LNIEKRTWIVH--DEVLNYNKFQTNVQ 1319
                 +N  KR+ I +  + +L + KF   ++
Sbjct: 1453 GKTDIINFGKRSKIANIIEGILTFKKFHYKLK 1484

>Kwal_14.2313
          Length = 1517

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 101/208 (48%), Gaps = 13/208 (6%)

Query: 1117 ILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLA 1176
            +L  D ++ A QLT  E  + S++     LD   S++   F         +E++S     
Sbjct: 1234 LLDIDPQTFARQLTTKEHYLYSKITPFQCLDRIWSKKYCYFGG-------SEDISKF--- 1283

Query: 1177 IARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQ 1236
            I+  N   +++   IV   + + R    Q FI +AEHC EL N++++  I+ AL S  + 
Sbjct: 1284 ISSANSLTNYVSFAIVKQTNTKKRARVTQHFISVAEHCYELNNFSSMTAIVSALYSSPIF 1343

Query: 1237 KFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLN 1296
            +  ++W LV        E L  +    KN++  R  +  ++  + C+PF  VYLSDL+  
Sbjct: 1344 RLKKSWALVPEESQKVLENLNTLMDPAKNFATYRNWLKTIQD-TACVPFFGVYLSDLTFI 1402

Query: 1297 IEKRTWIVH--DEVLNYNKFQTNVQIVK 1322
             E     +H   E++N++K    V+I+K
Sbjct: 1403 AEGNPNYLHRSSEIINFSKRVRIVEILK 1430

>Sklu_2189.4 YLR310C, Contig c2189 8340-12920
          Length = 1526

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 91/208 (43%), Gaps = 13/208 (6%)

Query: 1117 ILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLA 1176
            +L  DS   A QLT+ E  +  ++   + LD T          W            I   
Sbjct: 1239 LLDIDSLDYAKQLTIKEHSLFYKISPFECLDRT----------WGNKYCNMGGSKNITEF 1288

Query: 1177 IARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQ 1236
            I+  N   +++   IV   DI+ R   IQ FI++A HC EL N+++L  II AL S  + 
Sbjct: 1289 ISNSNHLTNYVSFMIVKQTDIKKRIQLIQFFINVAAHCHELNNFSSLTAIISALYSSPIY 1348

Query: 1237 KFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLN 1296
            +   TW  V        E L  +    KN+   RQL+  +     C+PF  VYLSDL+  
Sbjct: 1349 RLKRTWAAVPEEYKKLLEELNTLMDSAKNFIRYRQLLKSIGDFP-CVPFFGVYLSDLTFT 1407

Query: 1297 IEKRTWIVHDE--VLNYNKFQTNVQIVK 1322
                   +H    ++N+ K    ++I+K
Sbjct: 1408 ANGNPDFLHRNTVLVNFGKRVRILEILK 1435

>YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown
            function [3147 bp, 1048 aa]
          Length = 1048

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 102/221 (46%), Gaps = 23/221 (10%)

Query: 1117 ILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLS-GIDL 1175
            IL  D    A QLT++E EI  E+   D L             W     ++   S G++ 
Sbjct: 744  ILAVDPVLFATQLTILEHEIYCEITIFDCLQ----------KIWKNKYTKSYGASPGLNE 793

Query: 1176 AIARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVV 1235
             I+  N   ++I   +V   D   R   +  FI IAE+C++  N++++  II AL S  +
Sbjct: 794  FISFANKLTNFISYSVVKEADKSKRAKLLSHFIFIAEYCRKFNNFSSMTAIISALYSSPI 853

Query: 1236 QKFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLS- 1294
             +  +TW+ V P      ++L  +   +KN+ N R  +  +   + C+PF  VYLSDL+ 
Sbjct: 854  YRLEKTWQAVIPQTRDLLQSLNKLMDPKKNFINYRNELKSLHS-APCVPFFGVYLSDLTF 912

Query: 1295 --------LNIEKRTWIVHDE--VLNYNKFQTNVQIVKNFV 1325
                    L +E     VHDE   +N+NK    V I++  +
Sbjct: 913  TDSGNPDYLVLEHGLKGVHDEKKYINFNKRSRLVDILQEII 953

>Scas_621.1*
          Length = 1323

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 94/210 (44%), Gaps = 29/210 (13%)

Query: 1124 SVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLT 1183
            ++A QL+L+E E+  ++   + L+    ++   F               I + I   N  
Sbjct: 1086 TMAQQLSLLEHELYCQITIFECLERVWGKKYGGFGG----------SPNITIFINGANNL 1135

