Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A04015g1343132271360.0
Kwal_26.70701315128151780.0
YAL026C (DRS2)1355130950740.0
ADR350W1311131349730.0
CAGL0G06270g1328131049140.0
Scas_505.4102545020130.0
CAGL0G08085g1578109417890.0
KLLA0C17644g1576103717830.0
AGR120C1547112117660.0
Scas_636.161554106117580.0
CAGL0L11814g1576104217370.0
YDR093W (DNF2)1612105717290.0
YER166W (DNF1)1571104217250.0
Scas_576.81591107516940.0
Sklu_2193.11143105011751e-140
YIL048W (NEO1)1151105011601e-138
ADL079C1166106311611e-138
Scas_704.381161105811441e-135
CAGL0L00715g1144105211301e-133
KLLA0C08393g1148100211301e-133
Kwal_23.57891133106011121e-131
CAGL0H04477g16265288972e-99
Kwal_23.355615975228732e-96
YMR162C (DNF3)16565468531e-93
KLLA0E01650g15505238492e-93
Scas_669.316385278175e-89
AFL191W15754828042e-87
Scas_89.12712694164e-45
Scas_665.3014398302362e-19
Kwal_26.920714695182201e-17
Kwal_47.1754712407992182e-17
KLLA0B08217g14394982139e-17
CAGL0M11308g14528272112e-16
YOR291W14728812075e-16
AFR567W14498291985e-15
KLLA0A08910g12808731985e-15
AFL011W12427331968e-15
Kwal_23.3160110011031861e-13
CAGL0K12034g10878011806e-13
CAGL0L01419g12147001762e-12
YDR040C (ENA1)10917951726e-12
YEL031W (SPF1)12157011717e-12
YDR039C (ENA2)10917971718e-12
YDR038C (ENA5)10917971718e-12
YGL167C (PMR1)9505031681e-11
KLLA0E14630g10824901672e-11
CAGL0I04312g9514591663e-11
Scas_583.14*8754971653e-11
KLLA0F20658g10824891654e-11
Scas_707.48*7414621628e-11
KLLA0E22352g12067211611e-10
AEL301W9575461592e-10
CAGL0A00517g11227491592e-10
AFR354C12106971592e-10
AGL097C10967921574e-10
Kwal_56.234672802151409e-09
Kwal_14.14989395081441e-08
YGL006W (PMC1)11733071395e-08
CAGL0J01870g9465061385e-08
KLLA0A03157g9384601386e-08
Kwal_47.175228992971127e-05
KLLA0A09031g8993001091e-04
YPL036W (PMA2)947297980.003
YGL008C (PMA1)918297980.003
Scas_688.1913299950.006
AGL085C909297950.007
CAGL0A00495g902287910.019
Scas_710.41904303890.031
YDR270W (CCC2)1004216810.31
Scas_297.180059780.60
KLLA0F07447g975117770.92
Scas_569.0d46860741.6
CAGL0M08602g101272742.0
Kwal_26.833342285732.2
Scas_665.139284704.6
YBL088C (TEL1)2787109705.5
KLLA0B04455g29772688.1
Scas_630.1470159688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A04015g
         (1322 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...  2753   0.0  
Kwal_26.7070                                                         1999   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...  1959   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...  1920   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...  1897   0.0  
Scas_505.4                                                            780   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   693   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   691   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   684   0.0  
Scas_636.16                                                           681   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   673   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   670   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   669   0.0  
Scas_576.8                                                            657   0.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         457   e-140
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   451   e-138
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   451   e-138
Scas_704.38                                                           445   e-135
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   439   e-133
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   439   e-133
Kwal_23.5789                                                          432   e-131
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   350   2e-99
Kwal_23.3556                                                          340   2e-96
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   333   1e-93
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   331   2e-93
Scas_669.3                                                            319   5e-89
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   314   2e-87
Scas_89.1                                                             164   4e-45
Scas_665.30                                                            96   2e-19
Kwal_26.9207                                                           89   1e-17
Kwal_47.17547                                                          89   2e-17
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    87   9e-17
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    86   2e-16
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    84   5e-16
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    81   5e-15
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    81   5e-15
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    80   8e-15
Kwal_23.3160                                                           76   1e-13
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    74   6e-13
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    72   2e-12
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    71   6e-12
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    70   7e-12
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    70   8e-12
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    70   8e-12
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    69   1e-11
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    69   2e-11
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    69   3e-11
Scas_583.14*                                                           68   3e-11
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    68   4e-11
Scas_707.48*                                                           67   8e-11
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    67   1e-10
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    66   2e-10
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    66   2e-10
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    66   2e-10
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    65   4e-10
Kwal_56.23467                                                          59   9e-09
Kwal_14.1498                                                           60   1e-08
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    58   5e-08
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    58   5e-08
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    58   6e-08
Kwal_47.17522                                                          48   7e-05
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    47   1e-04
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    42   0.003
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    42   0.003
Scas_688.1                                                             41   0.006
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    41   0.007
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    40   0.019
Scas_710.41                                                            39   0.031
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    36   0.31 
Scas_297.1                                                             35   0.60 
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    34   0.92 
Scas_569.0d                                                            33   1.6  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    33   2.0  
Kwal_26.8333                                                           33   2.2  
Scas_665.1                                                             32   4.6  
YBL088C (TEL1) [113] chr2 complement(51016..59379) Phosphatidyli...    32   5.5  
KLLA0B04455g 396805..397698 no similarity, hypothetical start          31   8.1  
Scas_630.14                                                            31   8.9  

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 2753 bits (7136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1322/1322 (100%), Positives = 1322/1322 (100%)

Query: 1    MKPKYFEREIQSQRGATHRSTCFPMSGSTKHGDSDALFDVDFLDDSYTPDLRDSPRRNSP 60
            MKPKYFEREIQSQRGATHRSTCFPMSGSTKHGDSDALFDVDFLDDSYTPDLRDSPRRNSP
Sbjct: 1    MKPKYFEREIQSQRGATHRSTCFPMSGSTKHGDSDALFDVDFLDDSYTPDLRDSPRRNSP 60

Query: 61   SAVIDSGMDTSQRGLLPQETIDLSDNIENDIENPFNDRYSASFADTNPRNSVLPQPSGFN 120
            SAVIDSGMDTSQRGLLPQETIDLSDNIENDIENPFNDRYSASFADTNPRNSVLPQPSGFN
Sbjct: 61   SAVIDSGMDTSQRGLLPQETIDLSDNIENDIENPFNDRYSASFADTNPRNSVLPQPSGFN 120

Query: 121  RFMSNVKSAVGMNGGHKGQFQSFEMNDYDQSNTNRYESSTRKFDIKVLFNRYILRKGKTS 180
            RFMSNVKSAVGMNGGHKGQFQSFEMNDYDQSNTNRYESSTRKFDIKVLFNRYILRKGKTS
Sbjct: 121  RFMSNVKSAVGMNGGHKGQFQSFEMNDYDQSNTNRYESSTRKFDIKVLFNRYILRKGKTS 180

Query: 181  CKSDEPRTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSII 240
            CKSDEPRTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSII
Sbjct: 181  CKSDEPRTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSII 240

Query: 241  QQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVR 300
            QQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVR
Sbjct: 241  QQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVR 300

Query: 301  KKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETAN 360
            KKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETAN
Sbjct: 301  KKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETAN 360

Query: 361  YLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGL 420
            YLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGL
Sbjct: 361  YLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGL 420

Query: 421  IVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAH 480
            IVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAH
Sbjct: 421  IVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAH 480

Query: 481  LGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEES 540
            LGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEES
Sbjct: 481  LGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEES 540

Query: 541  DTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVED 600
            DTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVED
Sbjct: 541  DTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVED 600

Query: 601  GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEG 660
            GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEG
Sbjct: 601  GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEG 660

Query: 661  ALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK 720
            ALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK
Sbjct: 661  ALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK 720

Query: 721  LFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYE 780
            LFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYE
Sbjct: 721  LFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYE 780

Query: 781  AASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGD 840
            AASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGD
Sbjct: 781  AASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGD 840

Query: 841  RQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVI 900
            RQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVI
Sbjct: 841  RQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVI 900

Query: 901  DGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGAN 960
            DGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGAN
Sbjct: 901  DGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGAN 960

Query: 961  DVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFY 1020
            DVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFY
Sbjct: 961  DVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFY 1020

Query: 1021 KNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYP 1080
            KNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYP
Sbjct: 1021 KNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYP 1080

Query: 1081 QLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVG 1140
            QLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVG
Sbjct: 1081 QLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVG 1140

Query: 1141 IYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIG 1200
            IYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIG
Sbjct: 1141 IYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIG 1200

Query: 1201 HVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQ 1260
            HVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQ
Sbjct: 1201 HVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQ 1260

Query: 1261 KAIRKVRQVQRMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFNDTPA 1320
            KAIRKVRQVQRMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFNDTPA
Sbjct: 1261 KAIRKVRQVQRMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFNDTPA 1320

Query: 1321 QV 1322
            QV
Sbjct: 1321 QV 1322

>Kwal_26.7070
          Length = 1315

 Score = 1999 bits (5178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 961/1281 (75%), Positives = 1086/1281 (84%), Gaps = 22/1281 (1%)

Query: 58   NSP---SAVIDSGMD---TSQRGLLPQETIDL---------SDNIENDI-ENPFND-RYS 100
            N+P   + V+DS  D     +RG +PQET++L         +DNIENDI +NPF+D R +
Sbjct: 34   NNPFNEAQVVDSDYDLLEDVRRGHIPQETMNLDLHSTTLPEADNIENDIVQNPFSDERRA 93

Query: 101  ASFADTNPRNSVLPQP-SGFNRFMSNVKSAVGMNGGHKGQFQSFEMNDYDQ-SNTNRYES 158
             S +       + PQ  S F R ++ +K  +G +G     +Q FEM++YD   N +RY  
Sbjct: 94   RSSSHNQGVVHLTPQNGSAFQRAINKIKKGLGRSGS-GNSYQGFEMHNYDDLGNDDRYAK 152

Query: 159  STRKFDIKVLFNRYILRKGKTSCK-SDEPRTILLNDSSANSRFGYRDNHISTTKYNAATF 217
            S  KFDIK++F RYILR+   S      PR I +ND  AN   G+  NHISTTKYN ATF
Sbjct: 153  SRNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATF 212

Query: 218  LPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRS 277
            +PKFLFQEFSKYANLFFLFTS IQQVPNVTPTNRYTTIGTLL+VLIVSA+KE VEDLKR+
Sbjct: 213  IPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRA 272

Query: 278  NADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCY 337
             +D ELN S   V  E+  +F   KW++I+VGDII+V SEEAIPAD+I+++SSEPEGLCY
Sbjct: 273  QSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCY 332

Query: 338  IETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTF 397
            IETANLDGETNLKIKQAR ET+ ++D+  L  + G+V SEHPNSSLYTYEGTM LNG   
Sbjct: 333  IETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNI 392

Query: 398  PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFG 457
             LSP+QM+LRGATLRNTAWI+GL+VFTGHETKLMRNATATPIKRTAVERVINMQI+ALFG
Sbjct: 393  SLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFG 452

Query: 458  VLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVT 517
            VLIVLALISS GNVI    D+ HL YLY++GTNK GLFFKDILT+WILFSNLVPISLFVT
Sbjct: 453  VLIVLALISSIGNVIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVT 512

Query: 518  VEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFK 577
            VEMIKYYQAYMI SDLDLY E SD+PTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFK
Sbjct: 513  VEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFK 572

Query: 578  SVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATC 637
            S SIAG+CYIETIPED+ AT EDGIEIGF  F+S+K+ + D +D ++ I+ +FLTLLATC
Sbjct: 573  SCSIAGKCYIETIPEDKAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATC 632

Query: 638  HTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTP-FSEQLEYQLL 696
            HTVIPE Q DG+IKYQAASPDEGALV+GAA LG++F IR+PNSVS+      ++ EYQLL
Sbjct: 633  HTVIPEFQEDGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLL 692

Query: 697  NICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEG 756
            NICEFNSTRKRMSAIFR+P+G IKLFCKGADTVILERL +  NPY+++TLRHLEDYAAEG
Sbjct: 693  NICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEG 752

Query: 757  LRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKL 816
            LRTLC+ASRT+ E EY EW  IY+AASTT+ DR ++LD AAELIE DLF LGATAIEDKL
Sbjct: 753  LRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKL 812

Query: 817  QEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNL 876
            Q+GVPETIH LQ+AG+KVWVLTGDRQETA+NIGMSCRLLSEDMNLLI+NEE KE TR NL
Sbjct: 813  QDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNL 872

Query: 877  QSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQ 936
              KL AI  HQISQQDMNSLALVIDGKSLG+ALE DLED  L IGKLCKAVICCRVSPLQ
Sbjct: 873  TEKLKAISDHQISQQDMNSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQ 932

Query: 937  KALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFL 996
            KALVVKMVKRKT SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAI QF++L
Sbjct: 933  KALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYL 992

Query: 997  RKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFF 1056
            +KLL+VHGSWSYQRIS AILYSFYKN+ALYMTQFWYVFANA+SGQSIMESWT+TFYNVFF
Sbjct: 993  KKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFF 1052

Query: 1057 TVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSV 1116
            TV+PPFV+G+FDQFV+SRLLDRYPQLYKLGQ+GQFFSV IFWGWV+NGFYHSAV FIGS 
Sbjct: 1053 TVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGST 1112

Query: 1117 LFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWL 1176
            LFYR GN LN  GETADHW WGV IYT S+IIV+GKAAL+T+QWTKFT  AIPGSLV WL
Sbjct: 1113 LFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWL 1172

Query: 1177 LFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPE 1236
            +FFP Y+++ P  NVSKEYYG++ HVYGSATFWLMCIVLP FAL+RD VWKYYKRTY+PE
Sbjct: 1173 VFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPE 1232

Query: 1237 SYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQVQRMKKQRGFAFSQSEEGGQDRIIRMYD 1296
            SYHVVQEMQKYNI DYRPR+EQFQKAIR+VRQVQRMKKQRGFAFSQSE GGQD+++RMYD
Sbjct: 1233 SYHVVQEMQKYNIGDYRPRIEQFQKAIRRVRQVQRMKKQRGFAFSQSETGGQDKVMRMYD 1292

Query: 1297 TTLKRGVHGELADASLNPFND 1317
            TTLKRG HGEL DAS NPF D
Sbjct: 1293 TTLKRGEHGELQDASANPFRD 1313

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 1959 bits (5074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 947/1309 (72%), Positives = 1094/1309 (83%), Gaps = 27/1309 (2%)

Query: 30   KHGDSDALFDVDFLDDSYTPDLRDSPRRNSPSAVIDSGMDTSQRGLLPQETIDLS---DN 86
            K G+ D LFD+DFLDD+ +     S   NS +    +G       +LP+ETIDL    DN
Sbjct: 12   KPGEDDTLFDIDFLDDTTSHSGSRSKVTNSHA----NGYYIPPSHVLPEETIDLDADDDN 67

Query: 87   IENDI-ENPF----NDRYSASFADTNPRNSVLPQ-------PSGFNRFMSNVKSAVGMNG 134
            IEND+ EN F    +D  ++  A+    ++  PQ       P  F RF + +K+A     
Sbjct: 68   IENDVHENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLKNAFTFK- 126

Query: 135  GHKGQFQSFEMNDYDQSNTNR----YESSTRKFDIKVLFNRYILRKGKTSCKSD-EPRTI 189
              K   +SFEMN Y+    N     Y  S  KF+IK+LFNRYILRK     + + EPR I
Sbjct: 127  -RKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVI 185

Query: 190  LLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPT 249
             +NDS ANS FGY DNHISTTKYN ATFLPKFLFQEFSKYANLFFL TS IQQVP+V+PT
Sbjct: 186  HINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPT 245

Query: 250  NRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVG 309
            NRYTTIGTLLVVLIVSA+KE +ED+KR+N+DKELN+S  ++  E   +FV K+WIDI VG
Sbjct: 246  NRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVG 305

Query: 310  DIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCK 369
            DIIRV+SEE IPAD IILSSSEPEGLCYIETANLDGETNLKIKQ+R ETA ++D K L  
Sbjct: 306  DIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKN 365

Query: 370  LHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETK 429
            ++G+V SE PNSSLYTYEGTMTLN    PLSPDQM+LRGATLRNTAWIFGL++FTGHETK
Sbjct: 366  MNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETK 425

Query: 430  LMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGT 489
            L+RNATATPIKRTAVE++IN QI+ LF VLIVL LISS GNVIM+  D+ HL YLY+EGT
Sbjct: 426  LLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLYLEGT 485

Query: 490  NKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTS 549
            NKAGLFFKD LTFWILFSNLVPISLFVTVE+IKYYQA+MIGSDLDLY+E++DTPTVVRTS
Sbjct: 486  NKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTS 545

Query: 550  SLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSF 609
            SLVEELGQIEYIFSDKTGTLTRN+MEFKS SIAG CYI+ IPED+ ATVEDGIE+G+  F
Sbjct: 546  SLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKF 605

Query: 610  ESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADL 669
            + LK K+ DP D+++ I+ +FLTLLATCHTVIPE QSDG+IKYQAASPDEGALVQG ADL
Sbjct: 606  DDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADL 665

Query: 670  GFRFDIRRPNSVSISTPFS-EQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADT 728
            G++F IR+ NSV++    + E+ EYQLLNICEFNSTRKRMSAIFR PDGSIKLFCKGADT
Sbjct: 666  GYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADT 725

Query: 729  VILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKD 788
            VILERLD E N YV++T+RHLEDYA+EGLRTLC+A R I E EYEEW+ IY  A+TT+ +
Sbjct: 726  VILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDN 785

Query: 789  RTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINI 848
            R E+LD AA LIE +L  +GATAIEDKLQ+GVPETIH LQEAG+K+WVLTGDRQETAINI
Sbjct: 786  RAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINI 845

Query: 849  GMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYA 908
            GMSCRLLSEDMNLLI+NEET++DT  NL  K+NA+  HQ+S  DM SLALVIDGKSLG+A
Sbjct: 846  GMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFA 905

Query: 909  LEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAA 968
            LE +LED  LT+ KLCKAVICCRVSPLQKALVVKMVKRK+SSLLLAI  GANDVSMIQAA
Sbjct: 906  LEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAA 965

Query: 969  HVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMT 1028
            HVGVGISGMEGMQAARSAD A+GQF+FL+KLL+VHGSWSYQRIS+AILYSFYKN ALYMT
Sbjct: 966  HVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMT 1025

Query: 1029 QFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQK 1088
            QFWYVFANAFSGQSIMESWT++FYN+FFTV PPFVIG+FDQFV+SRLL+RYPQLYKLGQK
Sbjct: 1026 QFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQK 1085

Query: 1089 GQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIII 1148
            GQFFSV IFWGW++NGF+HSA+VFIG++L YRYG  LNM GE ADHW WGV +YTTS+II
Sbjct: 1086 GQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVII 1145

Query: 1149 VLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATF 1208
            VLGKAAL+T+QWTKFTL+AIPGSL+ WL+FFP Y+++FP  N+S+EYYG++ H YGS  F
Sbjct: 1146 VLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVF 1205

Query: 1209 WLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQ 1268
            WL  IVLP+FAL+RDF+WKYYKR Y PE+YHV+QEMQKYNISD RP ++QFQ AIRKVRQ
Sbjct: 1206 WLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQ 1265

Query: 1269 VQRMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFND 1317
            VQRMKKQRGFAFSQ+EEGGQ++I+RMYDTT KRG +GEL DAS NPFND
Sbjct: 1266 VQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFND 1314

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 1920 bits (4973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 943/1313 (71%), Positives = 1078/1313 (82%), Gaps = 23/1313 (1%)

Query: 25   MSGSTKHGDSDALFDVDFLDDSYTPD----LRDSPRRNSPSAVIDSGMD---TSQRGLLP 77
            MSGS    + + LFD+DFLDD YTP+    + DS  R+ P  +IDSG+D     QR   P
Sbjct: 1    MSGSRDKHNEETLFDIDFLDDRYTPEPARPVNDSGSRSGP--IIDSGIDDLVQMQRTGFP 58

Query: 78   QETIDLSD--------NIEND-IENPFND-RYSASFADTNPRNSVLPQPSGFNRFMSNVK 127
            QE IDL D        +IEND IENPF+D R    +  +  R SV PQPSG+ R +  ++
Sbjct: 59   QEVIDLDDEPPFRHDDSIENDLIENPFDDERGQQRYLASANRLSV-PQPSGWQRLVGGLR 117

Query: 128  SAVGMNGGHKGQFQSFEMNDY-DQSNTNRYESSTRKFDIKVLFNRYILRK-GKTSCKSDE 185
             +VG  G    Q+QSFEM DY D  + +RY+ S  KF++K LF+ Y+LRK       + E
Sbjct: 118  DSVGGRGTENSQYQSFEMQDYRDTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADTGAGE 177

Query: 186  PRTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPN 245
            PR I +N+  AN   GY DNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPN
Sbjct: 178  PRVIYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPN 237

Query: 246  VTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWID 305
            VTPTNR+TTIGTL+VVL+VSA+KESVEDLKRSN+DKELNHS  DV  +  G+F+ KKWID
Sbjct: 238  VTPTNRFTTIGTLIVVLVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWID 297

Query: 306  IAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEK 365
            IAVGDIIRVRSEEAIPADLI+LSSSEPEGLCYIETANLDGETNLKIKQAR ET+  LD +
Sbjct: 298  IAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVR 357

Query: 366  ALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTG 425
             L  + G++ SE PN+SLYTYEGTM L+ +  PLSPDQ+LLRGATLRNT WIFG+++FTG
Sbjct: 358  ELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTG 417

Query: 426  HETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLY 485
            HETKL RNATATPIKRTAVERVIN+QI+ALFGVLI L+LISS GN+I+      +L YLY
Sbjct: 418  HETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLY 477

Query: 486  IEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTV 545
            ++GTN   LFFK+ILTFWILFSNLVPISLFVTVEMIKYYQAYMI SDLDL+HEES+ PTV
Sbjct: 478  LQGTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTV 537

Query: 546  VRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIG 605
            VRTSSLVEELGQIEYIFSDKTGTLT+NVMEFKS SIAGRCYI++IPED+ A  ++GIE+G
Sbjct: 538  VRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVG 597

Query: 606  FHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQG 665
            + +++ + + +  P   +  I+ EFLTLL+ CHTVIPE Q +G+IKYQAASPDEGALVQG
Sbjct: 598  YRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQG 657

Query: 666  AADLGFRFDIRRPNSVSI-STPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCK 724
            AADLG++F IR+PNSV+I     +E++ Y+LLNICEFNSTRKRMSAIFR PD SI+L CK
Sbjct: 658  AADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIRLLCK 717

Query: 725  GADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAAST 784
            GADTVILERL +  NPYV +TLRHLEDYAAEGLRTLCIASRTIPE EYEEWSK+Y+AA+T
Sbjct: 718  GADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAAT 777

Query: 785  TMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQET 844
            TM +R+EELD+ AE+IE  L  LGATAIEDKLQ+GVPETIH LQ+AG+KVWVLTGDRQET
Sbjct: 778  TMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQET 837

Query: 845  AINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKS 904
            AINIGMSC+LLSEDMNLLIVNE+TKE TR NL  KL AI  HQISQQDMN+LALVIDGKS
Sbjct: 838  AINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKS 897

Query: 905  LGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSM 964
            LG+ALE DLE+  L IGK+C+AVICCRVSPLQKALVVKMVKR+T SLLLAIGDGANDVSM
Sbjct: 898  LGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSM 957

Query: 965  IQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMA 1024
            IQAAHVGVGISGMEGMQAARSADFA+GQF++L+KLL+VHGSWSYQRIS AILYSFYKN+A
Sbjct: 958  IQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIA 1017

Query: 1025 LYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYK 1084
            LYMTQFWYV  NAFSGQSIMESWTLTFYN   T  PP      DQF  S LL+R  Q   
Sbjct: 1018 LYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCT 1077

Query: 1085 LGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTT 1144
            +GQKGQF+  TIF G  +NG YH+ +   G ++ YRYG    M GETADHWVWGV I  T
Sbjct: 1078 VGQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPT 1137

Query: 1145 SIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYG 1204
            SII VLGKAALIT+QWTKFT++AIPGSLV WLLFFP Y+ + P +NVSKEYYGI+ HVYG
Sbjct: 1138 SIIFVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYG 1197

Query: 1205 SATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKAIR 1264
            S TFW MC VLPV ALLRD +WKYYKRTY+PESYHVVQEMQKY+ISD RPR+EQFQKAIR
Sbjct: 1198 SFTFWAMCYVLPVLALLRDLLWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQKAIR 1257

Query: 1265 KVRQVQRMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFND 1317
            KVRQVQRMKKQRGFAFSQSEE GQDRI+RMYDTT KRG HGEL D S+NPF D
Sbjct: 1258 KVRQVQRMKKQRGFAFSQSEEAGQDRIVRMYDTTQKRGTHGELQDPSMNPFKD 1310

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 1897 bits (4914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 919/1310 (70%), Positives = 1077/1310 (82%), Gaps = 35/1310 (2%)

Query: 25   MSGSTKHGDSDALFDVDFLDDSYTPDLRDSPRRNSPSAVIDSGMDTSQRGLLPQETIDL- 83
            M   T+    D LFD+DF D +    +R S               T+  G  P+E IDL 
Sbjct: 5    MGKGTRVPTGDTLFDIDFNDGN---KIRASENER-----------TTSHGF-PEEIIDLD 49

Query: 84   SDNIENDI-ENPFNDRYSASFADTNPRNSVLPQP---------SGFNRFMSNVKSAVGMN 133
            +D+IEND+ +NPF++       +TN  + +  QP         + F R   ++K      
Sbjct: 50   NDSIENDLHDNPFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSIKGIFTFQ 109

Query: 134  GGHKGQFQSFEMNDYDQSNT----NRYESSTRKFDIKVLFNRYILRKGKTSCK-SDEPRT 188
               + Q  SFEM++Y+  +T    + ++ S  KFDIK+LFN+Y+LRK  +  + S EPR 
Sbjct: 110  SNSEPQ--SFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQDSGEPRE 167

Query: 189  ILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTP 248
            I ++D  +N+RFGY DNHISTTKYNAATFLPKFLFQEFSKYANLFFL TS IQQVP+V+P
Sbjct: 168  IHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSP 227

Query: 249  TNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAV 308
            TNRYTTIGTL+VVLIVSA+KESVEDLKR+++D ELN+S  ++  E  G+F++K+WIDI V
Sbjct: 228  TNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDIKV 287

Query: 309  GDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALC 368
            GDIIRV SEE IPAD+IILSSSEPEGLCYIETANLDGETNLKIKQAR ETA  +D + L 
Sbjct: 288  GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347

Query: 369  KLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHET 428
             + G + SE PNSSLYTYEGT+ +NG+  PLSP+QM+LRGATLRNT WIFG+++FTGHET
Sbjct: 348  NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407

Query: 429  KLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEG 488
            KLMRNATATPIKRTAVE+VINMQI+ALF VL+VL LISS GNVIM+  D+ HL YLY++G
Sbjct: 408  KLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLYLQG 467

Query: 489  TNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRT 548
            TNKAGLFFKD LTFWILFSNLVPISLFVTVE+IKYYQA+MIGSDLDLY+EE+DTPTVV+T
Sbjct: 468  TNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTVVKT 527

