Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A04037g3022988551e-115
ADR349W3201927194e-94
Kwal_26.70822991927132e-93
CAGL0G06248g2971926819e-89
YAL025C (MAK16)3061926681e-86
Scas_663.23041926367e-82
CAGL0F00715g3102034863e-59
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04037g
         (298 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04037g complement(359981..360889) some similarities with s...   333   e-115
ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH] complement...   281   4e-94
Kwal_26.7082                                                          279   2e-93
CAGL0G06248g 596704..597597 highly similar to sp|P10962 Saccharo...   266   9e-89
YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear pro...   261   1e-86
Scas_663.2                                                            249   7e-82
CAGL0F00715g complement(80864..81796) similar to sp|P10962 Sacch...   191   3e-59

>KLLA0A04037g complement(359981..360889) some similarities with
           sp|P10962 Saccharomyces cerevisiae YAL025c MAK16 nuclear
           viral propagation protein singleton, hypothetical start
          Length = 302

 Score =  333 bits (855), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 174/298 (58%)

Query: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60
           MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL
Sbjct: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60

Query: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120
           YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI
Sbjct: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120

Query: 121 TXXXXXXXXXXXHYVGIAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVYGDKPL 180
           T           HYVGIAP                                SGVYGDKPL
Sbjct: 121 TERRLALREEERHYVGIAPKVKRREENRERKALSAAKIEKAIEKELLERLKSGVYGDKPL 180

Query: 181 NVDEKIWKKVMGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKWLG 240
           NVDEKIWKKVMGR                                           KWLG
Sbjct: 181 NVDEKIWKKVMGRVEDEDLDEEENDWDEEEESDEGEVEFVEDEDAEDEMVDMEDLEKWLG 240

Query: 241 GXXXXXXXXXXXXXXXXXXXXXXXXXNPXXXXXXXXXXXXXHPKVEIEYEQELNSNQQ 298
           G                         NP             HPKVEIEYEQELNSNQQ
Sbjct: 241 GSDTSDYSSDEDSDEDSSDEDSDEEENPSKRQKKSTQTRKRHPKVEIEYEQELNSNQQ 298

>ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH]
           complement(1319477..1320439) [963 bp, 320 aa]
          Length = 320

 Score =  281 bits (719), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 130/192 (67%), Positives = 141/192 (73%)

Query: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60
           MSDEIIWQVINQHFCAYK+KTDKGQNFCRNEYNVTG C+R +CPLAN+KYATVK VDG L
Sbjct: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81

Query: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120
           YLYMKT ERAHTPAKLWER++LSKNY+ AL QIDEHLL+WNKFLIHKCKQR+TKLTQVMI
Sbjct: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141

Query: 121 TXXXXXXXXXXXHYVGIAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVYGDKPL 180
           T           HYVG+AP                                SG YGDKPL
Sbjct: 142 TERRMALREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 201

Query: 181 NVDEKIWKKVMG 192
           NVDEKIWK+VMG
Sbjct: 202 NVDEKIWKRVMG 213

>Kwal_26.7082
          Length = 299

 Score =  279 bits (713), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 143/192 (74%)

Query: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60
           MSDEIIWQVINQ FCAYK+KTDKGQNFCRNEYNVTGLC+RQ+CPLAN+KYATVKNVDG L
Sbjct: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60

Query: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120
           YLYMKTAERAHTPAKLWER++LSKNY KAL Q+D+HLLYWNKFLIHKCKQR+T+LTQ+ +
Sbjct: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120

Query: 121 TXXXXXXXXXXXHYVGIAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVYGDKPL 180
           T           HYVG+AP                                SG YGDKPL
Sbjct: 121 TERRMELREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLERLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVMG 192
           NVDEKIWKKV+G
Sbjct: 181 NVDEKIWKKVLG 192

>CAGL0G06248g 596704..597597 highly similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16, start by
           similarity
          Length = 297

 Score =  266 bits (681), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 138/192 (71%)

Query: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60
           MSDEI+WQVINQ FCAYKVKTDKGQ FCRNEYNVTGLCSRQ+CPLANSKYATVK+ +G L
Sbjct: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60

Query: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120
           YLY++T ERAHTPAK WE+++LSKNY+KAL QID+HLLYWNKF IHKCKQR TKLTQV I
Sbjct: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120

Query: 121 TXXXXXXXXXXXHYVGIAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVYGDKPL 180
           T           HYVG+AP                                SG YGDKP+
Sbjct: 121 TERRLAMREMERHYVGVAPKVKRREENRERKALAAAKIEKSIEKELLDRLKSGAYGDKPM 180

Query: 181 NVDEKIWKKVMG 192
           NVDEKIWKKVMG
Sbjct: 181 NVDEKIWKKVMG 192

>YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear
           protein with HMG-like acidic region, required for
           propagation of M1 double-stranded RNA (dsRNA) virus [921
           bp, 306 aa]
          Length = 306

 Score =  261 bits (668), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 122/192 (63%), Positives = 136/192 (70%)

Query: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60
           MSDEI+WQVINQ FC++++K   GQNFCRNEYNVTGLC+RQ+CPLANSKYATVK  +G L
Sbjct: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60

Query: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120
           YLYMKT ERAHTPAKLWER+KLSKNYTKAL QIDEHLL+W+KF  HKCKQR TKLTQVMI
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120

Query: 121 TXXXXXXXXXXXHYVGIAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVYGDKPL 180
           T           HYVG+AP                                SG YGDKPL
Sbjct: 121 TERRLALREEERHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVMG 192
           NVDEK+WKK+MG
Sbjct: 181 NVDEKVWKKIMG 192

>Scas_663.2
          Length = 304

 Score =  249 bits (636), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 132/192 (68%)

Query: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60
           MSDEI+WQVINQ FC++++K+  GQ FCR+ YNVTGLC+RQ+CPLANSKYATV+   G +
Sbjct: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60

Query: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120
           YLYMKT ERAHTPAKLWER+KLSKNY+KAL QIDEHLL+W  F IHKCKQR TKLTQV I
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120

Query: 121 TXXXXXXXXXXXHYVGIAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVYGDKPL 180
           T           HYVG+AP                                SG YGDKPL
Sbjct: 121 TERRLAMREEERHYVGVAPKVKRREQNRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVMG 192
           NVDEKIWKKV+G
Sbjct: 181 NVDEKIWKKVLG 192

>CAGL0F00715g complement(80864..81796) similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16 nuclear viral
           propagation protein, hypothetical start
          Length = 310

 Score =  191 bits (486), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 121/203 (59%), Gaps = 10/203 (4%)

Query: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNV--DG 58
           +SD++IW +IN  FCA K+KT  GQ F R+ YNVTGL +RQ+CPLANSKYATV+     G
Sbjct: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62

Query: 59  TLYLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQV 118
            LYL +KT ERAHTPAK+W+R++LS NY+KAL QIDEHL+YWNKF +H+CKQR  KL+Q+
Sbjct: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122

Query: 119 MITXXXXXXXX---XXXHYVGIAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVY 175
            +                 VGIAP                                SG Y
Sbjct: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182

Query: 176 --GDK---PLNVDEKIWKKVMGR 193
              DK   PLNVDE IW K+MG+
Sbjct: 183 SNADKTLTPLNVDENIWNKIMGK 205

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,629,601
Number of extensions: 160507
Number of successful extensions: 369
Number of sequences better than 10.0: 7
Number of HSP's gapped: 361
Number of HSP's successfully gapped: 8
Length of query: 298
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 197
Effective length of database: 13,099,691
Effective search space: 2580639127
Effective search space used: 2580639127
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)