Query: 1184 VDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWR 1243
             +++   IV   +I  R   I  FI +A++C+++ N++++  II AL S  V +  +TW 
Sbjct: 1136 TNFVSYTIVSNANISRRIQIITYFIAVAQYCRDINNFSSMTAIISALYSSPVYRLKKTWH 1195

Query: 1244 LVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLS--------- 1294
            LV          L  +    KN+   RQL+  V  +  C+PF  VYLSDL+         
Sbjct: 1196 LVPESSKALLRELNTLMDSTKNFIRYRQLLKSVRQVV-CVPFFGVYLSDLTFAHTGNPDF 1254

Query: 1295 -------LNIEKRTWIVH--DEVLNYNKFQ 1315
                   +N  KR  +V   +EV+N+ K  
Sbjct: 1255 LSGSTELINFSKRAKVVEIIEEVINFKKLH 1284

>Scas_604.15
          Length = 1676

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 101/211 (47%), Gaps = 13/211 (6%)

Query: 1117 ILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLA 1176
            +L  D    A QLT+ E E+         L++TM E L +  +W            I   
Sbjct: 1365 LLDIDPYVYAQQLTIREHELY--------LEITMFECLDR--AWGSKYCNMGGSRNISKF 1414

Query: 1177 IARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQ 1236
            I   N   +++   IV   D++ R   IQ FI +AEHCK+L N++++  I+ AL S  + 
Sbjct: 1415 IMNANSLTNFVSYTIVRHMDVKKRSKLIQYFITVAEHCKDLNNFSSMTAIVSALYSSPIF 1474

Query: 1237 KFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLN 1296
            +  +TW  +      + + L ++   ++N+   R+ +  V+ +   IPF  +YLSDL+  
Sbjct: 1475 RLKKTWSKIPVEIKKSLKKLNSLMDSKRNFIKYRESLKLVKDVPR-IPFFGIYLSDLTFT 1533

Query: 1297 IEKRTWIVHD--EVLNYNKFQTNVQIVKNFV 1325
                   +H   +++N++K    V I+++ +
Sbjct: 1534 FVGNPEFLHGTTDIINFSKRSRIVDIIEDIL 1564

>KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharomyces
            cerevisiae YLR310c CDC25 GDP/GTP exchange factor for
            RAS1P and RAS2P, hypothetical start
          Length = 1537

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 85/176 (48%), Gaps = 11/176 (6%)

Query: 1120 YDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIAR 1179
            +D  + A QLTL E  + S +D  + LD    +++  F         + N+S     I  
Sbjct: 1266 FDPITFAQQLTLEEHILYSAIDQFECLDRIWGKKVCDFGG-------SANISNF---ITS 1315

Query: 1180 FNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFT 1239
             N   D++   IV   D++ R   +Q FI ++E C  L+N++++  I+ AL S  + +  
Sbjct: 1316 SNHLTDFVSYTIVKETDLKKRAQILQFFIQVSEQCYNLKNFSSMTAIVSALYSSPIFRLK 1375

Query: 1240 ETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSL 1295
            +T+  +    L + + L  +    +N+   R L+  V  +  C+PF  VYLSDL+ 
Sbjct: 1376 KTFDRLPKHILNSLDKLNTLMDSTRNFFRYRDLLKTVHDVP-CVPFFGVYLSDLTF 1430

>ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W -
            SH] complement(623312..627841) [4530 bp, 1509 aa]
          Length = 1509

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 82/172 (47%), Gaps = 15/172 (8%)

Query: 1126 ANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSW--LQLLVQNENLSGIDLAIARFNLT 1183
            A QLT+ E  +  ++   + LD T   +   F     +   +QN N           +LT
Sbjct: 1237 AKQLTIKENLLYCKIHLFECLDRTWKTRYCDFGGSPNISSFIQNSN-----------HLT 1285

Query: 1184 VDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWR 1243
             +++   IV   D++ R   +Q FI +AE C+ L N++++  I  A+ S  + +   TW 
Sbjct: 1286 -NYVSYMIVKQTDLKRRVQIVQYFIDVAETCRALNNFSSMTAITSAMLSSSIYRLKRTWA 1344

Query: 1244 LVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSL 1295
            +V      + + + A+    KN+   R+L++ +     C+PF  VYLSDL+ 
Sbjct: 1345 MVHDNYKESLDRMNALMDSAKNFRKYRELLESLGDCP-CVPFFGVYLSDLTF 1395

>CAGL0D06512g complement(617453..621379) some similarities with
            sp|P04821 Saccharomyces cerevisiae YLR310c CDC25 or
            sp|P14771 Saccharomyces cerevisiae YLL016w SDC25,
            hypothetical start
          Length = 1308

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 78/177 (44%), Gaps = 11/177 (6%)