Query: 549  SSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHS 608
            SSLVEELGQIEYIFSDKTGTLTRN+MEFKS SIAGRCY E IPED+ AT EDGIE+G+ S
Sbjct: 528  SSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVGYRS 587

Query: 609  FESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAAD 668
            F+ LK ++T   DD   I+ EFLTLLATCHTVIPE Q+DG+IKYQAASPDEGALV+G A 
Sbjct: 588  FDDLKKQLTTNSDD-CKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDEGALVEGGAL 646

Query: 669  LGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADT 728
            LG++F IR+PNSV+I     E+ EYQLLNICEFNSTRKRMSAIFR PD SIKL CKGAD+
Sbjct: 647  LGYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIKLLCKGADS 706

Query: 729  VILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKD 788
            VILERL    N YV +T RHLEDYA EGLRTLC+A++ IPE EY  W+K Y  A+TT+  
Sbjct: 707  VILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDH 766

Query: 789  RTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINI 848
            R E+LD  AE IE  L  +GATAIEDKLQEGVP+TI  LQEAG+K+WVLTGD+QETAINI
Sbjct: 767  RAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINI 826

Query: 849  GMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYA 908
            GMSCRLLSEDMNLLI++EETKE TR N++ KL A+  H +S+ DMN+LALVIDG SL +A
Sbjct: 827  GMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFA 886

Query: 909  LEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAA 968
            LE DLED FL IGK+CKAVICCRVSPLQKALVVKMVKRKT+SLLLAIGDGANDVSMIQAA
Sbjct: 887  LEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAA 946

Query: 969  HVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMT 1028
            HVGVGISGMEGMQAARSAD ++GQFRFL+KLL+VHG+WSYQRIS+AILYSFYKN ALYMT
Sbjct: 947  HVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMT 1006

Query: 1029 QFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQK 1088
            QFWYVFANAFSGQSIMESWT++ YNVFFTV+PPFVIG+FDQFV SRLL+RYPQLYKLGQK
Sbjct: 1007 QFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQK 1066

Query: 1089 GQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIII 1148
            GQFFSV+IFWGW++NGFYHSAVVF+G++LFYRYG  L   GETADHW WG+ IYT+S+II
Sbjct: 1067 GQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVII 1126

Query: 1149 VLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATF 1208
            VLGKAAL+T+QWTKFTL AIPGSL  WL+FFP Y ++FP   +S+EY+G++ H YGSATF
Sbjct: 1127 VLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATF 1186

Query: 1209 WLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQ 1268
            WL  IVLP FAL RDF+WKYYKR Y+PESYH++QEMQKYN+SDYRP ++ FQ AIRKVRQ
Sbjct: 1187 WLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQ 1246

Query: 1269 VQRMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFNDT 1318
            VQRMKKQRGFAFSQ+EE GQ++IIRMYDTT KRG +GEL DAS +PF+DT
Sbjct: 1247 VQRMKKQRGFAFSQAEE-GQEKIIRMYDTTQKRGKYGELHDASADPFSDT 1295

>Scas_505.4
          Length = 1025

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/450 (77%), Positives = 406/450 (90%), Gaps = 2/450 (0%)

Query: 872  TRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCR 931
            TR N++ K+ A++ H++SQ +MN+LALVIDGKSL YALE DLED  L +GK+CKAV+CCR
Sbjct: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593

Query: 932  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIG 991
            VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD A+G
Sbjct: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653

Query: 992  QFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTF 1051
            QFRFL+KLL+VHGSWSYQRIS+AILYSFYKN ALYMTQFW+VFANAFSGQSIMESWT+++
Sbjct: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713

Query: 1052 YNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVV 1111
            YNVFFTV PPFVIG+FDQFV+SRLL+RYPQLYKLGQ+G+FFSV IFWGW++NGFYHSAVV
Sbjct: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773

Query: 1112 FIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQWTKFTLVAIPGS 1171
            +IG++LFYRYG  LNM GE ADHW WG+ +YT+SI+IVLGKAAL+T+QWTKFTL AIPGS
Sbjct: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833

Query: 1172 LVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKR 1231
             + W++FFP Y++VFP  N+S+EY+G++ H YGS TFWL  IVLPVFAL+RDFVWKYY+R
Sbjct: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893

Query: 1232 TYSPESYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQVQRMKKQRGFAFSQSEEGGQDRI 1291
             Y PESYH+VQEMQK+NISD RP ++ FQ  IRKVRQVQRMKKQRGFAFSQSEEGGQD+I
Sbjct: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953

Query: 1292 IRMYDTTLKRGVHGELADASLNPFNDTPAQ 1321
            IRMYDTT KRGV+GEL DA  NPF++  A+
Sbjct: 954  IRMYDTTQKRGVYGELHDA--NPFSNNNAE 981

 Score =  540 bits (1390), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 289/481 (60%), Positives = 344/481 (71%), Gaps = 29/481 (6%)

Query: 25  MSGSTKHGDSDALFDVDFLDDSYTPDLRDSPRRNSPSAVIDSGMDTSQRGL----LPQET 80
           MS   K  D D LFD+D L+DS  P     P       +I +  D   R +     P+ET
Sbjct: 49  MSKDAKVAD-DTLFDIDILNDSAEPSNSTQPH------IIANNRDAEARVIPPHTFPEET 101

Query: 81  IDLS--DNIENDI-ENPFNDRYSASFADTN--PRNSVLPQ--PSG-FNRFMSN----VKS 128
           IDL   DNIENDI +NPF D  S ++ DTN    N+  PQ  P+G  N F +N    VK+
Sbjct: 102 IDLDNDDNIENDIYDNPFQDEESTTW-DTNRFETNNYQPQLYPTGQRNGFFANSFNKVKN 160

Query: 129 AVGMNGGHKGQFQSFEMNDYDQSNTN----RYESSTRKFDIKVLFNRYILRKGKTSCKSD 184
               N        S+EMN Y+    N    RY  S  +F+IK+LFNRYILRK   +    
Sbjct: 161 IFVFNTKPSDS-GSYEMNRYNAVTNNELDGRYADSRNRFNIKILFNRYILRKNVGASDDG 219

Query: 185 EPRTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVP 244
            PR I LND +AN  F Y DNHISTTKYN ATFLPKFLFQEFSKYANLFFL T+ IQQVP
Sbjct: 220 TPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVP 279

Query: 245 NVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWI 304
           +V+PTNRYTT+GTL+VVLIVSA KES+ED+KR+N+DKELN+S  ++  E +G+F+ ++WI
Sbjct: 280 HVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWI 339

Query: 305 DIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDE 364
           DI  GD+IRV+SEEAIPADLI++SSSEPEGLCYIETANLDGETNLKIKQAR ETA  +D 
Sbjct: 340 DIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDS 399

Query: 365 KALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFT 424
           + L    G+V SE PNSSLYTYEGT+  N    PLSP+QM+LRGATLRNT+W+FGL++FT
Sbjct: 400 RKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFT 459

Query: 425 GHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYL 484
           GHETKLMRNATATPIKRTAVERVIN+QI+ALFGVLIVL LISS GN I++     HL YL
Sbjct: 460 GHETKLMRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLGNAIISSTQEKHLSYL 519

Query: 485 Y 485
           Y
Sbjct: 520 Y 520

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1094 (37%), Positives = 622/1094 (56%), Gaps = 100/1094 (9%)

Query: 276  RSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGL 335
            + N D  +N +L   ++ R   F +  W ++ VGDI+R+ + E IPAD+I+LS+S+ +G 
Sbjct: 381  QQNEDTLINKTLPTDMEWR---FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGA 437

Query: 336  CYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNG- 394
            CY+ET NLDGETNLK++Q+ + T++      + +    ++SE P+++LY+Y+G    N  
Sbjct: 438  CYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSL 497

Query: 395  -----STFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVIN 449
                    P++ + +LLRG TLRNT W  G++ FTG +TK+M NA  TP K++ + + +N
Sbjct: 498  EDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELN 557

Query: 450  MQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILF 506
            + +L  F +L VL  I+   N I   +      +    GT   G      ++FW   IL+
Sbjct: 558  LSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDFFDF-GTGTGGSATSGFVSFWVAVILY 616

Query: 507  SNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKT 566
             +LVPISL+++VE+IK  QA  I  D+ +Y+E+ D P   ++ ++ ++LGQIEYIFSDKT
Sbjct: 617  QSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKT 676

Query: 567  GTLTRNVMEFKSVSIAG----RCYIETIPEDRR---------ATVE-DGI---------- 602
            GTLT+NVMEFK  +I G    R Y E +   R+         + +E +GI          
Sbjct: 677  GTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINK 736

Query: 603  -------------EIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVI--PETQSD 647
                         E+ F S E + D        +      F+  LA CH+V+  P  +  
Sbjct: 737  LQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDP 796

Query: 648  GTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKR 707
              ++ +A SPDE ALV  A D+GF F  +    + +     E+ E+Q+LNI EFNS+RKR
Sbjct: 797  AKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEK-EFQILNILEFNSSRKR 855

Query: 708  MSAIFRMP----DGSIK--LFCKGADTVILERLDS---EFNPYVQSTLRHLEDYAAEGLR 758
            MS I ++P    +G  K  L CKGAD+VI  RLD         ++ T  HLE YA EGLR
Sbjct: 856  MSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLR 915

Query: 759  TLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQE 818
            TLC+A R +  +EYE W+K Y+ A+  + DR EEL++ ++ IE  L  LG TAIED+LQ+
Sbjct: 916  TLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQD 975

Query: 819  GVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNE---------ETK 869
            GVP++I  L EAG+K+WVLTGD+ ETAINIG SC LL+ DM LL++            T 
Sbjct: 976  GVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATP 1035

Query: 870  EDTRTNLQSKL---------------NAIESHQISQQDMNSLALVIDGKSLGYALE-EDL 913
            +D    L S+                 A   H I + +    A++IDG++L YAL  ED+
Sbjct: 1036 KDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE---FAVIIDGEALKYALSTEDM 1092

Query: 914  EDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVG 973
            + +FL + K CK+V+CCRVSP QKA VVK+VK     + LAIGDG+NDV+MIQ+A++GVG
Sbjct: 1093 KRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVG 1152

Query: 974  ISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYV 1033
            I+G EG QA  S+D+AIGQFR+L +LL+VHG W Y+R++  I   FYKNM   +  FW+ 
Sbjct: 1153 IAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFG 1212

Query: 1034 FANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFS 1093
              N + G  + E   LTFYN+ FT +P  ++GIFDQ V+  +   +PQLY++G   + +S
Sbjct: 1213 IYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS 1272

Query: 1094 VTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKA 1153
             T F  ++L+G Y S + F    L YR    +   G   DH  + VG+  T+I  +    
Sbjct: 1273 QTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYY-VGVPVTAIACISCNL 1331

Query: 1154 ALITSQ--WTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLM 1211
             ++  Q  W  F    +  S++I   FF  ++ ++   + S E+Y     V+G+ TFW +
Sbjct: 1332 YILIQQKHWDVFCSFFVGVSIMI---FFT-WTGIWSSASRSNEFYHGAARVFGTPTFWAV 1387

Query: 1212 CIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQVQR 1271
              V  +F LL  F    +KR + P+   +++EM  ++  D+    +++     +V ++  
Sbjct: 1388 LFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREM--WSRGDFDSFPKKYDPTDPEVHKIA- 1444

Query: 1272 MKKQRGFAFSQSEE 1285
            M   R F+ ++S+E
Sbjct: 1445 MSDIRVFSGAESKE 1458

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 61/118 (51%), Gaps = 8/118 (6%)

Query: 182 KSDEPRTILLN--------DSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLF 233
           K+DE R I  N        D        Y  N I TTKY   TFLPK +  +F  +AN++
Sbjct: 168 KADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIY 227

Query: 234 FLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVL 291
           FL   I+        TN   +   L+V++I++A+K+ +ED +R+  D E+N++   VL
Sbjct: 228 FLILIILGAFQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVL 285

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1037 (38%), Positives = 590/1037 (56%), Gaps = 86/1037 (8%)

Query: 297  EFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQ 356
            +F +  W  ++VGDI+RV + + IPAD+I+LSSS+ +G CY+ET NLDGETNLK++Q+ +
Sbjct: 437  KFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLK 496

Query: 357  ETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTM------TLNGSTFPLSPDQMLLRGAT 410
             +    + + + +   +V+SE P+S+LY+Y+G +      T      P++ + +LLRG T
Sbjct: 497  CSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCT 556

Query: 411  LRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGN 470
            LRNT W  G++VFTG +TK+M NA  TP K + + R +N+ +   F +L VL   +   N
Sbjct: 557  LRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVN 616

Query: 471  VIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQAY 527
             +  + D+    Y    G+         +++FW   IL+ ++VPISL++++E+IK  QA 
Sbjct: 617  GVYYRTDNTSRNYFEF-GSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQAL 675

Query: 528  MIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG---- 583
             I  D+ LY+E  D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK  +I G    
Sbjct: 676  FIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735

Query: 584  RCYIETIP----------EDRRATVEDGI----EIGFHSFESL-KDKMTDPED------- 621
            R Y E +           E+  A  ++GI    EI   + + L ++    PE+       
Sbjct: 736  RAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKE 795

Query: 622  ---DEAGIVIE--------FLTLLATCHTVIPETQSDG--TIKYQAASPDEGALVQGAAD 668
               D AG   E        F+  LA CHTV+ E   D    + ++A SPDE ALV  A D
Sbjct: 796  FVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARD 855

Query: 669  LGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK------LF 722
            +GF F  R  N V +      Q EY+LLN+ EFNSTRKRMS I ++P  +        L 
Sbjct: 856  MGFSFVGRTKNGVIVDIQ-GVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLI 914

Query: 723  CKGADTVILERLDSEFN-PYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEA 781
            CKGAD++I  RL    +   ++ T  HLE YA EGLRTLCIA R +  KEY+EW++ +E 
Sbjct: 915  CKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEI 974

Query: 782  ASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDR 841
            A+  + DR +E+++ A++IE +L  LG TAIED+LQ+GVP++I  L EAG+K+WVLTGD+
Sbjct: 975  AAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDK 1034

Query: 842  QETAINIGMSCRLLSEDMNLLIVN--------------EETKEDTRTNLQSKLNAI---- 883
             ETAINIG SC LL+ +M LL++               E  K      LQ K        
Sbjct: 1035 VETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYE 1094

Query: 884  ---ESHQISQQDMNSLALVIDGKSLGYALE-EDLEDQFLTIGKLCKAVICCRVSPLQKAL 939
               E+ ++ +    +  ++IDG +L  AL  +D++ +FL + K CKAV+CCRVSP QKA 
Sbjct: 1095 ELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAA 1154

Query: 940  VVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKL 999
            VVK+VK     + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D+AIGQFR+L +L
Sbjct: 1155 VVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRL 1214

Query: 1000 LIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVM 1059
            ++VHG WSY+R++  I   FYKN+   ++ FWY   N + G  + E   LT +N+ FT +
Sbjct: 1215 VLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSL 1274

Query: 1060 PPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFY 1119
            P   +GI DQ V   +    PQLY++G     ++ T FW ++ +  Y S + F    L Y
Sbjct: 1275 PVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCY 1334

Query: 1120 RYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGSLVIWLL 1177
                 +   G   DH  W VG++  +I +V     ++  Q  W  F+ + I  S    L 
Sbjct: 1335 YKTGIVTQNGFGLDHRYW-VGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSC---LC 1390

Query: 1178 FFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPES 1237
             F  ++ ++     S E+Y    H+YG   FW +     +F LL  F    + RTY P+ 
Sbjct: 1391 IFA-WTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKD 1449

Query: 1238 YHVVQEMQKYNISDYRP 1254
              +++E  K    D+ P
Sbjct: 1450 IDIIRECWKRGDFDHYP 1466

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 69/148 (46%), Gaps = 13/148 (8%)

Query: 144 EMNDYDQSNTNRYESSTRKFDIKVLFNRYILRKGKTSCKSDEPRTILLNDSSANSRFGYR 203
           E +  D  N   Y+ S R+ + + ++    L           P  IL  D   NS   Y 
Sbjct: 195 EGHSSDDDNDENYDKSHRQRETRTIYYNLPL-----------PEDIL--DEDGNSTIYYP 241

Query: 204 DNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVVLI 263
            N I TTKY   TF PK +  +F   AN++FL   I+         N       L+V+++
Sbjct: 242 RNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVV 301

Query: 264 VSAVKESVEDLKRSNADKELNHSLCDVL 291
           +++ K+++ED +R+  D E+N++   +L
Sbjct: 302 LTSFKDAIEDSRRTILDMEVNNAPTHIL 329

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1121 (37%), Positives = 615/1121 (54%), Gaps = 101/1121 (9%)

Query: 269  ESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILS 328
            +++  L  S+    LN +L  V D R G   +  W DI VGDI+R+ + + IPAD+I+LS
Sbjct: 374  DNIGQLVSSDQVSVLNRNLPPVPDCRFG---KSHWKDIRVGDIVRIHNNDEIPADIILLS 430

Query: 329  SSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEG 388
            +S+ +G CY+ET NLDGETNLK++Q+ + +    + K + +    V+SE P+++LY+Y+G
Sbjct: 431  TSDADGACYVETKNLDGETNLKVRQSLKCSHRIRNSKDISRCKFWVESEGPHANLYSYQG 490

Query: 389  TMTLNGSTF------PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRT 442
                  S        P++ + MLLRG +LRNT W  G+++FTG +TK+M NA  TP KR+
Sbjct: 491  NFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWAMGIVMFTGTDTKIMLNAGVTPTKRS 550

Query: 443  AVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTF 502
             + R +N  ++  F  L VL L +   N I  +RD+    +    GT     F   IL F
Sbjct: 551  RISRELNYSVILNFVFLFVLCLAAGLVNGIYYRRDATSRTFFEF-GTVAGTPFANGILAF 609

Query: 503  W---ILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIE 559
            +   IL+ +LVPISL++++E+IK  QA  I  D+ LY+ + D P   RT ++ ++LGQIE
Sbjct: 610  FVALILYQSLVPISLYISIEIIKTAQAAFIYGDVLLYNPKLDYPCTPRTWNISDDLGQIE 669

Query: 560  YIFSDKTGTLTRNVMEFKSVSIAG----RCYIET----------------------IPED 593
            YIFSDKTGTLT+NVMEFK  +I G    R Y E                       I ED
Sbjct: 670  YIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDIEEEGARERAEIEED 729

Query: 594  RRATVEDGIEIG-----------FHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIP 642
            ++  VE  +++G           F S E ++D       ++   V  F+  LA CH+V+ 
Sbjct: 730  KKQMVELLLKLGKNSQLDPHTVTFVSKELVQDLGGANSQEQKEAVEHFMLSLALCHSVVV 789

Query: 643  ETQSDGTIKY--QAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICE 700
            E   +   K   +A SPDE ALV+ A D+GF F  R  N V I      Q E+++LN+ E
Sbjct: 790  EENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNGVIIEIQ-GVQKEFRILNVLE 848

Query: 701  FNSTRKRMSAIFRMP--DGSIK----LFCKGADTVILERLDSEFN--PYVQSTLRHLEDY 752
            FNSTRKRMS I ++P  D + K    L CKGAD+VI  RLD   N    ++ T  HLE +
Sbjct: 849  FNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSRNDPKLLERTALHLEQF 908

Query: 753  AAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAI 812
            A EGLRTLC+A R I   EY  W++  E A+ ++ +R E L+R A+ IE  L  LG TAI
Sbjct: 909  ATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERVADAIERQLVLLGGTAI 968

Query: 813  EDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKE-- 870
            ED+LQ+GVP++I  L +AG+K+WVLTGD+ ETAINIG SC LL  DM LL++    ++  
Sbjct: 969  EDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNLLGSDMELLVIKSSGEDVE 1028

Query: 871  -----DTRTNLQSKLNAIESH----------QISQQD----MNSLALVIDGKSLGYALE- 910
                 D+   L      +E+H            +++D     ++  +VIDG +L  AL  
Sbjct: 1029 HLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKDHTPPQSAFGVVIDGDALKLALHG 1088

Query: 911  EDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHV 970
            ED+  +FL + K CKAV+CCRVSP QKA VVK+VK     + LAIGDG+NDV+MIQAA V
Sbjct: 1089 EDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADV 1148

Query: 971  GVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQF 1030
            G+GI+G EG QA  SAD+AIGQFR+L +L++VHG WSY+R++  I   FYKN+   +  F
Sbjct: 1149 GIGIAGEEGRQAVMSADYAIGQFRYLTRLVLVHGRWSYKRLAEMIPQFFYKNITFTLALF 1208

Query: 1031 WYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQ 1090
            W+   + + G  + E   L FYN+ FT +P   +GI DQ  +  L    PQLYK+G    
Sbjct: 1209 WFGICSNYDGSYLFEYTYLMFYNLAFTSLPVIFLGIMDQDASDVLSVVVPQLYKVGILRT 1268

Query: 1091 FFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVL 1150
             ++   FW +  +G Y S + F    L Y     +       DH  +  G++ TSI +V 
Sbjct: 1269 EWTQNKFWWYCFDGVYQSIICFFFPYLCYYRTGLITKNAYGLDH-RYTFGVFVTSIAVVS 1327

Query: 1151 GKAALITSQ--WTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATF 1208
                ++  Q  W  FT + I   L   +LF  F++ V+     S E+Y     +Y    F
Sbjct: 1328 CNLYVLIHQYRWDWFTTLFI--FLSCGILF--FWTGVWSSATYSGEFYKTAVRLYAQPVF 1383

Query: 1209 WLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEM----------QKYNISD-YRPRME 1257
            W +  V  +F LL  F W   ++ + P    +V+E           + Y+ +D  RPR+ 
Sbjct: 1384 WAVLFVGVIFCLLPRFTWDAVQKLFFPRDIDIVRECWWRGDFDMYPEDYDPTDPNRPRIN 1443

Query: 1258 QFQKAIRKVRQVQRMKKQRGFAFSQSEEGGQDRIIRMYDTT 1298
                 + +    +R +       +++    +D  + + D T
Sbjct: 1444 VSHTGVDRASDDERSRTGSDLGVTRTTVISEDIPMGLIDKT 1484

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 48/90 (53%)

Query: 202 YRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVV 261
           Y  N I TTKY   +FLPK L  +F   AN++FL    +  V     TN       L+ +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 262 LIVSAVKESVEDLKRSNADKELNHSLCDVL 291
           ++++ +K++ ED +R+  D E+N+    +L
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNNMRSHIL 292

>Scas_636.16
          Length = 1554

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1061 (38%), Positives = 597/1061 (56%), Gaps = 94/1061 (8%)

Query: 274  LKRSNADKELNHSLCDVLDER-----SGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILS 328
            L++SN D    +    VLD       + +F    W ++ VGDI+R+ + + IPAD+I+LS
Sbjct: 343  LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402

Query: 329  SSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEG 388
            +S+ +G CY+ET NLDGE+NLK++Q+ + T    + + +C+    V+SE P+++LY Y+G
Sbjct: 403  TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462

Query: 389  TM----TLNGSTF--PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRT 442
             +    +L+G T   P++ + MLLRG TLRNT W  G++VFTG +TK M NA  TP K++
Sbjct: 463  NLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKS 522

Query: 443  AVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTF 502
             + R +N  +L  F  L +L LI+   N    ++      +    GT          ++F
Sbjct: 523  RISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEF-GTIAGNPTTNGFVSF 581

Query: 503  W---ILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIE 559
            W   IL+ +LVPISL+++VE+IK  QA  I  D+ LY+E  D P   ++ S+ ++LGQIE
Sbjct: 582  WVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIE 641

Query: 560  YIFSDKTGTLTRNVMEFKSVSIAG----RCYIET----------------------IPED 593
            YIFSDKTGTLT+NVMEFK  +I G    R Y E                       I +D
Sbjct: 642  YIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQD 701

Query: 594  RRATVED-----------GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVI- 641
            R   ++D             E+ F S E  +D + +  + +      F+  LA CH+V+ 
Sbjct: 702  REIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLV 761

Query: 642  -PETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICE 700
             P+      ++  A SPDE ALV  A D+GF F  +    + +      Q E+Q+LNI E
Sbjct: 762  EPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQ-GIQKEFQILNILE 820

Query: 701  FNSTRKRMSAIFRMPDGSIK------LFCKGADTVILERLDSE--FN--PYVQSTLRHLE 750
            FNS+RKRMS I ++P  + K      L CKGAD+VI  RL  +  +N    ++ T  HLE
Sbjct: 821  FNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLE 880

Query: 751  DYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGAT 810
             YA EGLRTLC+  R I   EY+EW++ Y  A+ ++  R EELD  A+LIE DL  LG T
Sbjct: 881  QYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGGT 940

Query: 811  AIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVN---EE 867
            AIED+LQ+GVP++I  L EAG+K+WVLTGD+ ETAINIG SC LL+ DM LL++    E+
Sbjct: 941  AIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGED 1000

Query: 868  TKE--DTRTN---------LQSKLNAIESHQ---ISQQD----MNSLALVIDGKSLGYAL 909
             KE  D  T          L  K N   S +    +++D        A++IDG++L  AL
Sbjct: 1001 VKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIAL 1060

Query: 910  EED-LEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAA 968
              D ++ +FL + K CKAV+CCRVSP QKA VVK+VK     + LAIGDG+NDV+MIQ+A
Sbjct: 1061 TGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSA 1120

Query: 969  HVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMT 1028
             VGVGI+G EG QA   +D+AIGQFR++ +L++VHG W Y+R++  I   FYKN+   + 
Sbjct: 1121 DVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLA 1180

Query: 1029 QFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQK 1088
             FWY   N F G  + E   LTFYN+ FT +P   +GI DQ V++ +    PQLY+ G  
Sbjct: 1181 LFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGIL 1240

Query: 1089 GQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIII 1148
             Q ++ T F  ++ +G Y S + +    L YR  N +   G   DH  + VGI  T I +
Sbjct: 1241 RQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYY-VGIPVTGIAV 1299

Query: 1149 VLGKAALITSQ--WTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSA 1206
                  ++  Q  W  FT      S +++  +   +S+       S E++     +YG+ 
Sbjct: 1300 TSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSI----ASYEFWKGASRMYGTP 1355

Query: 1207 TFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKY 1247
            +FW +  V  +F +L  F +  + +   P    +++EM ++
Sbjct: 1356 SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQH 1396

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 62/118 (52%), Gaps = 8/118 (6%)

Query: 182 KSDEPRTILLNDSSANSRF--------GYRDNHISTTKYNAATFLPKFLFQEFSKYANLF 233
           +SDE RTI  N    +            Y  N I TTKY   TF PK +  +F+ +AN++
Sbjct: 140 RSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIY 199

Query: 234 FLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVL 291
           FL   I+        TN       L+V++I++A+K+++ED +R+  D E+N++   +L
Sbjct: 200 FLIMIILGAFQIFGVTNPGLAAVPLIVIIILTAIKDAIEDSRRTLLDMEVNNTRTHIL 257

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1042 (38%), Positives = 577/1042 (55%), Gaps = 95/1042 (9%)

Query: 298  FVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQE 357
            F R  W  + VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++QA + 
Sbjct: 389  FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448

Query: 358  TANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTF------PLSPDQMLLRGATL 411
            +      + + +    ++SE P+++LY+Y+G +    ST       P++ + MLLRG TL
Sbjct: 449  SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508

Query: 412  RNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNV 471
            RNT W  G++VFTG +TK+M NA  TP K++ + R +N  +L  F VL +L  IS   N 
Sbjct: 509  RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568

Query: 472  IMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQAYM 528
            I   +      +    GT          ++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 569  IDYDKHPRSRDFFEF-GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 627

Query: 529  IGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG----R 584
            I  D+ LY+ + D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK  +I G    R
Sbjct: 628  IYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 687

Query: 585  CYIET----------------------IPEDRRATVED-----------GIEIGFHSFES 611
             Y E                       I +DR   + D             EI F S E 
Sbjct: 688  AYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747

Query: 612  LKDKMTDPEDDEAGIVIEFLTLLATCHTVI--PETQSDGTIKYQAASPDEGALVQGAADL 669
            ++D      D +      F+  LA CH+V+  P   +   ++ +A SPDE ALV  A DL
Sbjct: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDL 807

Query: 670  GFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK------LFC 723
            GF F  +    + +      Q E+++LNI EFNS RKRMS I ++P  +        L C
Sbjct: 808  GFCFMGKTKTGMVVEIQ-GIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLIC 866

Query: 724  KGADTVILERLDSEFNP----YVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIY 779
            KGAD+VI  RL ++        ++ T  HLE YA EGLRTLC+A R +   EY EW+  Y
Sbjct: 867  KGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARY 926

Query: 780  EAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTG 839
            + A+ ++ +R E+L+  ++ IE DL  LG TAIED+LQ+GVPE+I  L EAG+K+WVLTG
Sbjct: 927  DIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTG 986

Query: 840  DRQETAINIGMSCRLLSEDMNLLIVNE------ETKEDTRTNLQSKL------------- 880
            D+ ETAINIG SC LL+ DM LL+V        E  ED    + S +             
Sbjct: 987  DKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGS 1046

Query: 881  -----NAIESHQISQQDMNSLALVIDGKSLGYALE-EDLEDQFLTIGKLCKAVICCRVSP 934
                 NA   H   + D    A+VIDG +L  AL  +D++ +FL + K CKAV+CCRVSP
Sbjct: 1047 EMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSP 1103

Query: 935  LQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFR 994
             QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+AIGQFR
Sbjct: 1104 AQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFR 1163

Query: 995  FLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNV 1054
            +L +LL+VHG WSY+R+S  I   FYKN+   +  FWY   N F G  + E   L FYN+
Sbjct: 1164 YLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNL 1223

Query: 1055 FFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIG 1114
             FT +P  ++GI DQ V   +    PQLY++G     ++ T F  ++ +G Y S + F  
Sbjct: 1224 AFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFF 1283

Query: 1115 SVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGSL 1172
              L Y+    +   G   +H  + VGI  T+I +      ++  Q  W  F+   I  S 
Sbjct: 1284 PYLLYKRNGVVTKNGMGLEHRYY-VGIIVTTIAVFACNLYILIHQYRWDWFSGFFIFLSC 1342

Query: 1173 VIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRT 1232
            ++ + +   +++ F  +++ K        +Y S +FW +  +   F LL  F W  Y + 
Sbjct: 1343 IVVIGWTGIWTSSFTSLDLWKAGE----RIYDSPSFWAVFFIGVFFCLLPRFTWDCYTQF 1398

Query: 1233 YSPESYHVVQEMQKYNISDYRP 1254
            ++P    +++EM K    D+ P
Sbjct: 1399 FNPSDVQIIREMWKRGDYDHYP 1420

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 125/289 (43%), Gaps = 36/289 (12%)

Query: 25  MSGSTKHGDSDALFDVDFLDDSYTPDLRDSPRRNSPSA----VIDSGMDTSQRGLLPQET 80
           MSGS K G+ D  F     DD++  +  D+   NS S        SG       +  +ET
Sbjct: 1   MSGSNKPGNGD--FITSPFDDAFEFEEGDNTVNNSSSNGNGHTSGSGNWNDGHKMEEKET 58

Query: 81  IDLSDNIENDIEN-----PFNDRYSASFADTNPRNSVLPQPSGFNRFMSNVKSAVGMNGG 135
             L+D+ + +I +           +  F D    N      S   R M  ++       G
Sbjct: 59  T-LADDTDIEISSIQPTPHLGGAKTGMFDDVALDNDDHNDSS---REMKRLRMGTRRVKG 114

Query: 136 HKGQFQSFEMNDYDQSNTNRYESSTRKFDIKVLFNRYIL----RKGKTSCKSDEPRTILL 191
           HK QF +   N      T ++     K +IK  F+ +         +++ ++D+ RT+  
Sbjct: 115 HKSQFGNMSRN-----KTLKWA----KKNIKNPFDDFSRDEEEENDRSTNRADQLRTVYH 165

Query: 192 N--------DSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQV 243
           N        D   N    Y  N I TTKY   +F PK L  +F  +AN++FL   I+   
Sbjct: 166 NLPLPEEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAF 225

Query: 244 PNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLD 292
                TN   +   L+V++I++A+K+ +ED +R+  D E+N++   +L+
Sbjct: 226 QIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILE 274

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1057 (37%), Positives = 592/1057 (56%), Gaps = 104/1057 (9%)

Query: 298  FVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQE 357
            F +  W ++ VGDI+RV + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+ + 
Sbjct: 438  FAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKC 497

Query: 358  TANYLDEKALCKLHGRVQSEHPNSSLYTYEGTM----TLNGS--TFPLSPDQMLLRGATL 411
            +      + + +    V+SE P+++LY+Y+G      T NG+    P++ + +LLRG TL
Sbjct: 498  SKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTL 557

Query: 412  RNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNV 471
            RNT W  G+++FTG +TK+M NA  TP K++ + R +N  ++  F +L +L   +   N 
Sbjct: 558  RNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNG 617

Query: 472  IMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQAYM 528
            +  K+      Y    GT          ++FW   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 618  VYYKQKPRSRDYFEF-GTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIF 676

Query: 529  IGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG----R 584
            I +D+ LY+ + D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK  +I G    R
Sbjct: 677  IYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 736

Query: 585  CYIET----------------------IPEDRRATVED-----------GIEIGFHSFES 611
             Y E                       I +DR   +++             ++ F S E 
Sbjct: 737  AYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEI 796

Query: 612  LKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKY--QAASPDEGALVQGAADL 669
            ++D      D +      FL  LA CH+V+ E   D   K   +A SPDE ALV  A  L
Sbjct: 797  VEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQL 856

Query: 670  GFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK------LFC 723
            G+ F +    S  I      Q E+Q+LN+ EFNS+RKRMS I ++P  + K      L C
Sbjct: 857  GYSF-VGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLIC 915

Query: 724  KGADTVILERLDSEFN--PYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEA 781
            KGAD+VI  RLD   N    ++ T  HLE+YA EGLRTLC+A R +   EYE W K Y+ 
Sbjct: 916  KGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDV 975

Query: 782  ASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDR 841
            A+ ++ +R EELD+  ++IE +L  LG TAIED+LQ+GVP++I  L EAG+K+WVLTGD+
Sbjct: 976  AAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDK 1035

Query: 842  QETAINIGMSCRLLSEDMNLLIVN---EETKE------DTRTNLQSKL------------ 880
             ETAINIG SC +L+ DM LL+V    E+ +E          NL +K             
Sbjct: 1036 VETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEE 1095

Query: 881  ---NAIESHQISQQDMNSLALVIDGKSLGYALE-EDLEDQFLTIGKLCKAVICCRVSPLQ 936
                A   H + Q    + A++IDG +L  AL  E++  +FL + K CKAV+CCRVSP Q
Sbjct: 1096 ELKEAKREHGLPQ---GNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQ 1152

Query: 937  KALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFL 996
            KA VVK+VK+    + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+AIGQFR++
Sbjct: 1153 KAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYV 1212

Query: 997  RKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFF 1056
             +L++VHG W Y+R++  I   FYKN+   ++ FWY   N F G  + E   LTFYN+ F
Sbjct: 1213 TRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAF 1272

Query: 1057 TVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSV 1116
            T +P  ++ + DQ V+  +    PQLY++G   + ++ T F  ++L+G Y S + F    
Sbjct: 1273 TSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPY 1332

Query: 1117 LFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGSLVI 1174
            L Y     +   G   DH  + VG++ T+I +      +   Q  W  F  + I  SL +
Sbjct: 1333 LAYHKNMVVTENGLGLDHRYF-VGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAV 1391

Query: 1175 WLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYS 1234
                F  ++ ++   + S E+Y     V+    +W +  V  +F LL  F     ++ + 
Sbjct: 1392 ----FYGWTGIWTSSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFY 1447

Query: 1235 PESYHVVQEM----------QKYNISD-YRPRMEQFQ 1260
            P+   +V+EM          Q Y+ +D  RPR+ + +
Sbjct: 1448 PKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 8/126 (6%)

Query: 182 KSDEPRTILLN--------DSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLF 233
           +SDE RT+  N        D        Y  N I TTKY   TF PK +  +F  +AN++
Sbjct: 201 RSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIY 260

Query: 234 FLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDE 293
           FL   I+        TN       L+V++I++A+K+ +ED +R+  D E+N++   +L  
Sbjct: 261 FLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSG 320

Query: 294 RSGEFV 299
              E V
Sbjct: 321 VKNENV 326

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1042 (37%), Positives = 585/1042 (56%), Gaps = 93/1042 (8%)

Query: 297  EFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQ 356
            +F +  W  + VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++Q+ +
Sbjct: 392  KFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLK 451

Query: 357  ETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNG------STFPLSPDQMLLRGAT 410
             T      K + +    ++SE P+S+LYTY+G M             P++ + +LLRG T
Sbjct: 452  CTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCT 511

Query: 411  LRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGN 470
            LRNT W  G+++FTG +TK+M N+  TP K++ + R +N  ++  F +L +L  +S   N
Sbjct: 512  LRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIAN 571

Query: 471  -VIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQA 526
             V   K+  +   Y +  GT          ++FW   IL+ +LVPISL+++VE+IK  QA
Sbjct: 572  GVYYDKKGRSRFSYEF--GTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA 629

Query: 527  YMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG--- 583
              I  D+ LY+ + D P   ++ ++ ++LGQ+EYIFSDKTGTLT+NVMEFK  +I G   
Sbjct: 630  AFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSY 689

Query: 584  -RCYIETIP------------EDRRATVE---------DGI------------EIGFHSF 609
             R Y E +             E RR   E         D +            E+ F S 
Sbjct: 690  GRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSK 749

Query: 610  ESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKY--QAASPDEGALVQGAA 667
            E ++D      + +      F+  LA CH+V+ E   D   K   +A SPDE ALV  A 
Sbjct: 750  EFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATAR 809

Query: 668  DLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMP------DGSIKL 721
            D+GF F  +    + I      Q E+++LNI EFNS+RKRMS I ++P      +    L
Sbjct: 810  DVGFSFVGKTKKGLIIEMQ-GIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALL 868

Query: 722  FCKGADTVILERLD----SEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSK 777
             CKGAD++I  RL     S     ++ T  HLE YA EGLRTLCIA R +   EYE+W++
Sbjct: 869  ICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNE 928

Query: 778  IYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVL 837
             Y+ A+ ++ +R +EL+  A+ IE +L  LG TAIED+LQ+GVP+ I  L EAG+K+WVL
Sbjct: 929  KYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVL 988

Query: 838  TGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRT---------------------NL 876
            TGD+ ETAINIG SC LL+ +M LL++ + T +D +                      NL
Sbjct: 989  TGDKVETAINIGFSCNLLNNEMELLVI-KTTGDDVKEFGSEPSEIVDALLSKYLKEYFNL 1047

Query: 877  QSKLNAI-ESHQISQQDMNSLALVIDGKSLGYAL-EEDLEDQFLTIGKLCKAVICCRVSP 934
                  I E+ +  +    + A+VIDG +L  AL  ED+  +FL + K C+AV+CCRVSP
Sbjct: 1048 TGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSP 1107

Query: 935  LQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFR 994
             QKA VVK+VK     + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+AIGQFR
Sbjct: 1108 SQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFR 1167

Query: 995  FLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNV 1054
            +L +L++VHG WSY+R++  I   FYKNM   +  FWY   N F G  + E   + FYN+
Sbjct: 1168 YLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNL 1227

Query: 1055 FFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIG 1114
             FT +P   +GI DQ V   +    PQLY++G   + ++   F  ++L+G Y S + F  
Sbjct: 1228 AFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFF 1287

Query: 1115 SVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGSL 1172
              L Y     +   G   DH  + VG+Y T+I ++     ++  Q  W  F+ + I  S 
Sbjct: 1288 PYLVYHKNMIVTSNGLGLDHRYF-VGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSC 1346

Query: 1173 VIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRT 1232
            ++   +   +S+       S+E++     +YG+ +FW +  V  +F LL  F +  +++ 
Sbjct: 1347 LVVFAWTGIWSSAI----ASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKF 1402

Query: 1233 YSPESYHVVQEMQKYNISDYRP 1254
            + P    +V+EM ++   D+ P
Sbjct: 1403 FYPTDVEIVREMWQHGHFDHYP 1424

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 182 KSDEPRTILLN--------DSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLF 233
           ++ E RT+  N        D   N    Y  N I TTKY   TFLPK +  +F  +AN++
Sbjct: 163 RAQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVY 222

Query: 234 FLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDE 293
           FL   I+        TN   +   L+V++I++A+K+++ED +R+  D E+N++   +L+ 
Sbjct: 223 FLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEG 282

Query: 294 RSGEFV 299
              E V
Sbjct: 283 VENENV 288

>Scas_576.8
          Length = 1591

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1075 (37%), Positives = 596/1075 (55%), Gaps = 98/1075 (9%)

Query: 297  EFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQ 356
            +F +  W ++ VGDI+R+ + + IPAD+I+LS+S+ +G CY+ET NLDGETNLK++++ +
Sbjct: 408  KFSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLK 467

Query: 357  ETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGS------TFPLSPDQMLLRGAT 410
             + +  + + + +    V+SE P+++LY+Y+G +    S        P++ + +LLRG T
Sbjct: 468  CSHSIRNSRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCT 527

Query: 411  LRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGN 470
            LRNT W  G++VFTG +TK+M N+ ATP K++ + R +N+ +   F  L ++  IS+  N
Sbjct: 528  LRNTKWAMGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIIN 587

Query: 471  VIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFW---ILFSNLVPISLFVTVEMIKYYQAY 527
             +   +      +    GT          ++FW   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 588  GVDYDKHPRSRDFFEF-GTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAA 646

Query: 528  MIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAG---- 583
             I  D+ LY+ + D P   ++ ++ +++GQIEYIFSDKTGTLT+NVMEFK  +I G    
Sbjct: 647  FIYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYG 706

Query: 584  RCYIET----------------------IPEDRRATVED-----------GIEIGFHSFE 610
            R Y E                       I +DR   +               +I F S E
Sbjct: 707  RAYTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKE 766

Query: 611  SLKDKMTDPEDDEAGIVIEFLTLLATCHTVI--PETQSDGTIKYQAASPDEGALVQGAAD 668
             + D      D +      F+  LA CH+V+  P       +  +A SPDE ALV  A D
Sbjct: 767  FVNDLKGASGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARD 826

Query: 669  LGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK------LF 722
            +GF F I +  +  I      Q E+Q+LN  EFNSTRKRMS I ++P  +        L 
Sbjct: 827  VGFSF-IGKTKTGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLI 885

Query: 723  CKGADTVILERLDSEFNP----YVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKI 778
            CKGAD++I  RL ++        ++ T  HLE YA EGLRTLCIA R +   EY EW+K 
Sbjct: 886  CKGADSIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKR 945

Query: 779  YEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLT 838
            Y+ A+ ++ +R E+L+  ++ IE +L  LG TAIED+LQ+GVPE+I  L +AG+K+WVLT
Sbjct: 946  YDIAAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLT 1005

Query: 839  GDRQETAINIGMSCRLLSEDMNLLIVN-------------EETKEDTRTN-LQSKL---- 880
            GD+ ETAINIG SC LL+ DM LL+V               E  E   T  L+ K     
Sbjct: 1006 GDKVETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTG 1065

Query: 881  ------NAIESHQISQQDMNSLALVIDGKSLGYALE-EDLEDQFLTIGKLCKAVICCRVS 933
                  +A ++H   + D    A+VIDG++L  AL  E +  +FL + K CKAV+CCRVS
Sbjct: 1066 SEMELADAKKNHDFPRGD---FAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVS 1122

Query: 934  PLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQF 993
            P QKA VVK+V      + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+AIGQF
Sbjct: 1123 PAQKAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQF 1182

Query: 994  RFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYN 1053
            R+L +L++VHG WSY+R++  I   FYKN+   +  FWY   N F G  + E   L FYN
Sbjct: 1183 RYLTRLVLVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYN 1242

Query: 1054 VFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFI 1113
            + FT +P   +GI DQ V+  +    PQLY+ G     ++ T F  ++L+G Y S + F 
Sbjct: 1243 LAFTSLPVIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFF 1302

Query: 1114 GSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ--WTKFTLVAIPGS 1171
                 Y     ++  G   DH  + VG+  TS+ +V     ++  Q  W  F+ + I  S
Sbjct: 1303 FPYCLYHKNQIVSNNGLGLDHRFY-VGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLS 1361

Query: 1172 LVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKR 1231
             +I  LF  F++ V+     SKE++     +YG+ +FW +  V  V+ LL  F    +++
Sbjct: 1362 CII--LF--FWTGVWSSSLTSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFRK 1417

Query: 1232 TYSPESYHVVQEM-QKYNISDYRPRMEQFQKAIRKVRQVQRMKKQ--RGFAFSQS 1283
             + P    +V+EM Q+ + S Y P  +       KV +  +  ++   G   SQS
Sbjct: 1418 FFYPTDVEIVREMWQRGDFSHYPPGYDPTDPNRPKVAKSGKFGERIVEGIHLSQS 1472

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 53/91 (58%)

Query: 202 YRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVV 261
           Y  N I TTKY+   F PK +  +F  +AN++FL   I+        TN       L+V+
Sbjct: 201 YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGVTNPGLAAVPLIVI 260

Query: 262 LIVSAVKESVEDLKRSNADKELNHSLCDVLD 292
           +I++A+K+++ED +R+  D E+N++   +L+
Sbjct: 261 VIITAIKDAIEDSRRTLLDMEVNNTRTHILE 291

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  457 bits (1175), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 341/1050 (32%), Positives = 527/1050 (50%), Gaps = 84/1050 (8%)

Query: 202  YRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVV 261
            Y  N IS  KYN  TF+P  L+++F  + NL+FL  ++ Q +P +      + I  L  V
Sbjct: 166  YPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 225

Query: 262  LIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIP 321
            L+V+  KE+++D++R   DKE N+ L +VL++   + V  K  D+ VGD+I++     IP
Sbjct: 226  LMVTMSKEAMDDIQRRQRDKESNNELYEVLNK--AQLVPSK--DLKVGDLIKIHKGTRIP 281

Query: 322  ADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNS 381
            ADL++L SSEP G  +I+T  LDGET+ K++ A   T N   +  L K+   + +  P  
Sbjct: 282  ADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKI--SITASSPEK 339

Query: 382  SLYTYEGTMTL-NGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIK 440
            S++ + G +T  + S+  LS D  +     L +     G +V+TG +T+   N T + +K
Sbjct: 340  SIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVK 399

Query: 441  RTAVERVINM--QILA--LFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFF 496
               +E  IN   +IL   +F + IVL   +  GN     +D                 ++
Sbjct: 400  TGLLELEINSLSKILCACVFVLSIVLVAFAGFGN-----KD-----------------WY 437

Query: 497  KDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELG 556
             DI+ + ILFS ++P+SL V +++ K   A  I       H+ +   T+VRTS++ E+LG
Sbjct: 438  VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIE------HDATIPDTIVRTSTIPEDLG 491

Query: 557  QIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKM 616
            +IEY+ SDKTGTLT+N M+ K + +    Y      D    V D ++    S  +     
Sbjct: 492  RIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTM----DTMDIVTDYVQELVSSSTTTPMPQ 547

Query: 617  TDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIR 676
            +  + D    V + +  LA CH V P T  DG + YQAASPDE A+V+    +G     R
Sbjct: 548  STAKKDLPNRVRDLVVTLAICHNVTP-TFEDGELTYQAASPDEIAIVKFTESVGLSLFKR 606

Query: 677  RPNSVSISTPFSE-QLEYQLLNICEFNSTRKRMSAI-FRMPDGSIKLFCKGADTVILERL 734
              +SVS+    S    EY +L +  FNS  KRM  I +    G      KGADTV+   +
Sbjct: 607  DRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIV 666

Query: 735  DSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELD 794
             S  N ++   + ++   A EGLRTL I  + +  K YE++ K Y  AS +M +R E + 
Sbjct: 667  QS--NDWLDEEVGNM---AREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMS 721

Query: 795  RA-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCR 853
                + +EH+L  LG T +EDKLQ  V  +I  L+ AG+K+W+LTGD+ ETA  + +S +
Sbjct: 722  SVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAK 781

Query: 854  LLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDL 913
            L+S    +  V + ++       +  LNA+E  +I++    S  L+IDG+SLG  L    
Sbjct: 782  LISRGQYVHTVTKLSRP------EGALNALEYLKINK----SSCLLIDGESLGMFLTY-Y 830

Query: 914  EDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVG 973
            + +F  I     AVI CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGVG
Sbjct: 831  KQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVG 890

Query: 974  ISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYV 1033
            I G EG QA+ +ADF++ QF  L KLL+ HG  SY+R +    +  ++ + + + Q  Y 
Sbjct: 891  IVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYS 950

Query: 1034 FANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFS 1093
              + F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK    G   S
Sbjct: 951  VCSKFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLS 1009

Query: 1094 VTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKA 1153
               F+ WV+   +    +   S  F           +  D        +T  +I  L   
Sbjct: 1010 YKTFFVWVILSLFQGCAIQGISQYFTSL--------DEVDFKKLVALSFTALVINELIMV 1061

Query: 1154 ALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCI 1213
            AL    W K  ++    + +I+++  PF S  F    VS+  +      Y    F L   
Sbjct: 1062 ALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPF------YAKLIFILAVS 1115

Query: 1214 VLPVFALLRDFVWKYYKRTYSPESYHVVQE 1243
            V PV+A       K   R  +P +Y  VQ+
Sbjct: 1116 VFPVWAA------KAIHRKINPPNYAKVQQ 1139

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  451 bits (1160), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 334/1050 (31%), Positives = 533/1050 (50%), Gaps = 74/1050 (7%)

Query: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258
            R  Y  N +S  KYNA TF+P  L+++F  + NL+FL  ++ Q VP +      + I  L
Sbjct: 167  RNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPL 226

Query: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318
              VL V+  KE+++D++R   D+E N+ L  V+  R+     K   D+ VGD+I+V   +
Sbjct: 227  AFVLTVTMAKEAIDDIQRRRRDRESNNELYHVI-TRNRSIPSK---DLKVGDLIKVHKGD 282

Query: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378
             IPADL++L SSEP G  +I+T  LDGET+ K++ A   T N  +   + ++   + +  
Sbjct: 283  RIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRI--SITASA 340

Query: 379  PNSSLYTYEGTMTLNGSTF-PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437
            P  S++ + G +T   ST  PLS D  L     L ++ +    +V+TG +T+   N T  
Sbjct: 341  PEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTA 400

Query: 438  PIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFK 497
             +K   +E  IN     L   +  L+       +++      H    YI           
Sbjct: 401  KVKTGLLELEINSISKILCACVFALS-------ILLVAFAGFHNDDWYI----------- 442

Query: 498  DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQ 557
            DIL + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG+
Sbjct: 443  DILRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGR 496

Query: 558  IEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMT 617
            IEY+ SDKTGTLT+N M+ K + +    Y     +     V+  +     S  + K  ++
Sbjct: 497  IEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALS 556

Query: 618  DPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRR 677
                D +  V + +  LA CH V P T  D  + YQAASPDE A+V+    +G     R 
Sbjct: 557  TTRKDMSFRVRDMILTLAICHNVTP-TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD 615

Query: 678  PNSVSISTPFS-EQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFC-KGADTVILERLD 735
             +S+S+    S + L Y++L +  FNS  KRM  I R        F  KGADTV+ + ++
Sbjct: 616  RHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVE 675

Query: 736  SEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDR 795
            S  N +++    ++   A EGLRTL I  + + +K YE++ K Y  AS +M +R +++ +
Sbjct: 676  S--NDWLEEETGNM---AREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQ 730

Query: 796  A-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRL 854
               + +EHDL  LG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD+ ETA  + +S +L
Sbjct: 731  VITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 790

Query: 855  LSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLE 914
            +S    +  + + T+       +   N +E  +I++    +  L+IDG+SLG  L+   E
Sbjct: 791  ISRGQYVHTITKVTRP------EGAFNQLEYLKINR----NACLLIDGESLGMFLKH-YE 839

Query: 915  DQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 974
             +F  +      VI CR +P QKA V  ++++ T   +  IGDG NDVSMIQ A VGVGI
Sbjct: 840  QEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGI 899

Query: 975  SGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVF 1034
             G EG QA+ +ADF+I QF  L +LL+ HG  SY+R +    +  ++ + + + Q  Y  
Sbjct: 900  VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSI 959

Query: 1035 ANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSV 1094
             + F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK   +G+  S 
Sbjct: 960  CSLFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSY 1018

Query: 1095 TIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIII-VLGKA 1153
              F+ WVL   +  +V+ + S  F    +           +   V I  T++++  L   
Sbjct: 1019 KTFFVWVLLSLFQGSVIQLFSQAFTSLLDT---------DFTRMVAISFTALVVNELIMV 1069

Query: 1154 ALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCI 1213
            AL    W K  LV    +L+ +++  PF    F    ++   Y      Y      L+  
Sbjct: 1070 ALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNY------YAGLLVILLIS 1123

Query: 1214 VLPVFALLRDFVWKYYKRTYSPESYHVVQE 1243
            + PV+        K   R   P SY  VQE
Sbjct: 1124 IFPVWTA------KAIYRRLHPPSYAKVQE 1147

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  451 bits (1161), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 335/1063 (31%), Positives = 542/1063 (50%), Gaps = 79/1063 (7%)

Query: 187  RTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNV 246
            R I L+ +    +  Y  N IS  KYNA TFLP  L+++F  + NL+FL  S+ Q +P +
Sbjct: 173  REIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPAL 232

Query: 247  TPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDI 306
                  + I  L  VL+V+  KE+++D++R   D+E N+ L +VL+  + + V  K  ++
Sbjct: 233  RIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLN--NSQLVPSK--NL 288

Query: 307  AVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKA 366
             VGD++++  +  IPAD+I+L SSEP G  +++T  LDGET+ K++ A   T N   ++ 
Sbjct: 289  RVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEM 348

Query: 367  LCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGH 426
            L K+H  + +  P  S++ + G +T  GS+ PLS D  L     L ++      +++TG 
Sbjct: 349  LTKVH--ITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVIYTGT 406

Query: 427  ETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYI 486
            +T+   N + + +K   +E  IN    +L  +L +     S   V++   D         
Sbjct: 407  DTRQAMNTSKSSVKTGLLELEIN----SLSKILCICVFTLSILLVVIGGLDDDK------ 456

Query: 487  EGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVV 546
                    ++ DI+ + ILFS ++P+SL V +++ K   A  I SD      +S   T+V
Sbjct: 457  --------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESD------KSIPDTIV 502