Query: 1117 ILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLA 1176
            IL   +++VA QL LIE+ +  ++   D LD     +   F         ++N+S     
Sbjct: 988  ILDIPAENVAQQLALIEENLYEKITIFDCLDRVWGCKQCDFGG-------SKNISEF--- 1037

Query: 1177 IARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQ 1236
            I+  N    ++  +I+       R   I  FI +A    E+ N++++  II  + +  V 
Sbjct: 1038 ISFANSITKYVSYKILQYDTAAKRGQAIGYFIKVARISYEINNFSSMTAIISGIYASPVN 1097

Query: 1237 KFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDL 1293
            +  E+W+LV      T   L  +    KN+   R  +  V     CIPF  VYLSDL
Sbjct: 1098 RLHESWKLVSRELQNTLRELDDLMISTKNFLKYRLTLKNVGN-RPCIPFFGVYLSDL 1153

>Kwal_33.13598
          Length = 1412

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 100/223 (44%), Gaps = 43/223 (19%)

Query: 1125 VANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSG---IDLAIARFN 1181
            VA QL+LIE  +   V   +L++                + + ++LS    ++  I   N
Sbjct: 1126 VAKQLSLIESTLYLAVGPGELMNQ-------------NFIPKKKHLSASPDVERIIDFAN 1172

Query: 1182 LTVDWIISEIVMTQ-DIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTE 1240
            L  +++I  IV ++  +++R + +  +++IA      +N+NT+  I+ AL S ++ +   
Sbjct: 1173 LLSNYVIESIVASKLTLKVRASRLTAWLNIALSALYFRNFNTVATIMTALQSHILSRVEL 1232

Query: 1241 TWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVE-----PLSG-------CIPFIVV 1288
             W  +    L  ++ L  I   +KNYS  R  + E+      P SG        +PF  +
Sbjct: 1233 VWENISEKYLELYKYLSKIIHPDKNYSIYRLKLRELATGFSIPESGGNRSPIPIVPFFAL 1292

Query: 1289 YLSDLSLNIEKRTWIVHD----------EVLNYNKFQTNVQIV 1321
            +L DL+   E     +HD          +++N +KF    +I+
Sbjct: 1293 FLQDLTFIHEG----IHDFRDPSSFRPNKLINIDKFFRTTKII 1331

>KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030
            Candida albicans, hypothetical start
          Length = 1360

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 84/185 (45%), Gaps = 24/185 (12%)

Query: 1125 VANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTV 1184
            V+ Q++LIE  I  ++   +LL    S + P        L ++ N++ I   I   NL  
Sbjct: 1076 VSKQISLIESTIFLKITPPELLKCKYSSKNPD-------LSKSPNVNSI---ITLTNLLS 1125

Query: 1185 DWIISEIVMTQ-DIRLRRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWR 1243
            ++++  I+M    ++ R   I+ ++ IA      +N+N L  I+  L S V+ + +  W 
Sbjct: 1126 NYVLESILMPGIPLKKRALRIKSWLRIALSSLYFRNFNALASIMTTLQSYVISRLSMLWG 1185

Query: 1244 LVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEV-------------EPLSGCIPFIVVYL 1290
            ++   D+  +E L  I     NY   R+ I+++             + +   +PF  ++L
Sbjct: 1186 MLSNEDVELFEYLSKIIHPNNNYKVYRKKIEKLVTESSSSSGLLSSKSVLPVVPFFNLFL 1245

Query: 1291 SDLSL 1295
             DL+ 
Sbjct: 1246 QDLTF 1250

>CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyces
            lactis, hypothetical start
          Length = 1247

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 1200 RRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLTWETLKAI 1259
            R   ++ ++ IA     L+N+N++  I+ A+ +  + + T  W+ +   D L +E L  I
Sbjct: 1031 RTTILKAWLRIALSALYLRNFNSVASIMTAIQNHSITRLTGVWQQLSRKDTLLYEYLSRI 1090

Query: 1260 PSLEKNYSNIRQ----LIDE--------VEPLSGCIPFIVVYLSDLSL 1295
                 N+   RQ    +ID+        V+     +PF  ++L D++ 
Sbjct: 1091 IHPNHNFKVYRQKLKKIIDDSSQGSIIPVKSHVPVVPFFNLFLQDITF 1138

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 8/119 (6%)

Query: 34  LRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFLVYRNFMSSQKLLDLIQERFQWAI 93
           + D    ++  T   L+ +L+  LD      ++ F L +R+FM S +L+  +  RF  A 
Sbjct: 677 IYDSNNELITATCRGLVFKLTDELDHPSSFFVSTFLLNFRSFMKSYELVTELINRFDLAD 736