Query: 547  RTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCY-IETIP--EDRRATVEDGIE 603
            RTS++ E+LG+IEY+ SDKTGTLT+N M+ + + +    Y +ET+    D   T+     
Sbjct: 503  RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPAN 562

Query: 604  IGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALV 663
            +G          +T    + +  V + +  LATCH V P  + D  + YQAASPDE A+V
Sbjct: 563  MGAAGV-----AVTGSRKEVSQRVRDLVVTLATCHNVTPNFE-DNELAYQAASPDEIAIV 616

Query: 664  QGAADLGFRFDIRRPNSVSISTPFSE-QLEYQLLNICEFNSTRKRMSAIFR-MPDGSIKL 721
            +    +G     R  +S+++   +S   L+Y +L++  F S  KRM  I R      I  
Sbjct: 617  KFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWF 676

Query: 722  FCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEA 781
              KGADTV+ + + S  N +++     + + A EGLRTL IA + +  + YE++SK Y+ 
Sbjct: 677  LQKGADTVMSKIVQS--NDWLE---EEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKD 731

Query: 782  ASTTMKDRTEELDRAAEL-IEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGD 840
            AS +M +R E ++   +  +EH+L  LG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD
Sbjct: 732  ASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGD 791

Query: 841  RQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVI 900
            + ETA  + +S +L+S    +  + + T+ D          A+   +  + + NS  L+I
Sbjct: 792  KVETARCVCVSAKLISRGQYVHTITKLTRRD---------GALSRLEYLKANRNS-CLLI 841

Query: 901  DGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGAN 960
            DG SL   +      +F  I      VI CR +P QKA V  +++  T   +  IGDG N
Sbjct: 842  DGDSLAIYMSH-YRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGN 900

Query: 961  DVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFY 1020
            DVSMIQ A VGVGI G EG QA+ +AD++I QF  L KLL+ HG  SY+R +    +  +
Sbjct: 901  DVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIH 960

Query: 1021 KNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYP 1080
            + + + + Q  Y  ++     ++ + W +  Y   +T+ P F + + D  +   L   YP
Sbjct: 961  RGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYP 1019

Query: 1081 QLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVG 1140
            +LYK   +G+  S   F+ WV+   +  AV+   S LF      + +G E     V    
Sbjct: 1020 ELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLF------IGVGSEVFKKMV--AL 1071

Query: 1141 IYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIG 1200
             +T  +I  L   AL    W K   ++   +  I++L  P     F   ++    + I  
Sbjct: 1072 SFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFI-- 1129

Query: 1201 HVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQE 1243
                  T  L   + PV+A       K   R   P S+  VQ+
Sbjct: 1130 ----QLTIILTVSIFPVWAA------KTIHRRLKPPSHAKVQQ 1162

>Scas_704.38
          Length = 1161

 Score =  445 bits (1144), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 324/1058 (30%), Positives = 527/1058 (49%), Gaps = 90/1058 (8%)

Query: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258
            R  Y  N IS  KYNA TF+P  L+++F  + NL+FL  ++ Q +P +      + +  L
Sbjct: 177  RNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPL 236

Query: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318
              VL V+  KE+++D++R   D E N  L  VL++   + V  K  D+ VGD+I++   +
Sbjct: 237  AFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQ--SKLVPSK--DLKVGDLIKISKGD 292

Query: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378
             +PADL++L SSEP G  +I+T  LDGET+ K++ A   T N  +   + K+   + +  
Sbjct: 293  RLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKV--SITASA 350

Query: 379  PNSSLYTYEGTMTL-NGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437
            P  +++ + G +T  + S+ PLS D  L     L +T +  G +V+TG +T+   N T  
Sbjct: 351  PEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTA 410

Query: 438  PIKRTAVERVINM--QIL--ALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAG 493
             +K   +E  IN   +IL  ++F + I+L + +   N                       
Sbjct: 411  TVKTGLLELEINSISKILCASVFALSIILVVFAGFHN----------------------S 448

Query: 494  LFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVE 553
             ++ D++ + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E
Sbjct: 449  DWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDDTIPETIVRTSTIPE 502

Query: 554  ELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLK 613
            +LG+IEY+ SDKTGTLT+N M+ K + +    Y     +     V+  +     +  S K
Sbjct: 503  DLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGK 562

Query: 614  DKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRF 673
               +    D +  V + +  LA CH V P T  D  + YQAASPDE A+V+    +G   
Sbjct: 563  SVPSTSRKDLSARVRDMVVTLAICHNVTP-TFEDDELTYQAASPDEIAIVKFTESVGLSL 621

Query: 674  DIRRPNSVSISTPFSEQ-LEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFC-KGADTVIL 731
              R  +S+S+    S   L Y++L +  FNS  KRM  I          F  KGADTV+ 
Sbjct: 622  FKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMA 681

Query: 732  ERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTE 791
              +  E N +++    ++   A EGLRTL +  + +    Y+++ K Y+ AS +M +R +
Sbjct: 682  RIV--ENNDWLEEETGNM---AREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQ 736

Query: 792  ELDRA-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM 850
            +++    + +E+DL  LG T +EDKLQ  V  +I  L+ AG+K+W+LTGD+ ETA  + +
Sbjct: 737  QMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 796

Query: 851  SCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALE 910
            S +L+S    + I+ + TK       +  LN +E  ++++       L+IDG+SLG  L 
Sbjct: 797  SAKLISRGQYVHIITKLTKP------EGALNQLEYLKVNK----GACLLIDGESLGMFLR 846

Query: 911  EDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHV 970
               + +F  +      V+ CR +P QKA V  +++  T   +  IGDG NDVSMIQ A V
Sbjct: 847  Y-YKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADV 905

Query: 971  GVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQF 1030
            GVGI G EG QA+ +ADF+I +F  L +LL+ HG  SY+R +    +  ++ + + + Q 
Sbjct: 906  GVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQA 965

Query: 1031 WYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQ 1090
             Y   + F    + + + +  Y   +T+ P F + + D  +   L   YP+LYK   +G+
Sbjct: 966  VYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTL-DHDIEESLTKIYPELYKDLTEGK 1024

Query: 1091 FFSVTIFWGWVLNGFYHSAVV-----FIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTS 1145
              S   F+ W     +   V+        S+L   +   + +G             +T  
Sbjct: 1025 SLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIG-------------FTAL 1071

Query: 1146 IIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGS 1205
            I+  L   AL    W K  +     + + +++  PF    F         Y +    YG 
Sbjct: 1072 ILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDL------KYMMTLRFYGE 1125

Query: 1206 ATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQE 1243
              F L+  V PV+A       K   R   P SY  VQE
Sbjct: 1126 LLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  439 bits (1130), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 332/1052 (31%), Positives = 534/1052 (50%), Gaps = 79/1052 (7%)

Query: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258
            R  +  N +S  KYNA TFLP  L+++F  + NL+FL  ++ Q +P +      + +  L
Sbjct: 161  RHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPL 220

Query: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318
              VL V+  KE+ +D++R   D+E N  L +VL  R      K   D+ VGD+I++    
Sbjct: 221  AFVLTVTMAKEASDDIQRRRRDRESNMELYEVLG-RPRPVASK---DLKVGDLIKISKGA 276

Query: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378
             +PADLI+L SSEP G  +I+T  LDGET+ K++ A   T N  ++  L K+   + +  
Sbjct: 277  RVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKI--TITASA 334

Query: 379  PNSSLYTYEGTMTL-NGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437
            P  S++++ G +T  + +T  L+ D  L     L ++ +  G +++TG +T+   N T+ 
Sbjct: 335  PEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSA 394

Query: 438  PIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFK 497
             +K   +E  IN     L   + +L+++                  L +        ++ 
Sbjct: 395  KVKTGLLELEINDISKILCACVFILSIL------------------LVVFAGLHNDDWYV 436

Query: 498  DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQ 557
            DI+ + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG+
Sbjct: 437  DIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDKTIPETIVRTSTIPEDLGR 490

Query: 558  IEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMT 617
            IEY+ SDKTGTLT+N M+ K V +    Y     +     ++  IE    S  +L  + T
Sbjct: 491  IEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRST 550

Query: 618  DPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRR 677
                D A  VI+ +T LA CH V P T  D  + YQAASPDE A+V+    +G     R 
Sbjct: 551  -TRKDAATHVIDLITTLAICHNVTP-TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD 608

Query: 678  PNSVSISTPFSEQ-LEYQLLNICEFNSTRKRMSAI-FRMPDGSIKLFCKGADTVILERLD 735
             +S+S+    S   L Y +L +  FNS  KRM  I +           KGADTV + R+ 
Sbjct: 609  RHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTV-MNRIV 667

Query: 736  SEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEEL-D 794
            +  N +++    ++   A EGLRTL I  + + +K YE++ K YE  S +M +R +E+ +
Sbjct: 668  AN-NDWLEEETGNM---AREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMAN 723

Query: 795  RAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRL 854
              ++ +EHDL  LG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD+ ETA  + +S +L
Sbjct: 724  TISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 783

Query: 855  LSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLE 914
            +S    + +V + +K       +   N +E  ++++    +  L+IDG+SLG  L+   +
Sbjct: 784  ISRGQYVHVVTKLSKP------EGAFNQLEYLKVNK----NACLLIDGESLGMFLKYYRQ 833

Query: 915  DQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 974
            + F  +  L   VI CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGVGI
Sbjct: 834  EFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGI 892

Query: 975  SGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVF 1034
             G EG QA+ +ADF+I QF  L +LL+ HG  SY+R +    +  ++ + + + Q  +  
Sbjct: 893  VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSV 952

Query: 1035 ANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSV 1094
             + F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK   +G+  S 
Sbjct: 953  CSQFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKMYPELYKDLTEGKSLSY 1011

Query: 1095 TIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAA 1154
              F+ WV   FY   V+         +        E     +  +G +T  I   L   A
Sbjct: 1012 KTFFVWVALSFYQGLVI-------QGFSQTFTSLAEIDFTKMVAIG-FTALIFNELIMVA 1063

Query: 1155 LITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIV 1214
            L    W K  ++    +L I++   PF    F    +S   +          T  ++ +V
Sbjct: 1064 LEIYTWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYISTLKF---------ITELILILV 1114

Query: 1215 LPVFALLRDFVW---KYYKRTYSPESYHVVQE 1243
            + +F      VW     Y+R   P SY  VQE
Sbjct: 1115 VSIFP-----VWLTKAIYRRLNLP-SYAKVQE 1140

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  439 bits (1130), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 321/1002 (32%), Positives = 503/1002 (50%), Gaps = 86/1002 (8%)

Query: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258
            R  Y  N IS  KYN  TF+P  L+++F  + NL+FL  ++ Q +P +      + I  L
Sbjct: 170  RKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPL 229

Query: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318
              VL V+  KE+++D+ R   D+E N+ L +V+++     +  K  D+ VGDII+++   
Sbjct: 230  AFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPSK--DLKVGDIIKLKKGA 285

Query: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378
             +PAD+++L ++EP G  +I+T  LDGET+ K++ A   T +  +   L  +   + +  
Sbjct: 286  RVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNI--TITASA 343

Query: 379  PNSSLYTYEGTMTLNGSTF-PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437
            P  S++ + G +T   ST  PLS D  +     L ++A     IV+TG ET+   N T +
Sbjct: 344  PEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKS 403

Query: 438  PIKRTAVERVIN--MQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLF 495
              K   +E  IN   +IL     L+ + L++  G       D                 +
Sbjct: 404  KAKTGLLELEINGLSKILCACVFLLSIMLVAFAG---FNNND-----------------W 443

Query: 496  FKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEEL 555
            + DI+ + ILFS ++P+SL V +++ K   AY I       H++    T+VRTS++ E+L
Sbjct: 444  YVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIE------HDKQIEDTIVRTSTIPEDL 497

Query: 556  GQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDK 615
            G+IEY+ SDKTGTLT+N M+ K + +    Y             + ++I     +S+  +
Sbjct: 498  GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY-----------TNETMDIVTDFIQSMNSR 546

Query: 616  MTD--PEDDEAGI---VIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLG 670
             ++  P      I   VI+ +T LA CH V P T  DG + YQAASPDE A+V+    +G
Sbjct: 547  TSNSTPTTTRKNISDRVIDLVTTLAICHNVTP-TFEDGELTYQAASPDEIAIVKFTESVG 605

Query: 671  FRFDIRRPNSVSISTPFS-EQLEYQLLNICEFNSTRKRMSAI-FRMPDGSIKLFCKGADT 728
                 R  +S+S+    S  +LEY +  +  FNS  KRM  I F           KGADT
Sbjct: 606  LSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADT 665

Query: 729  V---ILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTT 785
            V   I+ R     N +++    ++   A EGLRTL I  + +    +E++ K Y  AS T
Sbjct: 666  VMSSIVVR-----NDWLEEETSNM---ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLT 717

Query: 786  MKDRTEELDRAA-ELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQET 844
            M DR   +     + +E+DL  LG T +EDKLQ+ V  +I  L+ AG+K+W+LTGD+ ET
Sbjct: 718  MMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET 777

Query: 845  AINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKS 904
            A  + +S +L+S    +  V +  K       +  L+ +E  Q++Q       L+IDG+S
Sbjct: 778  ARCVSISAKLISRGQYVHTVTKVNKP------EGALHHLEYLQVNQNS----CLLIDGES 827

Query: 905  LGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSM 964
            LG  L+    D+F  I      V+ CR +P QKA V   +++ T   +  IGDG NDVSM
Sbjct: 828  LGLYLQY-FPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSM 886

Query: 965  IQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMA 1024
            IQ A VGVGI G EG QA+ +ADF+I QF  L KLL+ HG  SY+  +    +  ++ + 
Sbjct: 887  IQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLI 946

Query: 1025 LYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYK 1084
            + + Q  Y   + F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK
Sbjct: 947  ISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTTLYPELYK 1005

Query: 1085 LGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTT 1144
                G+  S   F+ WV    +   V+ + S  F      LN    T    +    +   
Sbjct: 1006 ELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFF----TSLNDSDFTKMVAISFTALVLN 1061

Query: 1145 SIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVF 1186
             +I+V     L  + W K   +    +L+I+L   PF    F
Sbjct: 1062 ELIMV----GLEINTWNKIMAITEVVTLLIYLGSIPFLGEYF 1099

>Kwal_23.5789
          Length = 1133

 Score =  432 bits (1112), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 328/1060 (30%), Positives = 528/1060 (49%), Gaps = 99/1060 (9%)

Query: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258
            R+ Y  N IS  KYN  TF+PK L+++F  + NL+FL  ++ Q +P +      + I  L
Sbjct: 153  RYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPL 212

Query: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318
              VL V+  KE+++D++R   D+E N+ L +VL +   + V  K  D+ VGD+I++    
Sbjct: 213  AFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSK--SQLVPSK--DLKVGDLIKIGKGA 268

Query: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378
              PADL++L SSEP G  +I+T  LDGET+ K++ A   T +   +  L ++   + +  
Sbjct: 269  RAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRI--SITASV 326

Query: 379  PNSSLYTYEGTMTLNG-STFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437
            P  S+  + G +T     + PLS D  +       +       +V+TG +T+   N + +
Sbjct: 327  PEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMS 386

Query: 438  PIKRTAVERVINM--QILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLF 495
             +K   +E  IN   +IL     ++ +AL++  G       D                 +
Sbjct: 387  SVKTGLLELEINSLSKILCACVFILSVALVAFAG---FNNND-----------------W 426

Query: 496  FKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEEL 555
            + DI+ + ILFS ++P+SL V +++ K   A+ I       H+ +   T+VRTS++ E+L
Sbjct: 427  YVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIE------HDSTIPETIVRTSTIPEDL 480

Query: 556  GQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDK 615
            G+IEY+ SDKTGTLT+N ME K + +    Y             D ++I      ++ D 
Sbjct: 481  GRIEYLLSDKTGTLTQNDMELKKLHLGTVSY-----------TMDTMDIVTDYVRAMSDN 529

Query: 616  M------TDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADL 669
            +      +  + D  G V + +  LA CH V P T  DG + YQAASPDE A+V+    +
Sbjct: 530  LNSSAVPSASKKDLPGRVRDLVLTLALCHQVTP-TFEDGELTYQAASPDEIAIVKFTESV 588

Query: 670  GFRFDIRRPNSVSISTPFS-EQLEYQLLNICEFNSTRKRMS-AIFRMPDGSIKLFCKGAD 727
            G     R  +S+++    S    EY +L++  FNS  KRM   IF           KGAD
Sbjct: 589  GLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGAD 648

Query: 728  TVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMK 787
             V+ + +    N +++    +L   A EGLRTL I  + + +K  + ++K YE AS  M 
Sbjct: 649  VVMSKIVQK--NDWLEEETGNL---AREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMML 703

Query: 788  DRTEELDRA-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAI 846
            +R   +    ++ +EHDL  LG T +EDKLQE V  +I  L+ AG+K+W+LTGD+ ETA 
Sbjct: 704  NREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETAR 763

Query: 847  NIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLG 906
             + +S +L+S    +  V +  K +          A+   ++ + + NS  L+IDG+SLG
Sbjct: 764  CVSISAKLVSRGQYVHTVTKVNKPE---------GALTHLELLKINTNS-CLLIDGESLG 813

Query: 907  YALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQ 966
              LE     QF  I     AVI CR +P QKA V   ++  T   +  IGDG NDVSMIQ
Sbjct: 814  LYLEY-YRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQ 872

Query: 967  AAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALY 1026
            +A VGVGI G EG QA+ +ADF+I QF  L KLL+ HG  SY+R +    +  ++ + + 
Sbjct: 873  SADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLIS 932

Query: 1027 MTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLG 1086
            + Q  Y  ++ F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK  
Sbjct: 933  VCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKEL 991

Query: 1087 QKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSI 1146
              G+  S   F+ WV+   +   V+             L+ G  + D   +   +  +  
Sbjct: 992  TAGKSLSYKTFFVWVVLSLFQGCVI-----------QGLSQGFTSLDELDFKRLVALSFT 1040

Query: 1147 IIVLGKAALITSQ---WTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVY 1203
            +++L +  ++  +   W K  +V+   + +I++   P     F    +S+  Y      Y
Sbjct: 1041 VLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEY------Y 1094

Query: 1204 GSATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQE 1243
            G     L   ++PV+A       K   R  +P SY  VQ+
Sbjct: 1095 GKLAIILSLSIIPVWAA------KALHRRLNPPSYAKVQQ 1128

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  350 bits (897), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 192/528 (36%), Positives = 313/528 (59%), Gaps = 34/528 (6%)

Query: 742  VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIE 801
            ++ TL  +E ++ EGLRTL  A + I  +++E+W   Y  A T++ +R +++D     IE
Sbjct: 958  LEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIE 1017

Query: 802  HDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNL 861
             +L+ LGATAIEDKLQEGV E I  ++ AG+K+W+LTGD++ETAINIG SC+L+ +   +
Sbjct: 1018 DELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTV 1077

Query: 862  LIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIG 921
            +I+    +     N+ SK+NAI S ++   ++    +VIDG +L  A+ ED         
Sbjct: 1078 VILTTSDE-----NIISKMNAI-SQEVDSGNVAHCVIVIDGATL--AMFEDNPTLMSVFT 1129

Query: 922  KLC---KAVICCRVSPLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGISGM 977
            +LC    +V+CCR SP QKAL+V  ++    S++ LAIGDGAND++MIQ+A +GVGI+G 
Sbjct: 1130 ELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGK 1189

Query: 978  EGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANA 1037
            EG+QA+RSAD++IGQFRF+ KLL+VHG ++Y R +  IL +FYK +  Y+TQ  Y     
Sbjct: 1190 EGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTM 1249

Query: 1038 FSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIF 1097
            FSG S+ E W+L+ YN  FT +P   +G+F++ +    L   P+LY +G+  + F+ +IF
Sbjct: 1250 FSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIF 1309

Query: 1098 WGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGET--ADHWVWGVGI--YTTSIIIVLGKA 1153
              WV  G  ++ ++   +++ +         GET  +D+ ++ +G   ++ ++ ++  KA
Sbjct: 1310 AEWVFLGTANALIITFLNIVAW---------GETSLSDNTLYPLGFVNFSATVALINVKA 1360

Query: 1154 ALI---TSQWTKFTLVAIP-GSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFW 1209
              I      W  FT V +  G  ++W    P  +      +V+   YG+  H     TFW
Sbjct: 1361 QFIEMRNRNWLAFTSVILSCGGWLVWCCALPILNRSDGIYDVT---YGLYHHFGRDITFW 1417

Query: 1210 LMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRME 1257
               ++L V  ++ D V+K +K   +P    +  E+++   S+ R ++E
Sbjct: 1418 CTSLILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQK--SEIRKKLE 1463

 Score =  271 bits (692), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 182/541 (33%), Positives = 284/541 (52%), Gaps = 87/541 (16%)

Query: 123 MSNVKSAVGMNGGHKGQFQSFEMNDYDQSNTNRYESS---TRKFDIKVLFNRYILRKGKT 179
           M+++      + GH G F S +     Q+    ++S    T+  D+  LF+R      +T
Sbjct: 35  MNDIDEETENDEGHIGDFNSID----GQTKIRNHQSPRLVTKILDM--LFDR------RT 82

Query: 180 SCKSDEPR--TILLNDSSA--------------NSRFGYR--DNHISTTKYNAATFLPKF 221
              S + R   I L+ SSA              + R+GY   +N I++++Y   +F P+ 
Sbjct: 83  QVHSVDGRHIPISLDHSSAISDIYPVDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQ 142

Query: 222 LFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADK 281
           L+ +FSK AN++F   +I+Q +P  + T  YTTI  L V + +S  +E+ +D +R   DK
Sbjct: 143 LYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCVFMAISMAREAYDDYRRHKLDK 202

Query: 282 ELNHSLCDVLD---ERSG------------------------------------EFVRKK 302
           E N+ L  VL    ER                                        V KK
Sbjct: 203 EENNKLTKVLQILHEREDNDLDLENNAQHSANNPESISNLYFNNFDLLAKKYNVRIVEKK 262

Query: 303 WIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYL 362
           W DI VGD + ++ ++ +PAD++IL+S       +IET  LDGETNLK K    E  N L
Sbjct: 263 WKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEI-NKL 321

Query: 363 DEKA--LCKLHGRVQSEHPNSSLYTYEGTMTLNGST-----FPLSPDQMLLRGATLRNTA 415
            + A  L  ++ +V  E PN+ LY +EG + LN  +     +PL PD ++ RG+ +RNT 
Sbjct: 322 TKSASGLANINAQVTVEDPNNDLYNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTR 381

Query: 416 WIFGLIVFTGHETKLMRNATATP-IKRTAVERVINMQILALFGVLIVLALISSTGNVIMT 474
              G+++FTG E+K+  NA   P  K   ++R INM ++ +  V+  ++L S  G+ I  
Sbjct: 382 NCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQI 441

Query: 475 KR--DSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSD 532
           KR  ++    YL  E    A      I++F I+++ ++P+SL+VT+E+IK  Q+ M+  D
Sbjct: 442 KRYVNNNKAWYLLQEDAGTA----PTIMSFIIMYNTIIPLSLYVTMELIKVAQSRMMEWD 497

Query: 533 LDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPE 592
           +D+YH ESDTP  VRT++++EELGQ+ YIFSDKTGTLT N M F+ +S  G  ++    +
Sbjct: 498 IDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQ 557

Query: 593 D 593
           D
Sbjct: 558 D 558

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 86/159 (54%), Gaps = 26/159 (16%)

Query: 590 IPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGT 649
           IPED ++T           FE +    ++P+   A     F+  LA CH  +P+   +G 
Sbjct: 649 IPEDIKST-----------FELIYYIQSNPKSLFAKKAKMFILSLAICHICLPKRTEEGN 697

Query: 650 -----IKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLE-------YQLLN 697
                I+YQ++SPDE ALV  A D+G+    R  N +++ T F +  +       +++L 
Sbjct: 698 DEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLKT-FPDGFDELPRFENFEILE 756

Query: 698 ICEFNSTRKRMSAIFRMPD--GSIKLFCKGADTVILERL 734
           + +FNS RKRMS I R+P+    + LFCKGAD VILERL
Sbjct: 757 LVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVILERL 795

>Kwal_23.3556
          Length = 1597

 Score =  340 bits (873), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 191/522 (36%), Positives = 308/522 (59%), Gaps = 22/522 (4%)

Query: 742  VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIE 801
            ++ TL+ +ED++  GLRTL  + + IP ++YE+WSK Y AA T++++R E++    EL+E
Sbjct: 957  LERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVE 1016

Query: 802  HDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNL 861
              L  LGATAIEDKLQEGV + I  ++ AG+K+W+LTGD++ETAINIG SC L+ +   +
Sbjct: 1017 TSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHDYSTV 1076

Query: 862  LIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLG-YALEEDLEDQFLTI 920
            +I++ + +     N+ SKL A+ S +I + ++    +VIDG +L  +     L   F+ +
Sbjct: 1077 VILSAKDE-----NISSKLTAV-SQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVEL 1130

Query: 921  GKLCKAVICCRVSPLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGISGMEG 979
                 +VICCR SP QKAL+V  ++     L+ LAIGDGAND++MIQ+A +GVGI+G EG
Sbjct: 1131 CTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEG 1190

Query: 980  MQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFS 1039
            +QA+RS+D++I QFRFL KLL+VHG ++Y R +  +L +FYK +  Y+TQ  Y     FS
Sbjct: 1191 LQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQRHTMFS 1250

Query: 1040 GQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWG 1099
            G S+ E W+L+ +N  FT +P   IG+F++ +    L   P+LY +G+  Q F++ +F  
Sbjct: 1251 GTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNLRVFLY 1310

Query: 1100 WVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQ 1159
            W+     +S ++   + L ++     ++    +D+ V+ +G+   + II L        +
Sbjct: 1311 WMFLAALNSLII---TFLNWKIWAVSSL----SDNTVYPIGVINFTAIITLVNVKCQLLE 1363

Query: 1160 WTKFTLVAIPGSLVI----WLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVL 1215
                 ++AI  SLVI    WLL+      ++    +     G+        TFW  C+VL
Sbjct: 1364 THNRNVLAI-CSLVISVGGWLLWCCLLPGIYSEDGMYDVLTGLYFQFGNDITFWCACLVL 1422

Query: 1216 PVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRME 1257
             V  L+ D V+K  K    P    +  E+++ +  + R ++E
Sbjct: 1423 VVLPLIIDVVFKTVKIMIFPSDSEISMELEQKD--EIRKKLE 1462

 Score =  236 bits (602), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 157/490 (32%), Positives = 252/490 (51%), Gaps = 87/490 (17%)

Query: 202 YRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVV 261
           Y  N I++++Y   TFLP+ L+ +FS+ AN +F   +++Q +P  + T  YTTI  LL+ 
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 262 LIVSAVKESVEDLKRSNADKELNHSLCDVLDERSG---EFVR-------KKWIDIAVG-- 309
           + +S  +E+ +D +R   D+E N     VL + S    EF R        +W   A    
Sbjct: 168 MGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSATSTS 227

Query: 310 ------------------------DIIRVR-SEEAIP--------ADLIILSSSE--PEG 334
                                   D+++ +   EA+          D ++L   E  P  
Sbjct: 228 MLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPAD 287

Query: 335 L-----------CYIETANLDGETNLKIKQARQETANYLDEKA-LCKLHGRVQSEHPNSS 382
           +           C++ET  LDGETNLK KQ   E +  +   A L +   +V  E PN  
Sbjct: 288 MLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNID 347