Query: 94  ---DLRQSDPSSQEKITSEVILVR---MFVLVRHWLSNYFAQDFVVDTSLRRQFLQFIN 146
               LR + P  +   T+  +  R   +  +   W+ +Y+  D+  D       + F N
Sbjct: 737 MENKLRDNKPKGKYSTTASKLKNRRRLICSVFNEWMESYW--DYNTDFECISTMINFFN 793

>Scas_476.2
          Length = 1330

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 94/207 (45%), Gaps = 34/207 (16%)

Query: 1104 RLKIDNLEQHIPFILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQL 1163
            +L+I NL       + +++   A QLTL+E  +  EV   +L++         F    +L
Sbjct: 1034 KLQIKNL-------VSFNALEAAKQLTLLESTLYMEVQPFELIN-------ENFLQKKKL 1079

Query: 1164 LVQNENLS-GIDLAIARFNLTVDWIISEIVMTQDIRL--RRNTIQRFIHIAEHCKELQNY 1220
            L    NLS  I+  +   N   ++++ E ++T ++ +  R + ++ ++ IA      +NY
Sbjct: 1080 L----NLSPNINATLNFTNQFTNYVL-ESILTPNLSIPKRCSRLKGWLRIALSTLYFRNY 1134

Query: 1221 NTLMEIILALNSIVVQKFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLI------D 1274
            N+L  I++AL S  + +    W  +   D+  ++ L  I     NY   R+ +      +
Sbjct: 1135 NSLASIMIALQSHSLSRLYFLWEDLTEKDIKLYDFLCQIIHPNNNYRVYREKLRILKSGN 1194

Query: 1275 EVEPLS------GCIPFIVVYLSDLSL 1295
               PLS        +PF  ++L DL+ 
Sbjct: 1195 NQAPLSLSKSPLPIVPFFNLFLQDLTF 1221

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 35/56 (62%)

Query: 34  LRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFLVYRNFMSSQKLLDLIQERF 89
           +R+ +  I+  +  AL+++L+  +DK D  ++  F L +R F + + L++++ ERF
Sbjct: 751 VRNSSNNIIGGSFRALVIKLTDEIDKADDFLIFSFLLNFRIFGTPETLIEILIERF 806

>YDR427W (RPN9) [1250] chr4 (1322193..1323374) Non-ATPase subunit of
           the 26S proteasome complex, required for efficient
           assembly of the complex, also functions in RNA
           polymerase II transcription elongation [1182 bp, 393 aa]
          Length = 393

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 10/54 (18%)

Query: 925 KYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQTSLDEEEIATQDNENKDHG 978
           KYL +   DS DF    K LDDLK QF +  + +Q          ++N +KDHG
Sbjct: 80  KYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQ----------RNNGSKDHG 123

>YCR038C (BUD5) [572] chr3 complement(197616..199544) GTP/GDP exchange
            factor for Rsr1p/Bud1p involved in bud site selection,
            mutants bud at random sites [1929 bp, 642 aa]
          Length = 642

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 10/98 (10%)

Query: 1202 NTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLT---WETLKA 1258
            +TI  ++ +A  C  L+N N+L  II +L +  ++      RL  P D+ +   ++ LK 
Sbjct: 470  HTISYWLQVALSCLYLRNLNSLASIITSLQNHSIE------RLSLPIDVKSDHLFQRLKV 523

Query: 1259 IPSLEKNYSNIRQLIDEV-EPLSGCIPFIVVYLSDLSL 1295
            +     NY+  R+ I  +      C+PF  + + D++ 
Sbjct: 524  VVHPNNNYNVYRRTIKHIFHSQLPCVPFTSLLIRDITF 561

>Sklu_2291.5 YGL094C, Contig c2291 9283-12280
          Length = 1000

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1075 IDKDSSCTRLENTDEQIRNLLNQYTLTD--SRLKIDNLEQH-IPFILMYDSKSVANQLTL 1131
            I KD    +L+ TD +  N + +Y L    +R+  D  E H + +  +YD KS   +  +
Sbjct: 782  ISKDRPILKLQPTDLKTTNAIFKYELNAYVARISDDISESHLVTYAKVYDPKSYTYKWYM 841

Query: 1132 IEKEILSEVDWKDLLDLTMSEQLPQ 1156
                +++EVD ++ L+++   + P+
Sbjct: 842  FNDYLVAEVDEEEALNISYWWKTPE 866

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 45,474,135
Number of extensions: 2147981
Number of successful extensions: 10077
Number of sequences better than 10.0: 428
Number of HSP's gapped: 10187
Number of HSP's successfully gapped: 510
Length of query: 1345
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1231
Effective length of database: 12,649,657
Effective search space: 15571727767
Effective search space used: 15571727767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)