Query: 383 LYTYEGTMTLNGSTFPLS--PDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATP-I 439
           L+ +EG + L G    L+  PD ++ RG+ +RNT+   G++VFTG ETK+  NA   P I
Sbjct: 348 LHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIKNPRI 407

Query: 440 KRTAVERVINMQILALFGVLIVLALISSTGNVIMTKR--DSAHLGYLYIEGTNKAGLFFK 497
           K   ++R IN+ +L +  V+  +AL S  G  I+ K+  D+    YL+    + AGL   
Sbjct: 408 KAPKLQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLF---NSDAGL-AP 463

Query: 498 DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQ 557
            +++F I+++ L+P+SL+VT+E+IK  Q+ ++  D+D+YH E++TP   RT++++EELGQ
Sbjct: 464 TVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQ 523

Query: 558 IEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMT 617
           + YIFSDKTGTLT N M F+++S+ G  +I                   H F+   +K+T
Sbjct: 524 VSYIFSDKTGTLTDNKMVFRALSVCGSSWI-------------------HDFDPAAEKLT 564

Query: 618 DPEDDEAGIV 627
             E  ++  V
Sbjct: 565 KSESSDSNTV 574

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 74/129 (57%), Gaps = 12/129 (9%)

Query: 618 DPEDDEAGIVIEFLTLLATCHTVIPETQS----DGTIKYQAASPDEGALVQGAADLGFRF 673
           +P    A  V  F+  LA CH  +P++ S    +  ++YQA+SPDE ALV  A D+G+  
Sbjct: 656 NPNTHFAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAV 715

Query: 674 DIRRPNSVSIST-PFSEQLE-----YQLLNICEFNSTRKRMSAIFRMP--DGSIKLFCKG 725
             R  + ++I T P     E     Y++LN  EF+S RKRMS + R+P  +  I L CKG
Sbjct: 716 MNRNSDVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRLPHEENRILLICKG 775

Query: 726 ADTVILERL 734
           AD VILERL
Sbjct: 776 ADNVILERL 784

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  333 bits (853), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 198/546 (36%), Positives = 308/546 (56%), Gaps = 35/546 (6%)

Query: 727  DTVILERLDSE---FNP--YVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEA 781
            DT ILE + S+    N    ++ TL+ +++++ EGLRTL  A + I   +YE W+K Y  
Sbjct: 998  DTEILEHIGSDELILNEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQ 1057

Query: 782  ASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDR 841
            A T++ DR  ++D A   IE  L  LG TAIEDKLQ+GV E I  ++ AG+K+W+LTGD+
Sbjct: 1058 AKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDK 1117

Query: 842  QETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVID 901
            +ETAINIG SC L+ +D + +++   T E    N+ SK+NA+ S ++   ++    +VID
Sbjct: 1118 RETAINIGYSCMLI-KDYSTVVILTTTDE----NIISKMNAV-SQEVDSGNIAHCVVVID 1171

Query: 902  GKSLGYALEEDLEDQFLTIGKLC---KAVICCRVSPLQKALVVKMVKRKTSSLL-LAIGD 957
            G ++  A+ E          +LC    +VICCR SP QKAL+V  ++    +L+ LAIGD
Sbjct: 1172 GATM--AMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGD 1229

Query: 958  GANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILY 1017
            GAND++MIQ+A +GVGI+G EG+QA+R +D++IGQFRFL KLL VHG ++Y R S  +L 
Sbjct: 1230 GANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSKFMLC 1289

Query: 1018 SFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLD 1077
            +FYK +  Y TQ  Y     FSG S+ E W+L+ +N  FT +P   IG+F++ +    L 
Sbjct: 1290 TFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLL 1349

Query: 1078 RYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVW 1137
              P+LY  G+  Q F+  IF  WV+    +S ++   +V+ +   +        +D+ ++
Sbjct: 1350 TVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSSL-------SDNTMY 1402

Query: 1138 GVGIYTTSIIIVLGKAA-----LITSQWTKFTLVAIP-GSLVIWLLFFPFYSAVFPRVNV 1191
             +G+   + I+ L         +    W  FT V +  G  ++W    P  +      +V
Sbjct: 1403 PLGLINFTAIVALINVKSQFVEMHNRNWLAFTSVVLSCGGWLVWCCALPILNNTDQIYDV 1462

Query: 1192 SKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISD 1251
            +   YG   H     TFW   +VL +  +  D V+K +K    P    +  E+++   SD
Sbjct: 1463 A---YGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFAELEQK--SD 1517

Query: 1252 YRPRME 1257
             R ++E
Sbjct: 1518 IRKKLE 1523

 Score =  254 bits (649), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 154/465 (33%), Positives = 243/465 (52%), Gaps = 86/465 (18%)

Query: 202 YRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVV 261
           Y DN I++++Y   +FLP+ L+ +FSK AN +F   +++Q +P  + T  YTTI  L V 
Sbjct: 138 YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVF 197

Query: 262 LIVSAVKESVEDLKRSNADK---------------------------------------- 281
           + +S  +E+ +D +R   DK                                        
Sbjct: 198 MGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVYTLPSSVVSSTAYLTKSAA 257

Query: 282 -ELNHSLCDVLDERSGEFV-------------------RKKWIDIAVGDIIRVRSEEAIP 321
            E N  L D  +   G F+                   +KKW  + VGD + +  ++ +P
Sbjct: 258 AENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWEKLRVGDFVLLTQDDWVP 317

Query: 322 ADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKA--LCKLHGRVQSEHP 379
           ADL++L+       C++ET  LDGETNLK KQ   E  N L + A  L  ++ +V  E P
Sbjct: 318 ADLLLLTCDGENSECFVETMALDGETNLKSKQPHPE-LNKLTKAASGLANINAQVTVEDP 376

Query: 380 NSSLYTYEGTMTLNGS------TFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRN 433
           N  LY +EG + L          +PL PD ++ RG+ LRNT  + G+++F+G ETK+  N
Sbjct: 377 NIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMN 436

Query: 434 ATATP-IKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKA 492
           A   P  K   ++R INM I+ +  V+  ++L S  G+V+  K+        YI+  NKA
Sbjct: 437 ALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKK--------YID-QNKA 487

Query: 493 GLFFK-------DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTV 545
              F+        I++F I+++ ++P+SL+VT+E+IK  Q+ M+  D+D+YH E++TP  
Sbjct: 488 WYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCE 547

Query: 546 VRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETI 590
            RT++++EELGQ+ YIFSDKTGTLT N M F+  S+ G  ++  +
Sbjct: 548 SRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNV 592

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 84/157 (53%), Gaps = 26/157 (16%)

Query: 630 FLTLLATCHTVIP-----ETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSIS 684
           F   LA CH+ +P     E+  + +I+YQ++SPDE ALV  A DLG+    R    ++I 
Sbjct: 731 FFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIK 790

Query: 685 T-----PFSEQLE-YQLLNICEFNSTRKRMSAIFRMPD--GSIKLFCKGADTVILERLDS 736
           T         +LE Y++LN  +FNS RKRMS + RMP+    + L CKGAD VI+ERL  
Sbjct: 791 TFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIMERL-- 848

Query: 737 EFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYE 773
                      H  + AA+ +  +C +++   + E E
Sbjct: 849 -----------HDRELAAKKMADICTSTKERKDAEAE 874

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  331 bits (849), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 186/523 (35%), Positives = 301/523 (57%), Gaps = 24/523 (4%)

Query: 742  VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIE 801
            ++ TL  +++++ EGLRTL  + + IP +EY+ W   Y  A T++ +R+ ++      IE
Sbjct: 937  LEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEVGGHIE 996

Query: 802  HDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNL 861
             DL  LGATAIEDKLQEGVPE I  ++ AG+K+W+LTGD++ETAINIG +C+L+ +   +
Sbjct: 997  TDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYSTV 1056

Query: 862  LIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLG-YALEEDLEDQFLTI 920
            +I+ +        NL SK+ A+   ++    +    LVIDG SL  +     +   F+ +
Sbjct: 1057 VILKKNDD-----NLISKMTAL-GEELDTGKIAHCVLVIDGASLAVFENNPTMMSVFIEL 1110

Query: 921  GKLCKAVICCRVSPLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGISGMEG 979
                 +VICCR SP QKAL+V  ++ K   L+ LAIGDGAND++MIQ+A +GVGI+G EG
Sbjct: 1111 CTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGITGKEG 1170

Query: 980  MQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFS 1039
            +QA+RS+D++I QFR+L KLL VHG ++Y R S  +L +FYK +  Y+TQ  Y     FS
Sbjct: 1171 LQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQRQTMFS 1230

Query: 1040 GQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWG 1099
            G S+ E W+L+ +N  FT +P   IG+F++ +    L   P+LY +GQK Q F++ IF  
Sbjct: 1231 GTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFNLKIFLV 1290

Query: 1100 WVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGI--YTTSIIIVLGKAALIT 1157
            W+L     S  V I  + F  +G         +D+ ++ +G+  +T+   ++  K   I 
Sbjct: 1291 WMLTAAGIS--VLITFLNFEIWG-----FTAQSDNSIYPIGVINFTSICFLINVKCQFIE 1343

Query: 1158 SQ---WTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIV 1214
            ++   W  F  + I  S + W+L+      ++    +     G+        T+W  C++
Sbjct: 1344 TRNRNWLAFASLLI--SCIGWILWCCLLPGIYGENAIYDVLIGLYHQFGRDITWWASCLI 1401

Query: 1215 LPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRME 1257
            L +F ++ D V + ++    P    +  E+++ +  D R ++E
Sbjct: 1402 LIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQKD--DIRKKLE 1442

 Score =  266 bits (681), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 157/447 (35%), Positives = 243/447 (54%), Gaps = 65/447 (14%)

Query: 202 YRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVV 261
           YRDN I++++Y   +FLP+ L+ +FSK AN +FL  +I+Q +P+ + T  YTTI  L + 
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 262 LIVSAVKESVEDLKRSNADKELN------------------------------------- 284
           L +S  +E+ +D KR   DKE N                                     
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAILS 235

Query: 285 -----HSLCDV-----------LDERSGEF----VRKKWIDIAVGDIIRVRSEEAIPADL 324
                H+L DV           L+    +F     +K+W D+ VG+ + + S++ +PAD+
Sbjct: 236 DFNSMHNLNDVTEPSYTDHFTNLNLLRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPADI 295

Query: 325 IILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQS-EHPNSSL 383
           ++LS+       ++ET  LDGETNLK K    E A  +       +H    + E PN+ L
Sbjct: 296 LLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTLEDPNNDL 355

Query: 384 YTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATP-IKRT 442
           Y +EGT+ ++G  +PL  D ++ RG+ LRNT  I G+++FTG ETK+  NA   P  K  
Sbjct: 356 YNFEGTVEIDGELYPLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRTKAP 415

Query: 443 AVERVINMQILALFGVLIVLALISSTGNVIMTKR--DSAHLGYLYIEGTNKAGLFFKDIL 500
            ++  IN+ +L +  V+  +A+ S  G  I+ K   D+    YL+ E    A      I+
Sbjct: 416 KLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKNYVDNNRAWYLFQEDAGTA----PTIM 471

Query: 501 TFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEY 560
           +F I+++ L+P+SL+VT E+IK  Q+ ++  D+D+YH ESDTP   RT++++EELGQ+ Y
Sbjct: 472 SFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSY 531

Query: 561 IFSDKTGTLTRNVMEFKSVSIAGRCYI 587
           IFSDKTGTLT N M F+  SI G  ++
Sbjct: 532 IFSDKTGTLTDNKMIFRKFSICGSSWL 558

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 71/115 (61%), Gaps = 10/115 (8%)

Query: 630 FLTLLATCHTVIPETQSDGT--IKYQAASPDEGALVQGAADLGFRFDIRRPNSVSIST-- 685
           F+  LA CHT +P+   DGT  I YQ++SPDE ALV  A D+GF    R  +++SI+T  
Sbjct: 672 FILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYP 731

Query: 686 -PFSEQL---EYQLLNICEFNSTRKRMSAIFRMP--DGSIKLFCKGADTVILERL 734
             F +Q    +Y++L    F+S RKRMS   +MP  D  + L CKGAD VILERL
Sbjct: 732 NGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVILERL 786

>Scas_669.3
          Length = 1638

 Score =  319 bits (817), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 185/527 (35%), Positives = 305/527 (57%), Gaps = 32/527 (6%)

Query: 742  VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIE 801
            ++ T++ +++++ EGLRTL  + + +  +EY++W   Y  A  ++ +R  ++    E IE
Sbjct: 992  IEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIE 1051

Query: 802  HDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNL 861
             DL  LGATAIEDKLQEGV E I  ++ AG+K+W+LTGD++ETAINIG SC+L+ +   +
Sbjct: 1052 QDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTV 1111

Query: 862  LIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLG-YALEEDLEDQFLTI 920
            +I+    K D   N+ SK+NAI S ++   ++    ++IDG +L  +     L   F+ +
Sbjct: 1112 VIL---AKGDE--NIISKMNAI-SQEVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIEL 1165

Query: 921  GKLCKAVICCRVSPLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGISGMEG 979
                 +VICCR SP QK+L+V  ++    +L+ LAIGDGAND++MIQ+A +G+GI G EG
Sbjct: 1166 CTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEG 1225

Query: 980  MQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFS 1039
            +QA+R+AD++I QFRF+ KLL+VHG ++Y R +  IL +F+K +  Y+TQ  +     FS
Sbjct: 1226 LQASRTADYSIAQFRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFS 1285

Query: 1040 GQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWG 1099
            G S+ E W+L+ +N  FT +P   IG+F++ +    L   P+LY +G+  Q F++ IF  
Sbjct: 1286 GSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGE 1345

Query: 1100 WVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETA--DHWVWGVGI--YTTSIIIVLGKAAL 1155
            WV+    ++ ++   +++ +         GETA  DH ++ +G+  +T  + +V  K   
Sbjct: 1346 WVIQAAAYALLITFLNIIIW---------GETALSDHTMYPLGVINFTAIVALVNVKCQF 1396

Query: 1156 I---TSQWTKFTLVAIP-GSLVIWLLFFPFYSAVFPRVNVSKEY-YGIIGHVYGSATFWL 1210
            I      W  FT V +  G  ++W    P    +  R +V  +  YG   H     T+W 
Sbjct: 1397 IEMNNRNWVVFTSVILSCGGWLVWCCALP----ILNRSDVIYDVPYGFFYHFGKDITWWC 1452

Query: 1211 MCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRME 1257
             C VL V  +  D V++ +K    P    +   +++   S+ R ++E
Sbjct: 1453 SCFVLAVLPITIDIVYQTFKTMIWPSDADIFSVLEQK--SEIRKKLE 1497

 Score =  262 bits (669), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 144/442 (32%), Positives = 242/442 (54%), Gaps = 58/442 (13%)

Query: 202 YRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVV 261
           Y +N+I++++Y   +F PK L+ +FSK AN++F   +I+Q +P  + T  YTTI  L + 
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 262 LIVSAVKESVEDLKRSNADKELNHSLCDVL------------------------------ 291
           + +S  +E+ +D +R   DKE N+  C +L                              
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 292 -------------DERSGEFVRKK-WIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCY 337
                        +ER G  +++  W ++ VGD + ++ +  +PAD+++L+S      C+
Sbjct: 260 DYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECF 319

Query: 338 IETANLDGETNLKIKQARQETANY-LDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGST 396
           +ET  LDGETNLK+KQ   E          L  ++  +  E PNS LY +EG + L  + 
Sbjct: 320 VETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNN 379

Query: 397 ------FPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATP-IKRTAVERVIN 449
                 +P+ PD +  RG+ +RNT  + G++++TG ETK+  NA   P  K   +++ IN
Sbjct: 380 NNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNIN 439

Query: 450 MQILALFGVLIVLALISSTGNVIMTKR--DSAHLGYLYIEGTNKAGLFFKDILTFWILFS 507
           + I  +  V+ V++L S  G+V+  K+  D     YL  +    A      I++F I+++
Sbjct: 440 IIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAA----PTIMSFIIMYN 495

Query: 508 NLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTG 567
            ++P+SL+VT+E+IK  Q+ M+  D+D+YH E++TP   RT++++EELGQ+ Y+FSDKTG
Sbjct: 496 TIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTG 555

Query: 568 TLTRNVMEFKSVSIAGRCYIET 589
           TLT N M F+  SI G  ++ +
Sbjct: 556 TLTDNKMIFRKFSICGSSWLHS 577

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 70/120 (58%), Gaps = 17/120 (14%)

Query: 630 FLTLLATCHTVIPETQS-----DGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSIS 684
           F+  LA CHT +P+  +     +  I+YQ++SPDE ALV  A DLG+    +  + ++I 
Sbjct: 702 FILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADVLTIK 761

Query: 685 T--------PFSEQLEYQLLNICEFNSTRKRMSAIFRMPD--GSIKLFCKGADTVILERL 734
           T        P  E  +YQ+LN  +FNS RKRMS + + PD    + L CKGAD +ILERL
Sbjct: 762 TYPDGFENEPIFE--DYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMILERL 819

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  314 bits (804), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 184/482 (38%), Positives = 281/482 (58%), Gaps = 36/482 (7%)

Query: 742  VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIE 801
            ++ TL+ ++ +  EGLRTL  + + I  +EYE W+  Y AA   + +R E++D   E+IE
Sbjct: 938  IERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTVGEIIE 997

Query: 802  HDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNL 861
             DL  LG   IEDKLQEGVP+ I  L+ AG+K+W+LTGD++ETAINIG SCRL+ +   +
Sbjct: 998  RDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHDYSTV 1057

Query: 862  LIV--NEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLT 919
            +I+  N+E       N+ SK+  I + +I   ++    +VIDG +L    E +L    L 
Sbjct: 1058 IILAPNDE-------NMASKITTI-TQEIEAGNVAHCVVVIDGATLTI-FEGNLTLMTLF 1108

Query: 920  IGKLC---KAVICCRVSPLQKALVVKMVKRKTSSLL-LAIGDGANDVSMIQAAHVGVGIS 975
            I +LC    +VICCR SP QKAL+V  +++    L+ LAIGDGAND++MIQ+A +GV I+
Sbjct: 1109 I-ELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDIT 1167

Query: 976  GMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFA 1035
            G EG+QA+RS+D++I QFR+L KLL+VHG ++Y R S  +L +FYK    Y+TQ  +   
Sbjct: 1168 GKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQIN 1227

Query: 1036 NAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVT 1095
              FSG S  E W LT +N  FT +P   IG+F++ + S  L   P+LY  G++ Q F++ 
Sbjct: 1228 TMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLV 1287

Query: 1096 IFWGWVLNGFYHSAVVFIGSVLF-YRYGNCLNMGGETADHWVWGVGI--YTTSIIIVLGK 1152
            IF  W+       A+  + SV+  +    C ++  + +D+ ++ +G+  YT  +++V  K
Sbjct: 1288 IFLRWM-------AIAALSSVIICFTNWQCWSLTAQ-SDNTLYPIGLINYTAVVVLVNVK 1339

Query: 1153 AALI---TSQWTKFT--LVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSAT 1207
              L+      W  F    +++ G L  W L  P   A++    V     G+        T
Sbjct: 1340 CQLLEMANRNWLAFASFFISVCGWLC-WCLLLP---AIYKETLVYDVREGLYHQFGPDIT 1395

Query: 1208 FW 1209
            FW
Sbjct: 1396 FW 1397

 Score =  241 bits (615), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 229/428 (53%), Gaps = 43/428 (10%)

Query: 198 SRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGT 257
           S   Y  N I++++Y+  +FLP+ L  +FSK  N +F   +I+Q VPN + T +YTTI  
Sbjct: 106 SGLPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVP 165

Query: 258 LLVVLIVSAVKESVEDLKRSNADKELNHSLCDVL----------------DERSGEF--- 298
           L + + +S  +E  ED +R   D+E N+ L  VL                + R+  F   
Sbjct: 166 LSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDF 225

Query: 299 -----------VRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGET 347
                      V K+W D+ VG+ + +  ++ +PADL +L++      CY+ET  LDGET
Sbjct: 226 ETLQANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGET 285

Query: 348 NLKIKQARQETANYL-DEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGST-----FPLSP 401
           NLK K    + A+       L    G    E PN  LY +EG + +   +     + +  
Sbjct: 286 NLKCKHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQAYSIGL 345

Query: 402 DQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATP-IKRTAVERVINMQILALFGVLI 460
           D +L RG+ +RNT  + G++VFTG ETK+  NA   P IK   ++  IN+ +L +  V+ 
Sbjct: 346 DNVLFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVA 405

Query: 461 VLALISSTGNVIMTKR--DSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTV 518
           + + +S         R  DS    YL       AGL    I++F I+++ L+P+SL+VT+
Sbjct: 406 IFSFLSFGLQRFFKNREVDSDRAWYLM---KVDAGLA-PTIMSFIIMYNTLIPLSLYVTM 461

Query: 519 EMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKS 578
           E+IK  Q+ ++  D+D+YH E++T    RT++++EELGQ+ YIFSDKTGTLT N M F+ 
Sbjct: 462 EIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRK 521

Query: 579 VSIAGRCY 586
            S  G  +
Sbjct: 522 FSFCGTAW 529

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 71/121 (58%), Gaps = 18/121 (14%)

Query: 630 FLTLLATCHTVIPETQSDG------TIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSI 683
           F+  LA CHT +P+ +         +++YQ++SPDE ALV  A D+G+    R  + ++I
Sbjct: 653 FILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTI 712

Query: 684 STPFSEQLE-------YQLLNICEFNSTRKRMSAIFRM---PDGSIKLFCKGADTVILER 733
            T + +  E       Y++LN  +F+S RKRMS + RM   P+  + L CKGAD VILER
Sbjct: 713 KT-YPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPE-KVLLICKGADNVILER 770

Query: 734 L 734
           L
Sbjct: 771 L 771

>Scas_89.1
          Length = 271

 Score =  164 bits (416), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 154/269 (57%), Gaps = 12/269 (4%)

Query: 772  YEEWSKIYEAASTTMKDRTEELDRA-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEA 830
            Y+++ K Y  AS +M +  E +     + +EH+L  LG T +EDKLQ  V  +I  L+ A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 831  GLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQ 890
            G+K+W+LTGD+ ETA  + +S +L+S    +  V + ++       +  LNA+E  +I++
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP------EGALNALEYLKINK 115

Query: 891  QDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSS 950
                S  L+IDG+SLG  L    + +F  I     AVI CR +P QKA V  +++  T  
Sbjct: 116  ----SSCLLIDGESLGMFLTY-YKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGK 170

Query: 951  LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQR 1010
             +  IGDG NDVSMIQ A VGVGI G EG QA+ +ADF++ QF  L KLL+ HG  SY+R
Sbjct: 171  RVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKR 230

Query: 1011 ISLAILYSFYKNMALYMTQFWYVFANAFS 1039
             +    +  ++ + + + Q  Y   +  S
Sbjct: 231  SAKLAQFVIHRGLIISVCQAVYSVCSKLS 259

>Scas_665.30
          Length = 1439

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 186/830 (22%), Positives = 322/830 (38%), Gaps = 156/830 (18%)

Query: 252  YTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDI 311
            Y   G + ++ I+S V   VE  +   +  +++H  C+V   R   +      D+  GDI
Sbjct: 291  YYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDI 350

Query: 312  IRVR--SEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCK 369
              +   S    P D ++LS     G C +  + L GE+ + + +   E    L       
Sbjct: 351  YEISDPSLTVFPCDSLLLS-----GDCIVNESMLTGES-VPVSKFPAEPETML------- 397

Query: 370  LHGRVQSEHPNSSLYTY-EGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHET 428
               ++  +  N+ + +Y   +   NG+T        ++R       +    ++V TG  T
Sbjct: 398  ---QLLDDFQNTQISSYLSKSFLFNGTT--------IIRARIPYGQSAALAMVVRTGFST 446

Query: 429  ---KLMRN-----ATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAH 480
                L+R+      T       + + +  M ++ALFG  I                  + 
Sbjct: 447  TKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSI------------------SC 488

Query: 481  LGYLYIEGTNKAGLFFK--DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHE 538
            + ++ I G +K  +  +  DI+T       +VP +L  T+          IG+   L   
Sbjct: 489  IQFIKI-GLDKRTMILRALDIITI------VVPPALPATL---------TIGTGFALSRL 532

Query: 539  ESD-----TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPED 593
            +       +PT V         G+I+ +  DKTGTLT N ++   V +   C   +    
Sbjct: 533  KKKGIFCISPTRVNIG------GKIDILCFDKTGTLTENGLDVLGVQL---CVPSSHNSF 583

Query: 594  RRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHT--VIPETQSDGTIK 651
            + A +   +   F  F SL D  + P D  A     F   L TCH+  V+        + 
Sbjct: 584  QFADLVQDVHKLFPKF-SLND-CSSPRDYRAK---NFFISLLTCHSLRVVDNELIGDPLD 638

Query: 652  YQAASPDEGALVQGAADLGFR--FDIRR-----------------PNSVSISTPFSEQLE 692
            ++     + +  +   +  F   ++ RR                 PNS      F +   
Sbjct: 639  FKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDP 698

Query: 693  YQLLNIC---EFNSTRKRMSAIFRMPDGSIK-LFCKGADTVILERLDSEFNPYVQSTLRH 748
            +  L I    EF S  +RMS I +  +  +   F KGA  VI +  +    P   +    
Sbjct: 699  HNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLP--ANFEEM 756

Query: 749  LEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLG 808
            L  Y  +G R +  A R +P   +    K+                 + E +E ++ FLG
Sbjct: 757  LNYYTHKGYRVIACAGRVLPRNTWLYSQKV-----------------SREEVESNMEFLG 799

Query: 809  ATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEET 868
                E+KL++   +T+  LQEA ++  + TGD   TAI++G  C L+      +   EE 
Sbjct: 800  FIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEI 859

Query: 869  KEDTRT--------NLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEED----LEDQ 916
                +T        N+   L++     I+     S  L I G        ++     ED 
Sbjct: 860  DSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDY 919

Query: 917  FLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISG 976
              T+  L K  I  R+SP +K  +++ ++R   ++    GDGAND   ++AA VG+ +S 
Sbjct: 920  INTV--LLKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSE 976

Query: 977  MEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALY 1026
             E   A+ +A F    F     L ++       R  L   +S ++ M+LY
Sbjct: 977  AE---ASVAAPFTSQVFDISCVLDVIKEG----RACLVTSFSCFQYMSLY 1019

>Kwal_26.9207
          Length = 1469

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 129/518 (24%), Positives = 215/518 (41%), Gaps = 77/518 (14%)

Query: 543  PTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGI 602
            PT V  S      G+I+ +  DKTGTLT + ++   V +A     +     R   +   +
Sbjct: 772  PTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNF---RFGALITNV 822

Query: 603  EIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHT---VIPETQSDG----------- 648
               F+ + SL D    P D ++     FL  L TCH+   V  E   D            
Sbjct: 823  RGLFNKY-SLND-CGSPIDFKSR---NFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNW 877

Query: 649  -------TIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNIC-- 699
                     K+ + + +         + G    +  PN+ S    F+E   + LL +   
Sbjct: 878  SYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRS 937

Query: 700  -EFNSTRKRMSAIFRMPDGSIKL--FCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEG 756
             EF S  +RMS I + P G      F KGA  VI E  +    P     +  L+ Y   G
Sbjct: 938  FEFVSELRRMSVIVK-PYGENVFWGFTKGAPEVISEICNKSTLPANYEQI--LQQYTHNG 994

Query: 757  LRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKL 816
             R +  A +T+P++ +    K+                 + E +E ++ FLG    E+KL
Sbjct: 995  YRVIACAGKTLPKRTWRFAQKV-----------------SREEVESNMEFLGFVVFENKL 1037

Query: 817  QEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIV---NEETKED-- 871
            +     T+  LQ+AG++  + TGD   TAI++G    L++E    +     N +  ED  
Sbjct: 1038 KPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLI 1097

Query: 872  ---TRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVI 928
                  +    L+ +    ++     ++A+  D   L +   E L + ++ +  L K+ I
Sbjct: 1098 IWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINM-VLLKSSI 1156

Query: 929  CCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADF 988
              R+SP +K  +V  ++     ++   GDGAND   ++AA VGV +S  E   A+ +A F
Sbjct: 1157 YARMSPDEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAADVGVSLSEAE---ASVAAPF 1212

Query: 989  AIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALY 1026
                F     L ++       R SL   +S ++ M+LY
Sbjct: 1213 TSSVFEISCILDVIKEG----RASLTTSFSCFQYMSLY 1246

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 7/100 (7%)

Query: 250 NRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVG 309
           N Y     + ++ ++S +   VE  K S    E++HS C+V   R G +V+    ++  G
Sbjct: 519 NYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPG 578

Query: 310 DIIRVR--SEEAIPADLIILSSSEPEGLCYIETANLDGET 347
           D+  +   S    P D ++LS     G C +  + L GE+
Sbjct: 579 DVYEISDPSLSTFPCDSLLLS-----GDCIVNESMLTGES 613

>Kwal_47.17547
          Length = 1240

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 183/799 (22%), Positives = 315/799 (39%), Gaps = 170/799 (21%)

Query: 258 LLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSE 317
           +LVV++V +  +  ++L+ S  + + N     VL  R+G+       DI VGDI+ +++ 
Sbjct: 158 VLVVILVGSANDYQKELQFSKLNDKKNDREVIVL--RNGDEHLISIHDILVGDILSLQTG 215

Query: 318 EAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSE 377
           + +PAD I++     +G C  + + L GE+   IK+A  +   Y   K L      +   
Sbjct: 216 DVVPADCILV-----KGSCECDESALTGES-ATIKKAAIDVC-YEKYKQLSATDAAIDIG 268

Query: 378 HPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRN---TAWIFGLIVFTGHETKLMR-- 432
            P +                   PD ML+ G+ L +    A +  + V + H   LM   
Sbjct: 269 TPGAEKV----------------PDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLMALK 312

Query: 433 -NATATPIKRTAVERVINM-QILALFGVLIVLALISSTGNVIMTKRDSAHL---GYLYIE 487
             A  TP++    ER+ ++   ++++G    L L       I+  R  A+L   G L+  
Sbjct: 313 VEAETTPLQ----ERLDSLANSISVYGSAAALLLF-----FILFMRFLANLKKGGELHDL 363

Query: 488 GTNKAGLFFKDILTFWI-LFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVV 546
              + G  F +I    I +    VP  L + V +   +    +  D +L          V
Sbjct: 364 TPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNL----------V 413

Query: 547 RTSSLVEELGQIEYIFSDKTGTLTRNVM-------------EFKSV-----------SIA 582
           R     E +G    + SDKTGTLT N M             E +SV           +IA
Sbjct: 414 RVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETDVDLAIA 473

Query: 583 GRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLL-------- 634
             C      E+ +  V   I +   +FE+ K+   D   +E        +L         
Sbjct: 474 NECS-----EELKKDVLTNITLNSTAFEN-KENEEDKVSNENPFHKPRKSLFPWSRNNKS 527

Query: 635 ---ATCHTVIPETQSDGTIKYQAASPDEGALVQGA-ADLGFR--FDIR-RPNSVSISTPF 687
              AT   ++    +D   +    S  E AL+  A  +LG +     R  P+ + I    
Sbjct: 528 KKPATAKELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIE--- 584

Query: 688 SEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERL------DSEFNPY 741
                 +++ I  F S+RK    + +  +G  + + KGA  ++L R       DS+    
Sbjct: 585 ------KIVQIIPFESSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLI 638

Query: 742 VQSTL----RHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIY-----EAASTTM-----K 787
            Q       + + + AAE LR + +A R  P       S++      EAAS  +      
Sbjct: 639 SQKDFDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEV 698

Query: 788 DRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAIN 847
            R++ +   A+ +   +   G   I+D L++GV +++   Q+AG+ V ++TGD   TA  
Sbjct: 699 SRSDSVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATA 758

Query: 848 IGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGY 907
           I   C +LSE+                N +S +      ++S ++   +           
Sbjct: 759 IAKKCSILSEEQ-------------AENPESSMEGPRFRKLSNKERVRI----------- 794

Query: 908 ALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQA 967
                          L    +  R SP  K ++V+ +K K   ++   GDG ND   ++ 
Sbjct: 795 ---------------LPNLRVLARSSPEDKRILVETLK-KMGDVVAVTGDGTNDAPALKL 838

Query: 968 AHVGVGISGMEGMQAARSA 986
           A VG  + G+ G + AR A
Sbjct: 839 ADVGFSM-GIAGTEVAREA 856

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 119/498 (23%), Positives = 206/498 (41%), Gaps = 68/498 (13%)

Query: 556  GQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDK 615
            G+++ +  DKTGTLT   ++   +  A        PE     ++    I        K  
Sbjct: 760  GKVDMMCFDKTGTLTEEGLDVLGIHFAK-------PEGSSTILQLSDLITDCDEVLQKHT 812

Query: 616  MTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTI-------------KYQAASPDEGAL 662
            ++D    E      FL  L TCH++      DG +             K+      E   
Sbjct: 813  LSDCNSAEEFKAKNFLVSLLTCHSL---KHIDGELLGDPLDLKMFEFTKWAYEEGYESWK 869

Query: 663  VQGAAD-LGFRFDIRRPNSVSISTPFSEQLEYQLLNIC---EFNSTRKRMSAIFR-MPDG 717
             + A D  G    +  P S   +  F E     L+ +    EF S  +RMS I +   + 
Sbjct: 870  FKNAEDKTGISPAVVHPTS---NCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKEN 926

Query: 718  SIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSK 777
            +   F KGA  VI +  +    P     L H   Y   G R +  A +T+P+  +    K
Sbjct: 927  TYWSFTKGAPEVIADICNPATIPKDFHELLH--HYTHNGFRIIACAGKTLPKSSWLYSQK 984

Query: 778  IYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVL 837
            +                 + E +E +L FLG    E+KL+      +  LQ A ++  + 
Sbjct: 985  V-----------------SREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMC 1027

Query: 838  TGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQ--------SKLNAIESHQIS 889
            TGD   TA+++G    L+S +   +    +  E++R  L         S L+A+    ++
Sbjct: 1028 TGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLN 1087

Query: 890  QQDMN-SLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKT 948
              + + +LA+  D   + +  +E L D +++   L K  I  R+SP +K  +V+ +++  
Sbjct: 1088 DPEKSYTLAITGDIFRILFRNDEILPDDYIST-VLMKGSIYARMSPDEKHELVEQLQKLD 1146

Query: 949  SSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSY 1008
             ++    GDGAND   ++AA++G+ +S  E   A+ +A F    F     L ++      
Sbjct: 1147 YNVGFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCVLDVIKEG--- 1199

Query: 1009 QRISLAILYSFYKNMALY 1026
             R SL   +S ++ M+LY
Sbjct: 1200 -RASLVTSFSCFQYMSLY 1216

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 7/108 (6%)

Query: 252 YTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDI 311
           Y   G + ++ ++S +   +E  K S    +++H  C+V   +   + +    D+  GD+
Sbjct: 502 YYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDL 561

Query: 312 IRVR--SEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQE 357
             +   S   +P D +++S     G C +  + L GE+    K A  E
Sbjct: 562 FEISDPSLVVLPCDAVLIS-----GDCIVNESMLTGESVPVSKYAATE 604

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 189/827 (22%), Positives = 331/827 (40%), Gaps = 152/827 (18%)

Query: 252  YTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDI 311
            Y   G + ++ ++S +   +E  K S    E++H  C+V   R G +      ++  GDI
Sbjct: 503  YYYAGCIFLISLLSILDTLIETKKISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDI 562

Query: 312  IRVRSEEA--IPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCK 369
              +       +P D I+LS     G C +  + L GE+   +  ++   +    E+ + +
Sbjct: 563  YEISDPNLNLLPCDSILLS-----GDCIVNESMLTGES---VPVSKYPAS----EETILQ 610

Query: 370  LHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHET- 428
            L    QS   ++ L     +   NG+T        L+R       +    + V TG  T 
Sbjct: 611  LFDDFQSTQISTFL---SKSFLFNGTT--------LIRAKIPNGGSVALAMAVRTGFSTT 659

Query: 429  --KLMRN-----ATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHL 481
               L+R+      +       + + +  M I+A FG  I      S  N I         
Sbjct: 660  KGSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSI------SCINFIKL------- 706

Query: 482  GYLYIEGTNKAGLFFK--DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEE 539
                  G +K  +  +  DI+T       +VP +L  T+          IG+   L   +
Sbjct: 707  ------GLDKRTMILRALDIITI------VVPPALPATL---------TIGTSFALNRLK 745

Query: 540  SD-----TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDR 594
                    PT V         G+I+ +  DKTGTLT + ++   V ++  C         
Sbjct: 746  EKGIFCIAPTRVNIG------GKIDVMCFDKTGTLTEDGLDVLGVRVS--CAATRNKASF 797

Query: 595  RATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHT---VIPETQSD---- 647
               + D  +I F  F SLKD  ++P+D +      FL  L TCH+   V  E   D    
Sbjct: 798  SDLISDTHDI-FPKF-SLKD-CSNPDDYKRR---NFLISLLTCHSLRVVDGELLGDPLDF 851

Query: 648  GTIKYQAASPDEGALVQGAADL------GFRFD--------IRRPNSVSISTPFSEQLEY 693
               ++   S +E         L      G  F         I  PN       F +    
Sbjct: 852  KMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPN 911

Query: 694  QLLNIC---EFNSTRKRMSAIFRMPDGSIK-LFCKGADTVILERLDSEFNPYVQSTLRHL 749
             +L I    EF S  +RMS I +  + ++   + KGA  VI++  +    P     +  L
Sbjct: 912  NILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDI--L 969

Query: 750  EDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGA 809
              Y   G R +  A +T+P+  +     +Y     + K R EE       +E ++ FLG 
Sbjct: 970  NFYTHSGYRVIACAGKTLPKNTW-----LY-----SQKVRREE-------VESNMEFLGF 1012

Query: 810  TAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSED--------MNL 861
               ++KL++    T+  L+ A ++  + TGD   TAI++G  C+L++ED         + 
Sbjct: 1013 IIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSD 1072

Query: 862  LIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGK--SLGYALEEDLEDQFLT 919
            + V      +  +N +  L+      I         L I G+   + ++ +++  ++++ 
Sbjct: 1073 MTVQPVIHWNEISNAEHILDTFTLQPIDDYS-GPYTLAITGEVFRIIFSNQDNYSEEYVN 1131

Query: 920  IGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEG 979
               L K  I  R+SP +K  +V+ +++   ++    GDGAND   ++AA VG+ +S  E 
Sbjct: 1132 -EILLKGSIFARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE- 1188

Query: 980  MQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALY 1026
              A+ +A F    F     L ++       R SL   ++ ++ M+LY
Sbjct: 1189 --ASVAAPFTSKIFDITCVLDVIKEG----RASLVTSFACFQYMSLY 1229

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 207/881 (23%), Positives = 349/881 (39%), Gaps = 183/881 (20%)

Query: 252  YTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDI 311
            Y     + ++ ++S      E  K S    E++H  CDV   R   +      ++  GDI
Sbjct: 515  YYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDI 574

Query: 312  IRVRSEEA--IPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCK 369
              V       +P D I+LSS      C +  + L GE+    K    E   Y     LC 
Sbjct: 575  YEVSDPNITILPCDSILLSSD-----CIVNESMLTGESVPVSKFPATEETMY----QLCD 625

Query: 370  LHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETK 429
                 Q     S  + Y GT  +      ++P Q       +R      G     G   +
Sbjct: 626  DFQSTQISSFVSKSFLYNGTNIIRAR---IAPGQTAALAMVVRT-----GFSTTKGSLVR 677

Query: 430  LMRNATATPIK--RTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIE 487
             M     T  K  R + + +  M ++A+FG  +                  + + ++ + 
Sbjct: 678  SMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCV------------------SCVQFIKL- 718

Query: 488  GTNKAGLFFK--DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESD---- 541
            G +K  +  +  DI+T       +VP +L  T+          IG++  L   +      
Sbjct: 719  GLDKKTMILRALDIITI------VVPPALPATL---------TIGTNFALSRLKEKGIFC 763

Query: 542  -TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIA------GRCYIETIPEDR 594
             +PT +  S      G+I+ +  DKTGTLT + ++   V I+      G+ + E + + R
Sbjct: 764  ISPTRLNIS------GKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIR 817

Query: 595  RATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTI---- 650
            +          F  F SL D  + P D ++     F   L TCH++      DG +    
Sbjct: 818  QV---------FPKF-SLND-CSSPLDFKSR---NFFMSLLTCHSL---RSVDGNLLGDP 860

Query: 651  ------KYQAASPDEG-------ALVQG-AADLGFRFD------IRRPNSVSISTPFSEQ 690
                  ++   S +E        +L +G   D  F  +      +  P+S +    F++ 
Sbjct: 861  LDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDN 920

Query: 691  LEYQLLNIC---EFNSTRKRMSAIFRMPDGSIKL-FCKGADTVILERLDSEFNPY-VQST 745
              +  L +    EF S  +RMS I +  +  +   F KGA  VI E  +    P   +  
Sbjct: 921  DPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEV 980

Query: 746  LRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLF 805
            LR    Y   G R +  A +T+P++ +    K+                 + E +E +L 
Sbjct: 981  LRC---YTHNGYRVIACAGKTLPKRTWLYSQKV-----------------SREEVESNLE 1020

Query: 806  FLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLS--------- 856
            FLG    ++KL++   ET+  LQ+A ++  + TGD   TAI++G    L+          
Sbjct: 1021 FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSI 1080

Query: 857  EDMNL----LIVNEETKE-----DTRTNLQSKL--NAIESHQISQQDMNSLALVIDGKSL 905
             D  L    +IV  +  E     DT+T    KL  N++ES +       +LA+  D   L
Sbjct: 1081 NDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNY---TLAVSGDVFRL 1137

Query: 906  GYALEEDLEDQFLTIGKLCKAVICCRVSPLQK-ALVVKMVKRKTSSLLLAIGDGANDVSM 964
             +  E ++ +++L    L  + I  R+SP +K  L++++  +K    +   GDGAND   
Sbjct: 1138 LFRDENEIPEEYLN-EILLNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGA 1194

Query: 965  IQAAHVGVGISGMEGMQAA--RSADFAIG----QFRFLRKLLIVH-GSWSY-------QR 1010
            ++AA VG+ +S  E   AA   S  F I       R  R  L+     + Y       Q 
Sbjct: 1195 LKAADVGISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQF 1254

Query: 1011 ISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTF 1051
            I++ ILYS   N+  +  QF Y+        +I  SW+ ++
Sbjct: 1255 ITITILYSRGSNLGDF--QFLYIDLLLIVPIAICMSWSKSY 1293

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 184/829 (22%), Positives = 320/829 (38%), Gaps = 162/829 (19%)

Query: 258  LLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVR-- 315
            + ++ ++S +   VE  + S    EL+   CDV   R G + +    D+  GDI  +   
Sbjct: 509  IFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIYELTDP 568

Query: 316  SEEAIPADLIILSSSEPEGLCYIETANLDGETNL--KIKQARQETANYLDEKALCKLHGR 373
            S   +P D I++S     G C +  + L GE+    K+   R+     LD+    +L   
Sbjct: 569  SLSLLPCDSILIS-----GDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSF 623

Query: 374  VQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHET---KL 430
            V      S  + + GT               L+R       +   G++  TG  T    L
Sbjct: 624  V------SKSFLFNGTK--------------LIRVRATAGQSIALGMVARTGFSTTKGSL 663

Query: 431  MRN-----ATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLY 485
            +R+      T       + + +  + I+ALFG  +                  + + +L 
Sbjct: 664  VRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAV------------------SFIQFLR 705

Query: 486  IEGTNKAGLFFKDILTFWILFSNLVPISLFV----TVEMIKYYQAYMIGSDLDLYHEESD 541
            + G +K  +  + +    ++    +P SL +     +  +K    + I            
Sbjct: 706  L-GLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCI------------ 752

Query: 542  TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDG 601
            +PT V         G+I+ +  DKTGTLT + ++   V +      E         V+D 
Sbjct: 753  SPTRVNVG------GKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDL 806

Query: 602  IEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGA 661
            ++       SL D ++   D +A     FL  L TCH++      DG +      P +  
Sbjct: 807  LQS-----LSLSDCVST-RDMKAK---NFLVSLLTCHSL---RMVDGEL---LGDPFDFK 851

Query: 662  LVQ----------GAADLGFRFDIRRPNSV---------SISTP-----FSEQLEYQLLN 697
            +VQ          G   +   ++ R   S          +I  P     F E+    ++ 
Sbjct: 852  MVQFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIG 911

Query: 698  IC---EFNSTRKRMSAIFR-MPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYA 753
            I    EF S  +RMS I +   +     F KGA  VI E    +  P     L H   Y 
Sbjct: 912  IVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLH--HYT 969

Query: 754  AEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIE 813
              G R +  A + +  + +    K+                 + E IE +L FLG    E
Sbjct: 970  HNGYRVIACAGKKLTRQSWLYSQKV-----------------SREEIESNLEFLGFIIFE 1012

Query: 814  DKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM------SCRLLSEDMNLLIVNEE 867
            +KL+    ET+  L  A ++  + TGD   TAI++G       S R+    +N +  ++E
Sbjct: 1013 NKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQE 1072

Query: 868  TKEDTRTNLQSKLNAIESHQIS--QQDMNSLALVIDGKSLGYALEED---LEDQFLTIGK 922
                T  N+ +  + ++S  +     D +   L + G+      + D   +E+    I  
Sbjct: 1073 GDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNI-- 1130

Query: 923  LCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 982
            L K  I  R+SP +K  +V+ ++     +    GDGAND   ++AA +G+ +S  E   A
Sbjct: 1131 LLKTSIYARMSPDEKHELVERLQSIGYQVGFC-GDGANDCGALKAADIGISLSEAE---A 1186

Query: 983  ARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALY-MTQF 1030
            + +A F    F     L ++       R +L   ++ ++ M+LY  TQF
Sbjct: 1187 SVAAPFTSRLFEISCVLDVMKEG----RAALVTSFACFQYMSLYSATQF 1231

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 183/873 (20%), Positives = 333/873 (38%), Gaps = 168/873 (19%)

Query: 289  DVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETN 348
            DV+  R+G+       D+ VGD+I +++ + +PAD +++S     G C  + + L GE+ 
Sbjct: 240  DVVVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLIS-----GSCECDESALTGES- 293

Query: 349  LKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRG 408
                    +T   +  K   + + ++  + P   + ++     +        PD +L+ G
Sbjct: 294  --------DTIKKVALKPALEKYKQIFEKDPTIDIGSHGVGEKV--------PDPLLISG 337

Query: 409  ATLRNTAWIFGLIVFTGHET-------KLMRNATATPIKRTAVERVINM-QILALFGVLI 460
            + L  +     +I   G  +        L   + +TP++    ER+ N+   ++++G + 
Sbjct: 338  SKLL-SGIGNAVITSVGENSVNGRIMMALKTESESTPLQ----ERLSNLADNISIYGCMA 392

Query: 461  VLALISSTGNVIMTKRDSAHL----GYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFV 516
             L L      +I+  R   +L     Y  +    K   F    +T   +    VP  L +
Sbjct: 393  ALVLF-----IILFIRFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPL 447

Query: 517  TVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM-- 574
             V +   +    +  D +L          VR     E +G    I SDKTGTLT N M  
Sbjct: 448  AVTLALAFATTRMTKDGNL----------VRVLRACETMGSATAICSDKTGTLTENRMTV 497

Query: 575  -------------------EFKS-VSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKD 614
                               E KS V +   C    + +     +   I +   +FE+ + 
Sbjct: 498  VKGFAGNLGFDDTTHAENKEIKSAVVLRSNCDASLLTD-----ILSNISLNSTAFENKES 552

Query: 615  KMTDPEDDEAGIVIEFLTLLA-----TCHTVIPETQSDGTIKYQAASPDEGALVQGAADL 669
            +  D + DE        +L           +I +   +   ++  +  +   L      L
Sbjct: 553  QHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIADAMKENDEQFLGSKTETALLAFAQKSL 612

Query: 670  GFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDG-SIKLFCKGADT 728
            G + D+ +     + T  S+    +++ +  F S+RK  +   ++ D    + + KGA  
Sbjct: 613  GMK-DVHK-----LRTKPSDLGIDKVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAE 666

Query: 729  VILERLDSEFN------PYVQ----STLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKI 778
            ++L+   ++ N      P  Q     + + ++D A+  LRT+ +  R     +++EW   
Sbjct: 667  ILLKVCSNQRNSDNSIVPMNQDLYDESFKKIQDMASHALRTISLVHR-----DFKEWPPK 721

Query: 779  YEAASTTMKDRTEELDRAAELIEHDLFFLGAT-----AIEDKLQEGVPETIHHLQEAGLK 833
              A ST     + +L    EL   +L   G T      ++D L+EGV E++   Q AG+ 
Sbjct: 722  EFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVT 781

Query: 834  VWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDM 893
            V ++TGD   TA  I  +C +LS         EE   D          A+E     +   
Sbjct: 782  VRMVTGDNILTARAISRNCNILS---------EEGYNDPEC-------AMEGPTFRKLPY 825

Query: 894  NSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLL 953
              +  VI                        K  +  R SP  K ++V+ +K K   ++ 
Sbjct: 826  KKMLRVIP-----------------------KLRVLARSSPEDKRILVETLK-KMGEVVA 861

Query: 954  AIGDGANDVSMIQAAHVG--VGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRI 1011
              GDG ND   ++ A VG  +GISG E  + A         F  +    I  G      I
Sbjct: 862  VTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFTAIVN-AIKWGRCVSVSI 920

Query: 1012 SLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGI--FDQ 1069
               I +    N+   +  F    A+A    S++ +  L + N+    +    +     D+
Sbjct: 921  KKFIQFQLTVNITAVILTFVSAVASA-EETSVLTAVQLLWVNLIMDTLAALALATDKPDE 979

Query: 1070 FVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVL 1102
            F+    LDR P+    G+     +V+  W  +L
Sbjct: 980  FI----LDRKPK----GRDAPLIAVST-WKMIL 1003

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 156/733 (21%), Positives = 287/733 (39%), Gaps = 138/733 (18%)

Query: 305 DIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDE 364
           D+ VGD++ +++ + +P D I++     EG C  + + + GE++  IK+     +     
Sbjct: 200 DLLVGDLLSLQTGDVVPVDCILV-----EGKCECDESGITGESD-TIKKVSLAMS----- 248

Query: 365 KALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFT 424
               +++  V +++P++ + + +     NG +  L PD ML+ G+ L +      +    
Sbjct: 249 ---LQVYRTVAADNPSADIGSSD-----NGHS--LVPDPMLISGSKLLSGIGHAVVTAVG 298

Query: 425 GHET--KLMRNATATPIKRTAVERVINM-QILALFGVLIVLALISSTGNVIMTKRDSAHL 481
            H    K+M    + P      ER+  +   ++++G +    L      V++  R  ++L
Sbjct: 299 PHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLF-----VVLFLRFLSYL 353

Query: 482 --GYLY--IEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYH 537
             G LY  +    K   F    +T   +    VP  L + V +   +    +  D +L  
Sbjct: 354 PKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL-- 411

Query: 538 EESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRAT 597
                   VR     E +G    + SDKTGTLT+N M        G  + + I ED    
Sbjct: 412 --------VRVLRACETMGSATTVCSDKTGTLTQNKMVVVK-GFLGSSHFDDISEDSNCA 462

Query: 598 VEDGIE--------------IGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPE 643
             D +               I  +S      ++ DP   E        +L        P+
Sbjct: 463 QSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVITENPYHKPRRSLFPWSRNNKPK 522

Query: 644 TQSDGTIKYQAA-----SPDEGALV---QGAADLGFRFDIRR-PNSVSISTPFSEQLEYQ 694
             +      Q+A     S  E AL+   +G+  L     +R  P+ + I++         
Sbjct: 523 YPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHHIGIAS--------- 573

Query: 695 LLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILER---LDSEFNPYVQ-STLRHLE 750
           ++ +  F S+RK    + R+ DG+ + F KGA   I +    + S  +  ++ S  +H E
Sbjct: 574 IVQMIPFESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGE 633

Query: 751 ------DYAAEGLRTLCIASR------TIPEKEYEEWSKIYEAASTTMKDR---TEELDR 795
                 + A++ LRT+ +A +      + P  E  + S    A+   +          DR
Sbjct: 634 IFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDR 693

Query: 796 AAELIEHD--LFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCR 853
            + +  ++  L   G   I D L+ GV E++ + Q++G+ V ++TGD   T   I  +C 
Sbjct: 694 PSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACG 753

Query: 854 LLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDL 913
           +LS             E    + +  +      ++S++ M   A                
Sbjct: 754 ILS-------------ESEYADHECAMEGPVFRKLSRRQMMDAA---------------- 784

Query: 914 EDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVG 973
                      K  +  R SP  K + V ++K K + ++   GDG ND   +  A VG  
Sbjct: 785 ----------PKLKVLARSSPEDKRIFVDILK-KMNEVVAVTGDGTNDAPALTLADVGFS 833

Query: 974 ISGMEGMQAARSA 986
           + G+ G   AR A
Sbjct: 834 M-GISGTGVAREA 845

>Kwal_23.3160
          Length = 1100

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 225/1103 (20%), Positives = 417/1103 (37%), Gaps = 226/1103 (20%)

Query: 256  GTLLVVLIVSAVKESVEDLKRS---NADKELNHSLCDVLDERSGEFVRKKWIDIAVGDII 312
            G +  V+ ++    S ++ K S   N+ K L+     V+ + + E +  K   +  GD+ 
Sbjct: 101  GVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSK--QLVPGDLC 158

Query: 313  RVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLH- 371
             V++ + +PADL ++     E     + A L GE+    K+A Q      D     +L+ 
Sbjct: 159  VVKAGDTVPADLRLIECVNFE----TDEALLTGESLPIAKEASQVYPATEDTPVGDRLNL 214

Query: 372  ---------GRVQSEHPNSSLYTYEGTM--TLNGSTFPLSPDQMLLRGATLRNTAWIFGL 420
                     GR       + L T  G +  +L G    +S D+          T W    
Sbjct: 215  AFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDE--------NKTFWANAG 266

Query: 421  IVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAH 480
            I         +   T TP+ R    ++  + +L LF + +V A++     V+ T++   +
Sbjct: 267  ITLAATIGSFLGTTTGTPLHR----KLSKLAVL-LFFIAVVFAIV-----VMATQKFVVN 316

Query: 481  LGYLYIEGTNKAGLFFKDILTFWILFS-NLVPISLFVTVEMIKYYQAYMIGSDLDLYHEE 539
                            K++  + I  + +++P SL V + +     A ++ +        
Sbjct: 317  ----------------KEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMAT-------- 352

Query: 540  SDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSVSIAGRCY----- 586
                 VVR    +E LG +  + SDKTGTLT+  M         F +++++         
Sbjct: 353  --RNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPT 410

Query: 587  ---IETIP-----EDRRATVED-GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATC 637
               IE IP     + +  + ED GI   F + +   DK+  P    + + + +L   A  
Sbjct: 411  DGGIELIPRFSPHQYKHDSTEDVGIITSFKN-KFYNDKL--PAGLNSKLFLNWLKTAALA 467

Query: 638  HTVIPETQSDGTIKYQA-ASPDEGALVQGAADLGF---------RFDIRRPNSVSISTPF 687
            + +    Q   T +++A   P E A+   A  L           + D       ++    
Sbjct: 468  N-IAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKT 526

Query: 688  SE-QLEYQLLNICEFNSTRKRMSAIFRM--PDGSIKLFCKGADTVILERL---------D 735
            S  +  Y+ +    F+S+ KRMSA++     D + ++F KGA   +L+           +
Sbjct: 527  SSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNE 586

Query: 736  SEFNPYVQS----TLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTE 791
            S+  P  +       +++E  ++EGLR L  A+++  E +  + S              E
Sbjct: 587  SDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVS--------------E 632

Query: 792  ELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMS 851
            +L +  + +E DL F G   I D  ++     +    +AG+ V +LTGD   TA  I   
Sbjct: 633  DLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQE 692

Query: 852  CRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEE 911
              +L    NL    +E  +         + A +  Q++ +++++L L+            
Sbjct: 693  VGILPR--NLYHYPKEVVDSMV------MTAAQFDQLTDEEIDNLLLL------------ 732

Query: 912  DLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVG 971
                           ++  R +P  K  ++  + R+        GDG ND   ++ A+VG
Sbjct: 733  --------------PLVIARCAPQTKVRMIDALHRR-EKFCAMTGDGVNDSPSLKKANVG 777

Query: 972  VGISGMEGMQAARSA-DFAIGQFRFLRKLLIV-HGSWSYQRISLAILYSFYKNMALYMTQ 1029
            + + G+ G   A+ A D  +    F   L  V  G      I   +L    +N+A     
Sbjct: 778  IAM-GINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVA---QA 833

Query: 1030 FWYVFANAFSGQSIMESWTLTFYNVFFTVM-----PPFVIGIFDQFVTSRLLDRYPQLYK 1084
             + +    F  +  +  + L+   V + ++     P   +G+  +     ++++ PQ  K
Sbjct: 834  LYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFPAMGLGL--EKSAPDIMEKEPQDSK 891

Query: 1085 LGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSV-LFYRYG------NCLNMGGETADH--- 1134
             G     F+  I    ++ G + +A      + + Y  G      NC N   E+ D+   
Sbjct: 892  AG----IFTWEIILDMLIYGTWMAACCLACFITVIYGKGNGELGINCNNSYSESCDNVYH 947

Query: 1135 ----------WV-----WGVGIYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFF 1179
                      W      W V     S   +  +     +QW K          + W + F
Sbjct: 948  GRAATFASMTWCALILAWEVIDMRRSFFKMQPETDTPYTQWMKDIW---SNQFLFWSVIF 1004

Query: 1180 PFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTY------ 1233
             F S VFP V +      +  H  G    W + +   +   +   ++KY+KR Y      
Sbjct: 1005 GFVS-VFPVVYIPVINKDVFKH-KGIGYEWGLAVAYTIAFWIGAELYKYFKRCYFKNKGR 1062

Query: 1234 --SP----ESYHVVQEMQKYNIS 1250
              +P    ES  V    +KYN +
Sbjct: 1063 AQNPEKDLESRRVHDPFEKYNTA 1085

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 178/801 (22%), Positives = 313/801 (39%), Gaps = 173/801 (21%)

Query: 252 YTTIGTLLVVLIVSAVKESVEDLKRS---NADKELNHSLCDVLDERSGEFVRKKWIDIAV 308
           + T G +  V+ ++ +   +++ K S   NA + L+     V+   + E V     D+  
Sbjct: 87  WITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDST--DVVP 144

Query: 309 GDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALC 368
           GD++ V+  + IPADL ++S    E     + A L GE+ L + +   E   + DE  + 
Sbjct: 145 GDLVVVKVGDTIPADLRLVSQQNFE----TDEALLTGES-LPVSKDANEI--FDDETPVG 197

Query: 369 K-----------LHGRVQSEHPNSSLYTYEGTM--TLNGSTFPLSPDQMLLRGATLRNTA 415
                       + GR Q     + L T  G +  +L G    +S D       T    A
Sbjct: 198 DRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDP----AKTWYQNA 253

Query: 416 WIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTK 475
           WI          TK    A     + T + R ++   + LF + +V A++          
Sbjct: 254 WI---------STKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVD 304

Query: 476 RDSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDL 535
           R  A                   I    +  S ++P SL V + +     A ++ S    
Sbjct: 305 RGVA-------------------IYAVCVALS-MIPSSLVVVLTITMSVGAAVMAS---- 340

Query: 536 YHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRR 595
                    ++R    +E LG +  I SDKTGTLT+  M  K + +     ++ +  +  
Sbjct: 341 ------RNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEP 394

Query: 596 ATVEDGIEIGF----------HS-------FESLKDKM---TDPEDDEAGIVIEFLTL-- 633
              E G +I F          H+        ++ KDK    + P + +  +  ++L    
Sbjct: 395 LNPEKG-DINFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETAS 453

Query: 634 LATCHTVI--PETQSDGTIKYQA-ASPDEGALVQGAADL--------GFRFDIRRP---N 679
           LA   +V   PET+     +++A   P E A+   A  +        G R D+      +
Sbjct: 454 LANIASVFTDPETK-----EWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMS 508

Query: 680 SVSISTPFSEQLEYQLLNICEF--NSTRKRMSAIFRMPD-GSIKLFCKGADTVILERLDS 736
           SVS+S   +     +  +  EF  +ST KRMS+++   D  + +++ KGA   +L     
Sbjct: 509 SVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTH 568

Query: 737 EF-----------NPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTT 785
            +           +  V +   +++  ++EGLR L  A+++ P+ +  E     E     
Sbjct: 569 WYGRDPNTATVMTDADVDTIKENIDSMSSEGLRVLAFANKSYPKSDVNE-----EKLQKI 623

Query: 786 MKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETA 845
           +K+R        +  E  L FLG   I D  +E     +    +AG+ V +LTGD   TA
Sbjct: 624 LKER--------DYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTA 675

Query: 846 INIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSL 905
             I     +L                  TNL         +  S++ ++   +V+ GK  
Sbjct: 676 KAIAQEVGILP-----------------TNL---------YHYSKEVVD--IMVMTGKQF 707

Query: 906 GYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMI 965
              L ED  D    +      ++  R SP  K  +++ + R+     +  GDG ND   +
Sbjct: 708 D-NLSEDEIDNLPVL-----PLVIARCSPQTKVRMIEALHRREKFCAMT-GDGVNDSPSL 760

Query: 966 QAAHVGVGISGMEGMQAARSA 986
           + A+VG+ + G+ G   A+ A
Sbjct: 761 KMANVGIAM-GINGSDVAKDA 780

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 160/700 (22%), Positives = 280/700 (40%), Gaps = 145/700 (20%)

Query: 294 RSGEFVR---KKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLK 350
           R G++V     + + + V  ++R   + A+P DLI++     +G C +  A L GE+   
Sbjct: 258 RDGKWVEMQTNELLPMDVVSVVRTAEDSALPCDLILV-----DGTCIVNEAMLSGESTPL 312

Query: 351 IKQA-RQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGST------FPLSPDQ 403
           +K++ R    N             +Q E  +     + GT  L  +T       P  PD 
Sbjct: 313 LKESIRLRPGNE-----------ELQIEGTDKISVLHGGTKVLQVTTPEKTGKVPSPPDG 361

Query: 404 MLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERV--INMQILALFGVLIV 461
               GA          ++  TG ET      +   +   + ERV   N + L     L++
Sbjct: 362 ----GA--------IAIVTKTGFETS---QGSLVRVMIYSSERVGVDNKEALYFILFLLI 406

Query: 462 LALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMI 521
            A+++S               Y+++EGT    +  K IL   ++ +++VP  L   +E+ 
Sbjct: 407 FAVVAS--------------WYVWVEGTKMGRVQSKLILDCILIITSVVPPEL--PMELT 450

Query: 522 KYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSI 581
               + +  S L  ++     P  +  +      G+I+    DKTGTLT   + F+    
Sbjct: 451 MAVNSSL--SALSKFYVYCTEPFRIPFA------GRIDVCCFDKTGTLTGEDLVFE---- 498

Query: 582 AGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVI 641
            G   + + P+D R           H + +     TD  +  + +V          H ++
Sbjct: 499 -GLAGLSSDPKDIR-----------HLYSA-----TDCPNSTSLVV-------GAAHALV 534

Query: 642 PETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQL-EYQLLNICE 700
                DG I      P E A ++       ++ + + + V     F+E+  +  +L   +
Sbjct: 535 --RLEDGEI---VGDPMEKATLKA-----LKWTVEKGDKV-----FNEKNGQVTILRRFQ 579

Query: 701 FNSTRKRMSAIFRMPDGSIKLFCKGADTVILERL---DSEFNPYVQSTLRHLEDYAAEGL 757
           F+S  KR S++    DG +    KGA   I ERL    + ++   +S  R        G 
Sbjct: 580 FSSALKRSSSV-ATHDGKLYSAVKGAPETIRERLFTIPANYDEIYKSFTR-------SGS 631

Query: 758 RTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQ 817
           R L +AS     K+ E+ S+           + E+ DR  E  E DL F G       L+
Sbjct: 632 RVLALAS-----KKLEKMSQ----------SQIEDADR--EHFERDLEFNGFLIFHCPLK 674

Query: 818 EGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQ 877
               ETI  L E+  +  ++TGD   TA+++     ++  +  L++   +   D +   +
Sbjct: 675 HDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGE-TLIVDMVDNGNDDKLVFR 733

Query: 878 SKLNAIESHQISQQDMNSLALVIDGKSL---GYALEEDLEDQFLTIGKLCKAVICCRVSP 934
           +    +    +  +D      + D   L   G+ALE  L+        +  A I  RVSP
Sbjct: 734 NVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGHALEA-LKGHHQLQDLIRHAWIYARVSP 792

Query: 935 LQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 974
            QK  ++  +K      L+  GDG NDV  ++ AHVGV +
Sbjct: 793 AQKEFILNNLKDMGYQTLMC-GDGTNDVGALKQAHVGVAL 831

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 172/795 (21%), Positives = 320/795 (40%), Gaps = 160/795 (20%)

Query: 252 YTTIGTLLVVLIVSAVKESVEDLKRS---NADKELNHSLCDVLDERSGEFVRKKWIDIAV 308
           + T G +  V+ V+ +   V++ K +   N+ K L+     V+     E +  K  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 309 GDIIRVRSEEAIPADLIILSSSE---PEGLCYIETANLDGETNLKIKQARQETAN---YL 362
           GDI  V+  + IPADL ++ +      E L   E+  +  + NL   +  + +      L
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNL 208

Query: 363 DEKALCKLHGRVQSEHPNSSLYTYEGTM--TLNGSTFPLSPDQMLLRGATLRNTAWIFGL 420
              +   + GR +     ++L +  G +  +L G +  +S D      + L+NT WI   
Sbjct: 209 AFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDP---SKSWLQNT-WI--- 261

Query: 421 IVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAH 480
                  TK +  A       T + R ++   + LF + ++ A+I     V+ +++    
Sbjct: 262 ------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII-----VMASQKFDVD 310

Query: 481 LGYLYIEGTNKAGLFFKDILTFWILFS-NLVPISLFVTVEM-IKYYQAYMIGSDLDLYHE 538
                           K +  + I  + +++P SL V + + +    A M+  ++     
Sbjct: 311 ----------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNV----- 349

Query: 539 ESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSVSIAG------- 583
                 +VR    +E LG +  I SDKTGTLT+  M         F +++I+        
Sbjct: 350 ------IVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNP 403

Query: 584 -RCYIETIPE---DRRATVEDGIEIGFHSFESLKDKMTD---PEDDEAGIVIEFLTLLAT 636
               +  IP       +  EDG ++G    ++ KD++ +   PED +  +  ++L   AT
Sbjct: 404 NEGNVSLIPRFSPYEYSHNEDG-DVGI--LQNFKDRLYEKDLPEDIDMDLFQKWLET-AT 459

Query: 637 CHTVIPETQSDGTIKYQA-ASPDEGALVQGAADLGFRFDI----------RRPNSVSIST 685
              +    + D T  ++A   P E A+   A  +    +              +  S+S 
Sbjct: 460 LANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQ 519

Query: 686 PFSEQLEYQLLNICEF--NSTRKRMSAIF-RMPDGSIKLFCKGADTVILERLDS------ 736
              +    Q  +I EF  +ST KRMS+++    + +  ++ KGA   I+    S      
Sbjct: 520 HNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDG 579

Query: 737 -EFNPY----VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTE 791
            +  P     V++  +++   + EGLR L  AS++  + +  +             D+ +
Sbjct: 580 VKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-------------DQLK 626

Query: 792 ELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMS 851
            +       E DL FLG   I D  +      +    +AG+ V +LTGD   TA  I   
Sbjct: 627 NITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQE 686

Query: 852 CRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEE 911
             +L                  TNL         +  SQ+ ++S  +V+ G       EE
Sbjct: 687 VGILP-----------------TNL---------YHYSQEIVDS--MVMTGSQFDGLSEE 718

Query: 912 DLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVG 971
           +++D  L +  L    +  R SP  K  +++ + R+     +  GDG ND   ++ A+VG
Sbjct: 719 EVDD--LPVLPL----VIARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSLKMANVG 771

Query: 972 VGISGMEGMQAARSA 986
           + + G+ G   ++ A
Sbjct: 772 IAM-GINGSDVSKEA 785

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 158/701 (22%), Positives = 264/701 (37%), Gaps = 150/701 (21%)

Query: 298 FVRKKWIDIAVGDII--------RVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNL 349
           F  KKW+ +   +++        R   E AIP DLI+L     +G   +  A L GE+  
Sbjct: 259 FRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILL-----DGSAIVNEAMLSGESTP 313

Query: 350 KIKQA---RQETANY----LDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPD 402
            +K++   R    N     +D+ A+  LHG  ++          + T   + S  P  PD
Sbjct: 314 LLKESIKLRPSEDNLQLDGVDKIAV--LHGGTKA---------LQVTPPEHKSDIPPPPD 362

Query: 403 QMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVI--NMQILALFGVLI 460
                G  L        ++  TG ET      +   +   + ERV   N + L     L+
Sbjct: 363 -----GGAL-------AIVTKTGFETS---QGSLVRVMIYSAERVSVDNKEALMFILFLL 407

Query: 461 VLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEM 520
           + A+I+S               Y+++EGT    +  K IL   ++ +++VP  L + + M
Sbjct: 408 IFAVIAS--------------WYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTM 453

Query: 521 IKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVS 580
                   +        E    P            G+I+    DKTGTLT   + F+ ++
Sbjct: 454 AVNSSLAALAKFYVYCTEPFRIPFA----------GRIDVCCFDKTGTLTGEDLVFEGLA 503

Query: 581 IAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTV 640
                               GI     +   L      PE          + ++   H +
Sbjct: 504 --------------------GISADSENIRHLYSAAEAPEST--------ILVIGAAHAL 535

Query: 641 IPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQL-EYQLLNIC 699
           +     DG I      P E A ++        + + R NS      + E   +  ++   
Sbjct: 536 V--KLEDGDI---VGDPMEKATLKAVG-----WAVERKNS-----NYREGTGKLDIIRRF 580

Query: 700 EFNSTRKRMSAIFRMPDGSIKLFC--KGADTVILERLDSEFNPYVQSTLRHLEDYAAEGL 757
           +F+S  KR ++I    D    LF   KGA   I ERL      Y +      + +   G 
Sbjct: 581 QFSSALKRSASIASHNDA---LFAAVKGAPETIRERLSDIPKNYDEI----YKSFTRSGS 633

Query: 758 RTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQ 817
           R L +AS+++P+                 + + ++L+R  + +E +L F G       L+
Sbjct: 634 RVLALASKSLPKMS---------------QSKIDDLNR--DDVESELTFNGFLIFHCPLK 676

Query: 818 EGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQ 877
           +   ETI  L E+  +  ++TGD   TA+++     ++  +   LI++   K D    L 
Sbjct: 677 DDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGET--LILDRAGKSDDNQLLF 734

Query: 878 SKLNAIESHQISQQ----DMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVS 933
             +    S          D + L    D    GYAL   LE        L    +  RVS
Sbjct: 735 RDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNA-LEGHSQLRDLLRHTWVYARVS 793

Query: 934 PLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 974
           P QK  ++  +K      L+  GDG NDV  ++ AHVG+ +
Sbjct: 794 PSQKEFLLNTLKDMGYQTLMC-GDGTNDVGALKQAHVGIAL 833

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 174/797 (21%), Positives = 321/797 (40%), Gaps = 164/797 (20%)

Query: 252 YTTIGTLLVVLIVSAVKESVEDLKRS---NADKELNHSLCDVLDERSGEFVRKKWIDIAV 308
           + T G +  V+ V+ +   V++ K +   N+ K L+     V+     E +  K  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 309 GDIIRVRSEEAIPADLIILSSSE---PEGLCYIETANLDGETNLKIKQARQETANYLDEK 365
           GDI  V+  + IPADL ++ +      E L   E+  +  + NL     ++E  +  D  
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF--GKEEETSVGDRL 206

Query: 366 ALC-----KLHGRVQSEHPNSSLYTYEGTM--TLNGSTFPLSPDQMLLRGATLRNTAWIF 418
            L       + GR +     ++L +  G +  +L G +  +S D      + L+NT WI 
Sbjct: 207 NLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDP---SKSWLQNT-WI- 261

Query: 419 GLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDS 478
                    TK +  A       T + R ++   + LF + ++ A+I     V+ +++  
Sbjct: 262 --------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII-----VMASQKFD 308

Query: 479 AHLGYLYIEGTNKAGLFFKDILTFWILFS-NLVPISLFVTVEM-IKYYQAYMIGSDLDLY 536
                             K +  + I  + +++P SL V + + +    A M+  ++   
Sbjct: 309 VD----------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNV--- 349

Query: 537 HEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSVSIAG----- 583
                   +VR    +E LG +  I SDKTGTLT+  M         F +++I+      
Sbjct: 350 --------IVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPF 401

Query: 584 ---RCYIETIPE---DRRATVEDGIEIGFHSFESLKDKMTD---PEDDEAGIVIEFLTLL 634
                 +  IP       +  EDG ++G    ++ KD++ +   PED +  +  ++L   
Sbjct: 402 NPNEGNVSLIPRFSPYEYSHNEDG-DVGI--LQNFKDRLYEKDLPEDIDMDLFQKWLET- 457

Query: 635 ATCHTVIPETQSDGTIKYQA-ASPDEGALVQGAADLGFRFDI----------RRPNSVSI 683
           AT   +    + D T  ++A   P E A+   A  +    +              +  S+
Sbjct: 458 ATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSL 517

Query: 684 STPFSEQLEYQLLNICEF--NSTRKRMSAIF-RMPDGSIKLFCKGADTVILERLDS---- 736
           S    +    Q  +I EF  +ST KRMS+++    + +  ++ KGA   I+    S    
Sbjct: 518 SQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGK 577

Query: 737 ---EFNPY----VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDR 789
              +  P     V++  +++   + EGLR L  AS++  + +  +             D+
Sbjct: 578 DGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-------------DQ 624

Query: 790 TEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIG 849
            + +       E DL FLG   I D  +      +    +AG+ V +LTGD   TA  I 
Sbjct: 625 LKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIA 684

Query: 850 MSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYAL 909
               +L                  TNL         +  SQ+ ++S  +V+ G       
Sbjct: 685 QEVGILP-----------------TNL---------YHYSQEIVDS--MVMTGSQFDGLS 716

Query: 910 EEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAH 969
           EE+++D  L +  L    +  R SP  K  +++ + R+     +  GDG ND   ++ A+
Sbjct: 717 EEEVDD--LPVLPL----VIARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSLKMAN 769

Query: 970 VGVGISGMEGMQAARSA 986
           VG+ + G+ G   ++ A
Sbjct: 770 VGIAM-GINGSDVSKEA 785

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 174/797 (21%), Positives = 321/797 (40%), Gaps = 164/797 (20%)

Query: 252 YTTIGTLLVVLIVSAVKESVEDLKRS---NADKELNHSLCDVLDERSGEFVRKKWIDIAV 308
           + T G +  V+ V+ +   V++ K +   N+ K L+     V+     E +  K  D+  
Sbjct: 91  WITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSK--DVVP 148

Query: 309 GDIIRVRSEEAIPADLIILSSSE---PEGLCYIETANLDGETNLKIKQARQETANYLDEK 365
           GDI  V+  + IPADL ++ +      E L   E+  +  + NL     ++E  +  D  
Sbjct: 149 GDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF--GKEEETSVGDRL 206

Query: 366 ALC-----KLHGRVQSEHPNSSLYTYEGTM--TLNGSTFPLSPDQMLLRGATLRNTAWIF 418
            L       + GR +     ++L +  G +  +L G +  +S D      + L+NT WI 
Sbjct: 207 NLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDP---SKSWLQNT-WI- 261

Query: 419 GLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDS 478
                    TK +  A       T + R ++   + LF + ++ A+I     V+ +++  
Sbjct: 262 --------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII-----VMASQKFD 308

Query: 479 AHLGYLYIEGTNKAGLFFKDILTFWILFS-NLVPISLFVTVEM-IKYYQAYMIGSDLDLY 536
                             K +  + I  + +++P SL V + + +    A M+  ++   
Sbjct: 309 VD----------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNV--- 349

Query: 537 HEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSVSIAG----- 583
                   +VR    +E LG +  I SDKTGTLT+  M         F +++I+      
Sbjct: 350 --------IVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPF 401

Query: 584 ---RCYIETIPE---DRRATVEDGIEIGFHSFESLKDKMTD---PEDDEAGIVIEFLTLL 634
                 +  IP       +  EDG ++G    ++ KD++ +   PED +  +  ++L   
Sbjct: 402 NPNEGNVSLIPRFSPYEYSHNEDG-DVGI--LQNFKDRLYEKDLPEDIDMDLFQKWLET- 457

Query: 635 ATCHTVIPETQSDGTIKYQA-ASPDEGALVQGAADLGFRFDI----------RRPNSVSI 683
           AT   +    + D T  ++A   P E A+   A  +    +              +  S+
Sbjct: 458 ATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSL 517

Query: 684 STPFSEQLEYQLLNICEF--NSTRKRMSAIF-RMPDGSIKLFCKGADTVILERLDS---- 736
           S    +    Q  +I EF  +ST KRMS+++    + +  ++ KGA   I+    S    
Sbjct: 518 SQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGK 577

Query: 737 ---EFNPY----VQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDR 789
              +  P     V++  +++   + EGLR L  AS++  + +  +             D+
Sbjct: 578 DGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVND-------------DQ 624

Query: 790 TEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIG 849
            + +       E DL FLG   I D  +      +    +AG+ V +LTGD   TA  I 
Sbjct: 625 LKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIA 684

Query: 850 MSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYAL 909
               +L                  TNL         +  SQ+ ++S  +V+ G       
Sbjct: 685 QEVGILP-----------------TNL---------YHYSQEIVDS--MVMTGSQFDGLS 716

Query: 910 EEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAH 969
           EE+++D  L +  L    +  R SP  K  +++ + R+     +  GDG ND   ++ A+
Sbjct: 717 EEEVDD--LPVLPL----VIARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSLKMAN 769

Query: 970 VGVGISGMEGMQAARSA 986
           VG+ + G+ G   ++ A
Sbjct: 770 VGIAM-GINGSDVSKEA 785

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 118/503 (23%), Positives = 199/503 (39%), Gaps = 120/503 (23%)

Query: 545  VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSV----SIAGRCYIETIPEDRRATVED 600
            +VR    VE LG +  I SDKTGTLT N M    +    S++ +  + ++ ++++    +
Sbjct: 352  IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSN 411

Query: 601  GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAA----S 656
            G         +LK+ +T  ED     V E LT+   C+        + +   + A    +
Sbjct: 412  G---------NLKNYLT--ED-----VRETLTIGNLCN--------NASFSQEHAIFLGN 447

Query: 657  PDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMP- 715
            P + AL++  A+     DIR  N+V            Q +    FNS RK M+     P 
Sbjct: 448  PTDVALLEQLANFEMP-DIR--NTV------------QKVQELPFNSKRKLMATKILNPV 492

Query: 716  DGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEW 775
            D    ++ KGA   ILE   S    Y++S  +  E        T+   + ++      E 
Sbjct: 493  DNKCTVYVKGAFERILEYSTS----YLKSKGKKTEKLTEAQKATINECANSMAS----EG 544

Query: 776  SKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVW 835
             +++  A  T+ D +  L    E +  DL F G   + D  +  V   I  L + G+ + 
Sbjct: 545  LRVFGFAKLTLSDSSTPL---TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHII 601

Query: 836  VLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNS 895
            ++TGD + TA+NI                    K+     +  KL+ +   ++ +   + 
Sbjct: 602  MITGDSENTAVNIA-------------------KQIGIPVIDPKLSVLSGDKLDEMSDDQ 642

Query: 896  LALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAI 955
            LA VID  +                       I  R +P  K  +V+ + RK   ++   
Sbjct: 643  LANVIDHVN-----------------------IFARATPEHKLNIVRAL-RKRGDVVAMT 678

Query: 956  GDGANDVSMIQAAHVGVGISGMEGMQAARSA--------DFAI---------GQFRFLRK 998
            GDG ND   ++ + +GV + G  G   A+ A        DF+          G F  ++ 
Sbjct: 679  GDGVNDAPALKLSDIGVSM-GRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQN 737

Query: 999  LLIVHGSWSYQRISLAILYSFYK 1021
             L    S S   +SL  L + +K
Sbjct: 738  FLTFQLSTSVAALSLVALSTAFK 760

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 119/490 (24%), Positives = 198/490 (40%), Gaps = 113/490 (23%)

Query: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIA--GRCYIETIPEDRRATVEDGI 602
           ++R    +E LG +  I SDKTGTLT+  M  K V I   G   ++   E    T+ + I
Sbjct: 350 IIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGE-I 408

Query: 603 EIGFHSFESLKDKMTDPEDDEAGIVIEFLT----------------------LLATCHTV 640
           ++    F   + K  D ED   G++ +F +                       LA   TV
Sbjct: 409 QL-IPKFSPYQYKHDDEED--VGMITDFKSKYYADELGPLNVSLFTQWLYTATLANIATV 465

Query: 641 I--PETQSDGTIKYQA-ASPDEGALVQGAA--DLGFRF----DIRRPNSVSISTPFSEQL 691
              PETQ      ++A   P E A+   A   DL  R     D     ++     F    
Sbjct: 466 FRDPETQD-----WKAHGDPTEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVA 520

Query: 692 EYQLLNICEFNSTRKRMSAIFRM---PDGSI-KLFCKGADTVILERLDSEF-------NP 740
           EY       F+S+ KRMSAI++    P   I ++F KGA   +L+  +S +        P
Sbjct: 521 EYP------FDSSVKRMSAIYKNVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQP 574

Query: 741 YVQSTL----RHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRA 796
             +  L    ++++  ++EGLR L  A +T  E ++           T  KD+   L + 
Sbjct: 575 LTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNESQF-----------TINKDK---LLKE 620

Query: 797 AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLS 856
            + +E++L FLG   I D  +      +     AG+ V +LTGD   TA +I     +L 
Sbjct: 621 RDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILP 680

Query: 857 EDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQ 916
              NL    +E       N    + A +   +S ++++ L ++                 
Sbjct: 681 H--NLYHYPKEV-----VNFMV-MTATDFDALSDKEIDELPVL----------------- 715

Query: 917 FLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISG 976
                     ++  R +P  K  +++ + R+     +  GDG ND   ++ A+VG+ + G
Sbjct: 716 ---------PLVIARCAPQTKVRMIEALHRRNRFCAMT-GDGVNDSPSLKIANVGIAM-G 764

Query: 977 MEGMQAARSA 986
           + G   A+ A
Sbjct: 765 INGSDVAKDA 774

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 104/459 (22%), Positives = 175/459 (38%), Gaps = 126/459 (27%)

Query: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSV----SIAGRCYIETIPEDRRATVED 600
           +VR    VE LG +  I SDKTGTLT N M    +    S+A +  + ++ +++      
Sbjct: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG---- 415

Query: 601 GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEG 660
                     +LK+ +TD          +  T L   +     + S    KY   +P + 
Sbjct: 416 ----------NLKNYLTD----------DVKTTLLCGNLCNNASYSQEHAKY-LGNPTDV 454

Query: 661 ALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK 720
           AL++         D+R               EY  +    FNS RK M+   +  +    
Sbjct: 455 ALLEQLQKFELA-DVRS--------------EYTKVKELSFNSKRKMMATKIQDNEKKTT 499

Query: 721 LFCKGADTVILERLDS---EFNPYVQSTLRHLED-------YAAEGLRTLCIASRTIPEK 770
           LF KGA   IL++  S   E     + T  H E         A+EGLR L  A R +   
Sbjct: 500 LFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT-- 557

Query: 771 EYEEWSKIYEAASTTMKDRTEELDRAAELIE---HDLFFLGATAIEDKLQEGVPETIHHL 827
                                  D +++L+E    DL F G   + D  +  V   I   
Sbjct: 558 -----------------------DSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQF 594

Query: 828 QEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQ 887
            + G+ + ++TGD + TA+NI       +  + + +++             KL+ +   +
Sbjct: 595 LQGGIHIIMITGDSENTAVNI-------ARQIGIPVID------------PKLSVLSGDK 635

Query: 888 ISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRK 947
           +++   + LA VID  +                       I  R +P  K  +V+ ++R+
Sbjct: 636 LNEMTDDQLANVIDHVN-----------------------IFARATPEHKLNIVRALRRR 672

Query: 948 TSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
              ++   GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 673 -GDVVAMTGDGVNDAPALKLADIGVSMGRM-GTDVAKEA 709

>Scas_583.14*
          Length = 875

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 125/497 (25%), Positives = 202/497 (40%), Gaps = 84/497 (16%)

Query: 483 YLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDT 542
           Y+++EGT    +  K IL   ++ + +VP  L + + M     +    S   +Y  E   
Sbjct: 70  YVWVEGTKMGRIQSKLILDCILIITYVVPPELPMELTM-AVNSSLAALSKFYVYCTE--- 125

Query: 543 PTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGI 602
           P  +  +      G+I+    DKTGTLT   + F+     G   +    ED R       
Sbjct: 126 PFRIPLA------GRIDVCCFDKTGTLTGEDLVFE-----GLAGLSDKSEDVR------- 167

Query: 603 EIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGAL 662
               H F S        ED       E + ++   H ++     DG I      P E A 
Sbjct: 168 ----HLFSS--------EDASQ----ETILVVGAAHALV--KLDDGEI---VGDPMEKAT 206

Query: 663 VQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLF 722
           ++    LG++ +     +   S P + +L  Q+L   +F+S  KR S++    D   KLF
Sbjct: 207 LKA---LGWKVE----GNDFTSRPKTGKL--QILRRFQFSSALKRSSSVASHKD---KLF 254

Query: 723 --CKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYE 780
              KGA   I ERL      Y +      + +   G R L +AS+++P    ++      
Sbjct: 255 TAVKGAPETIRERLAVVPKNYDEI----YKSFTRSGSRVLALASKSLPNLSSKQL----- 305

Query: 781 AASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGD 840
                     ++LDR  + IE  L F G       L+    ETI  L E+  +  ++TGD
Sbjct: 306 ----------DDLDR--DEIETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGD 353

Query: 841 RQETAINIGMSCRLLSEDMNLLIVNEETKEDTRT---NLQSKLNAIESHQISQQDMNSLA 897
              TA+++     +++ +  L++   ET  D +    N++  +         + D   L 
Sbjct: 354 NPLTAVHVAKEVAIVTGE-TLILDKSETVGDGKLLFFNVEETIKIPFDPASDKFDHRELF 412

Query: 898 LVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGD 957
              D    GYAL   LED       +    +  RVSP QK  ++  +K      L+  GD
Sbjct: 413 DKYDIAVTGYALNL-LEDHSQLKDLIRHTWVYARVSPSQKEFILNNLKEMGYQTLMC-GD 470

Query: 958 GANDVSMIQAAHVGVGI 974
           G NDV  ++ AHVGV +
Sbjct: 471 GTNDVGALKQAHVGVAL 487

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 117/489 (23%), Positives = 191/489 (39%), Gaps = 111/489 (22%)

Query: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIA--GRCYIETIPEDRRATVEDGI 602
           +VR    +E LG +  I SDKTGTLT+  M  K V I   G   ++   E    T+ + I
Sbjct: 350 IVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGE-I 408

Query: 603 EIGFHSFESLKDKMTDPEDDEAGIVIEFLT-------------------LLATCHTVIPE 643
            +    F   + K  D ED   GI+ +F +                     AT   +   
Sbjct: 409 HL-IPKFSPYQYKHDDEED--VGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATV 465

Query: 644 TQSDGTIKYQA-ASPDEGALVQGAADLGFRFDIRR----------PNSVSISTPFSEQLE 692
            Q   T  ++A   P E A+   A     R D+ R                ++ F    E
Sbjct: 466 FQDSETQDWKAHGDPTEIAIQVFAT----RMDLPRHVLTGEDKDDEKDARANSSFEHVAE 521

Query: 693 YQLLNICEFNSTRKRMSAIFRM---PDGSI-KLFCKGADTVILERLDSEF-------NPY 741
           +       F+S+ KRMSAI++    P   I ++F KGA   +L+  DS +       +P 
Sbjct: 522 F------PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPL 575

Query: 742 VQSTL----RHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAA 797
            +  L    ++++  ++EGLR L  A ++  E E+                  ++L +  
Sbjct: 576 SKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLKER 621

Query: 798 ELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSE 857
           + +E  L FLG   I D  ++     +    +AG+ V +LTGD   TA +I     +L  
Sbjct: 622 DFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPH 681

Query: 858 DMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQF 917
             NL    +E   +      +  +A+   +I   D+  L LVI                 
Sbjct: 682 --NLYHYPKEVV-NFMVMAATDFDALSDQEI--DDLRVLPLVI----------------- 719

Query: 918 LTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGM 977
                        R +P  K  +++ + R+ S      GDG ND   ++ A+VG+ + G+
Sbjct: 720 ------------ARCAPQTKVRMIEALHRR-SKFCAMTGDGVNDSPSLKIANVGIAM-GI 765

Query: 978 EGMQAARSA 986
            G   A+ A
Sbjct: 766 NGSDVAKDA 774

>Scas_707.48*
          Length = 741

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 109/462 (23%), Positives = 176/462 (38%), Gaps = 123/462 (26%)

Query: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSV----SIAGRCYIETIPEDRRATVED 600
           +VR    VE LG +  I SDKTGTLT N M    +    S+A +  + ++ + +      
Sbjct: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSKSG---- 407

Query: 601 GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEG 660
                     SLK+ +T  ED     V   LT+   C+     +Q  G  KY   +P + 
Sbjct: 408 ----------SLKNYLT--ED-----VKSTLTIGNICNNA-SFSQEHG--KY-LGNPTDI 446

Query: 661 ALVQGAADLGFRFDIR--RPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGS 718
           AL++  +    +FD+   RP              ++ +    FNS RK M+      +G 
Sbjct: 447 ALLEQLS----KFDLSDIRPT-------------FKKVQEIPFNSKRKFMAVKIVNSEGK 489

Query: 719 IKLFCKGADTVILERLDSEFNPYVQS----------TLRHLEDYAAEGLRTLCIASRTIP 768
             L  KGA   +L +     N   ++           +      A+EGLR L  A  T+P
Sbjct: 490 YSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLP 549

Query: 769 EKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQ 828
           +             S T+   TEE          DL F G   + D  +  V   I  L 
Sbjct: 550 D-------------SPTL--LTEES-------VGDLIFTGLIGMNDPPRPTVKPAIEQLL 587

Query: 829 EAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQI 888
           + G+ + ++TGD + TA+NI     +                     L  KL+ +   ++
Sbjct: 588 QGGVHIIMITGDSENTAVNIARQIGI-------------------PVLDPKLSVLSGDKL 628

Query: 889 SQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKT 948
           ++   + LA VID  +                       I  R +P  K  +V+ + RK 
Sbjct: 629 NEMSDDQLANVIDHVN-----------------------IFARATPEHKLNIVRAL-RKR 664

Query: 949 SSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAI 990
             ++   GDG ND   ++ A +GV +  M    A  ++D  +
Sbjct: 665 GDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVL 706

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 157/721 (21%), Positives = 279/721 (38%), Gaps = 157/721 (21%)

Query: 294 RSGEFVR---KKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLK 350
           R G++V     K   + +  I R   + AIP DL+++     +G C +  A L GE+   
Sbjct: 259 RDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLI-----DGSCIVNEAMLSGESTPL 313

Query: 351 IKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGAT 410
           +K++ +          L   + ++Q +  + +   + GT  L  +    +P+     G  
Sbjct: 314 LKESIK----------LRPANDQLQLDGVDKNAVLHGGTKALQVT----APENR--TGVI 357

Query: 411 LRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVI--NMQILALFGVLIVLALISST 468
                    ++  TG ET      +   +   + ERV   N + L     L++ A+++S 
Sbjct: 358 TPPDGGALAVVTKTGFETS---QGSLVRVMIFSAERVDVGNKEALYFILFLLIFAIVAS- 413

Query: 469 GNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYM 528
                         Y++ EGT    +  K IL   ++ +++VP  L + + M     +  
Sbjct: 414 -------------WYVWKEGTRMGRIQSKLILDCILIITSVVPPELPMELTM-AVNSSLA 459

Query: 529 IGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIE 588
             S   +Y  E            +   G+I+    DKTGTLT   + F+ +         
Sbjct: 460 ALSKFYVYCTEPFR---------IPYAGRIDVCCFDKTGTLTAEDLVFEGL--------- 501

Query: 589 TIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDG 648
                  A + DG +I   + +S  D              E L+ +   H ++     DG
Sbjct: 502 -------AGLHDGSDI--RTLKSANDASQ-----------EVLSAIGAAHALV--KLDDG 539

Query: 649 TIKYQAASPDEGALVQGAA-DLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKR 707
            I      P E A ++ ++  + F+  ++R  + +I          ++L   +F+S+ KR
Sbjct: 540 EI---VGDPMEKATLKASSWTVDFKDVVKRAGADNI----------RILRRFQFSSSLKR 586

Query: 708 MSAIFRMPDGSIKLFC--KGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASR 765
            ++I      S + F   KGA   I ERL+S  + Y        + +   G R L +A +
Sbjct: 587 SASI---ASQSNRFFAAVKGAPETIRERLNSVPSDYDDI----YKSFTRSGSRVLALAYK 639

Query: 766 TIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIH 825
            +P+    +   I         DR E        IE  L F         L++   ETI 
Sbjct: 640 DLPKMSNSQIDNI---------DRDE--------IETGLTFGAFLVFHCPLKDDAIETIK 682

Query: 826 HLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIES 885
            L E+  +  ++TGD   TA+++     ++  D   LI++E     +   +   +N    
Sbjct: 683 MLNESSHRSIMITGDNPLTAVHVAKEVGIV--DRETLILDEPIDGSSHALVMRDVN---- 736

Query: 886 HQISQQDMNSLALVIDGKSL---------GYALEEDLEDQFLTIGKLCKAV-----ICCR 931
            +   +  N  A   D K +         G+AL      + L   K  + V     I  R
Sbjct: 737 -ETIVKPFNPDADTFDEKEIFQKYDLAVTGHAL------KLLQGHKQLRDVIRHTWIYAR 789

Query: 932 VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI-----SGMEGMQAARSA 986
           VSP QK  ++  +K      L+  GDG NDV  ++ AHVG+ +       ++ +Q  R  
Sbjct: 790 VSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHVGIALLNGTEDSLKKLQEQRKI 848

Query: 987 D 987
           D
Sbjct: 849 D 849

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 117/546 (21%), Positives = 201/546 (36%), Gaps = 133/546 (24%)

Query: 545  VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEI 604
            +VR    VE LG +  I SDKTGTLT N M    +   G    +       A    G+  
Sbjct: 358  IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLP- 416

Query: 605  GFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAA-SPDEGALV 663
                  +LK+ ++D  D +A + I                   G+I   A+ S + G  +
Sbjct: 417  --GKLPNLKNYLSD--DVKATLRI-------------------GSICNNASFSHEHGKYL 453

Query: 664  QGAADLGF-----RFDI--RRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPD 716
                D+       +FD+   RP +  +                 FNS RK M+     P 
Sbjct: 454  GNPTDIALLEVLQKFDLVDERPTTTRVDE-------------LTFNSKRKYMAVKVDSPA 500

Query: 717  GSIK--LFCKGADTVILER-------------LDSEFNPYVQSTLRHLEDYAAEGLRTLC 761
             S K  ++ KGA   ILER             L       +    + L   A+EGLRTL 
Sbjct: 501  NSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSL---ASEGLRTLA 557

Query: 762  IASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVP 821
             A             ++  + +  M D T +          +L F+G   ++D  +  V 
Sbjct: 558  FA-------------QLECSTNKPMNDSTIQ----------NLTFVGLIGMKDPPRSTVR 594

Query: 822  ETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLN 881
              I  L + G+ V ++TGD + TA+NI       +  + + ++N E            ++
Sbjct: 595  PAIEELLQGGVHVIMITGDAENTAVNI-------ARQIGIPVINPE------------IS 635

Query: 882  AIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVV 941
             +   ++ Q   + LA VID  +                       I  R +P  K  +V
Sbjct: 636  VLTGDRLDQMTDDQLAGVIDHVN-----------------------IFARATPEHKLNIV 672

Query: 942  KMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLI 1001
            + ++++   ++   GDG ND   ++ A +GV +  M    A  ++D  +    F   L  
Sbjct: 673  RALQKR-GDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTA 731

Query: 1002 V-HGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMP 1060
            +  G   +  I   + +    ++A          A AF  Q+ + +  + + N+     P
Sbjct: 732  IEEGKGIFNNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQILWINILMDGPP 788

Query: 1061 PFVIGI 1066
               +G+
Sbjct: 789  AQSLGV 794

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 154/749 (20%), Positives = 283/749 (37%), Gaps = 165/749 (22%)

Query: 305 DIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDE 364
           ++ VGD++++++ + +PAD +++      G C  + + L GE+N   K    +   Y   
Sbjct: 174 NLLVGDLLKLQTGDVVPADCVLV-----RGECETDESALTGESNTIKKLPLADALEY--- 225

Query: 365 KALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATLRN---TAWIFGLI 421
                      S H    +     +     +     PD ML+ G+ + +   +A +  + 
Sbjct: 226 ----------HSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVG 275

Query: 422 VFTGHE---TKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDS 478
           V + H      L  ++  TP++    +   N+ +   +G +  + L      V++  R  
Sbjct: 276 VNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISV---YGCVAAITLF-----VVLFAR-- 325

Query: 479 AHLGYLYIEG--------TNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIG 530
            +L Y+   G          K   F    +T   +    VP  L + V +   +    + 
Sbjct: 326 -YLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMT 384

Query: 531 SDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETI 590
            D +L          VR     E +G    + SDKTGTLT N+M     ++ GR   + I
Sbjct: 385 KDGNL----------VRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTL-GRAGFDDI 433

Query: 591 PEDR---------------RATVEDGIEIGFHSFESLKDKMTDP------EDDEAGIVIE 629
             D                R  + D I +   +FE+ KD   DP      +D +   +I 
Sbjct: 434 GADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFEN-KD-YKDPNNYNSIDDSQPRRLIR 491

Query: 630 FLTLLATCHTVIPETQ-------SDGTIKYQAASPDEGALVQGA-ADLGFRFDIRRPNSV 681
            +T   T     P+ +       ++G  +    S  E AL+  A    G +F      ++
Sbjct: 492 RIT--QTLQKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKF-----GAL 544

Query: 682 SISTPFSEQLEY--QLLNICEFNSTRKRMSAIFRMPDG------SIKLFCKGADTVILER 733
                  E+L     ++ I  F S+RK  + + ++           +L+ KGA  ++ + 
Sbjct: 545 QSFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKA 604

Query: 734 --LDSEFNPYVQSTLRHLED--------YAAEGLRTLCIASRTI-----PEKEYEEWSKI 778
             L +  N  +    +  +D         A + LR + +A         P KE  +    
Sbjct: 605 CTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENS 664

Query: 779 YEAASTTMKD-RTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVL 837
           +EA +  + D +   L+         L       I+D L+E V  ++   Q+AG+ V ++
Sbjct: 665 HEALAVKLIDPKKPHLE--------GLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMV 716

Query: 838 TGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLA 897
           TGD   TA  I  +C +L                                 S + +N  A
Sbjct: 717 TGDNLLTAKAIARNCGIL---------------------------------SSKSLNDSA 743

Query: 898 LVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGD 957
             ++G +  +    D E + +    L K  +  R SP  K ++V+ +K +   ++   GD
Sbjct: 744 CAMEGPA--FRKLSDSERKRI----LPKLRVLARSSPEDKKILVRALK-EMGEVVAVTGD 796

Query: 958 GANDVSMIQAAHVGVGISGMEGMQAARSA 986
           G ND   ++ A VG  + G+ G + AR A
Sbjct: 797 GTNDAPALKLADVGFSM-GITGTEVAREA 824

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 157/697 (22%), Positives = 284/697 (40%), Gaps = 150/697 (21%)

Query: 311 IIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKL 370
           + R   + A+  D+I++     +G C +  A L GE+   +K++ +  ++  +EK     
Sbjct: 280 VTRTDEDSALSCDMILV-----DGTCIVNEAMLSGESTPLLKESVKLRSS--EEKL---- 328

Query: 371 HGRVQSEHPNSSLYTYEGTMTLN-------GSTFPLSPDQMLLRGATLRNTAWIFGLIVF 423
             +V+    NS L+   GT  L         S+ P  PD     G  L        ++  
Sbjct: 329 --QVEGLDKNSVLHG--GTKVLQVTAPEKGSSSIPAPPD-----GGAL-------AVVSK 372

Query: 424 TGHETKLMRNATATPIKRTAVERVI--NMQILALFGVLIVLALISSTGNVIMTKRDSAHL 481
           TG ET          +   + ERV   N + L     L++ A+ +S              
Sbjct: 373 TGFETS---QGALVRVMIYSSERVSVGNKEALYFILFLLIFAIAAS-------------- 415

Query: 482 GYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESD 541
            Y+++EGT    +  K IL   ++ +++VP  L + + M     +  + S   +Y  E  
Sbjct: 416 WYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTM-AVNNSLAVLSKFYVYCTE-- 472

Query: 542 TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVS-IAGRCY-IETIPEDRRATVE 599
            P  +  +      G+I+    DKTGTLT   + F+ ++ +AG+   +  + +     ++
Sbjct: 473 -PFRIPLA------GRIDVCCFDKTGTLTGEDLVFEGLAGLAGKNQPVNHLFKGTEVPLD 525

Query: 600 DGIEIGF-HSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPD 658
             + IG  H+   L D      D+  G  +E  TL AT                      
Sbjct: 526 TNLVIGAAHALVRLDD------DEVVGDPMEKATLAAT---------------------- 557

Query: 659 EGALVQGAADLGFRFDIRRPNSVSISTPFSEQL-EYQLLNICEFNSTRKRMSAIFRMPDG 717
                      G++  ++  +S+S     +E++ +  +L   +F+S  KR S I  + + 
Sbjct: 558 -----------GWKVGVK--DSLS-----NEKVGDISILRRFQFSSALKRSSTI-AVHNK 598

Query: 718 SIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSK 777
                 KGA   I ERL      Y Q      + +   G R L +AS+ +P         
Sbjct: 599 QHYSAVKGAPETIRERLSQVPTDYDQV----YKSFTRAGSRVLALASKKLP--------- 645

Query: 778 IYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVL 837
                S ++K + E+L+R  E +E DL F G       L++   ETI  L E+  +  ++
Sbjct: 646 -----SMSIK-QIEKLER--EAVESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMI 697

Query: 838 TGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRT----NLQSKLNAIESHQISQQDM 893
           TGD   TA+++     ++  +   LI++E     +      N++  +    + +    + 
Sbjct: 698 TGDNPLTAVHVAKEVAIVERET--LILDEPIDGSSHALVFRNIEETIVNPFNPEKDTFEH 755

Query: 894 NSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAV-ICCRVSPLQKALVVKMVKRKTSSLL 952
           + L    D    G+AL+  L      + +L +   +  RVSP QK  ++  +K      L
Sbjct: 756 SKLFAKYDIAVTGHALQ--LLSGHSQLNELIRHTWVYARVSPAQKEFIMNSLKDMGYQTL 813

Query: 953 LAIGDGANDVSMIQAAHVGVGI-----SGMEGMQAAR 984
           +  GDG NDV  ++ AHVG+ +      G++ +Q  R
Sbjct: 814 MC-GDGTNDVGALKQAHVGIALLNGTEEGLKKLQEQR 849

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 178/792 (22%), Positives = 302/792 (38%), Gaps = 176/792 (22%)

Query: 260 VVLIVSAVKESVEDLKRSNADKELNHSLCDVLDE-----RSGEFVRKKWIDIAVGDIIRV 314
           V+  V A+  S+   +  NA K +N SL D+        R+GE V      +  GDI++V
Sbjct: 100 VIAFVVALNVSIGAYQEYNACKTMN-SLKDLSTPSARVIRNGEDVVMASAQVVPGDIVQV 158

Query: 315 RSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALC-KLH-- 371
           R  + +PADL ++ +   E     + A L GE    +  A+   A +  +  +  +L+  
Sbjct: 159 RVGDTVPADLRLVEALNLE----TDEALLTGEA---LPVAKDPAAVFEQDTPVGDRLNLA 211

Query: 372 --------GRVQSEHPNSSLYTYEGTM--TLNGSTFPLSPDQMLLRGATLRNTAWIFGLI 421
                   GR       + L +  G +  +L G    +S D+     + L+NT     ++
Sbjct: 212 FASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDE---NKSGLQNT-----VL 263

Query: 422 VFTGHETKLMRNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHL 481
                    +     TP+ R   +       L LF + ++ ALI       +  R+ A  
Sbjct: 264 TVKASVGSFLGTNVGTPLHRKLAKLA-----LILFAIAVLFALIVMATQKFIVNREVA-- 316

Query: 482 GYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESD 541
                            I    +  S ++P SL V + +     A ++          S 
Sbjct: 317 -----------------IYAICVALS-MIPSSLVVVLTITMSAGAKVM----------ST 348

Query: 542 TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIA--GRCYIE--TIPEDRRAT 597
              +VR    +E LG +  I SDKTGTLT+  M  K + +   G   +    +P D   T
Sbjct: 349 RNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFD--PT 406

Query: 598 VEDGIEIG-FHSFESLKDKMTDPEDDEAGIVIEF-----------------------LTL 633
           V D   I  F  +E   D     E+++ GI+  F                          
Sbjct: 407 VGDVSLIPRFSPWEYQHD-----EEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTAT 461

Query: 634 LATCHTVIPETQSDGTIKYQA-ASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLE 692
           LA   TV  ++ S    +++A   P E A+   A  +               +  S+Q +
Sbjct: 462 LANIATVFKDSDSK---EWRAHGDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQND 518

Query: 693 YQLL--NICEF--NSTRKRMSAIF-RMPDGSIK-LFCKGADTVILE-----RLD---SEF 738
              +  +  EF  +S+ KRMSA++  + D + + +F KGA   +L+     +LD      
Sbjct: 519 AARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVT 578

Query: 739 NPYVQSTL----RHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELD 794
           +P  +  L    ++++  + EGLR L  A++TIP +E E                 E L 
Sbjct: 579 HPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLG--------------ERLT 624

Query: 795 RAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRL 854
           +  + +E DL F G   I D  +      +     AG+ V +LTGD   TA  I     +
Sbjct: 625 KDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGI 684

Query: 855 LSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLE 914
           L    NL    +E   D      ++ +++   ++ Q  +  L LVI              
Sbjct: 685 LPH--NLYHYPKEVV-DIMVMTATQFDSLTDEELDQ--LPVLPLVI-------------- 725

Query: 915 DQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 974
                           R +P  K  ++  + R+     +  GDG ND   ++ A+VG+ +
Sbjct: 726 ---------------ARCAPQTKVRMIDALHRREKFCAMT-GDGVNDSPSLKKANVGIAM 769

Query: 975 SGMEGMQAARSA 986
            G+ G   A+ A
Sbjct: 770 -GINGSDVAKDA 780

>Kwal_56.23467
          Length = 280

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 96/215 (44%), Gaps = 24/215 (11%)

Query: 1092 FSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLG 1151
            +++T FW ++++G Y S + F    L Y     ++  G   DH  W VGI   SI  V  
Sbjct: 5    WNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSC 63

Query: 1152 KAALITSQ--WTKFTLVAIPGS-LVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATF 1208
               ++  Q  W  F+ + I  S LV++      ++ ++     S E+Y    HVYGS  +
Sbjct: 64   NLYILIHQFRWDWFSTLFIALSCLVVYG-----WTGIWSTFTTSGEFYKSAAHVYGSPIY 118

Query: 1209 WLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEM----------QKYNISDYRPRMEQ 1258
            W +  V  +F LL  F +  +++ + P+   +++E           + Y+ +D  P   Q
Sbjct: 119  WAIFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTD--PNRPQ 176

Query: 1259 FQKAIRKV--RQVQRMKKQRGFAFSQSEEGGQDRI 1291
              KA  K+  R V+        A + +  G +D +
Sbjct: 177  IAKADTKLHPRYVEE-GSDYAHAITTANHGSRDTV 210

>Kwal_14.1498
          Length = 939

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 115/508 (22%), Positives = 189/508 (37%), Gaps = 136/508 (26%)

Query: 545  VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEI 604
            ++R    VE LG +  I SDKTGTLT N M    V   G            +   + +++
Sbjct: 347  IIRRLPSVETLGSVNVICSDKTGTLTANHMSVNKVWCLGSM----------SNKSNILKL 396

Query: 605  GFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQ 664
               +  S K  +T+          +    L T +     T S    KY   +P + AL++
Sbjct: 397  DKATSGSFKKNLTE----------DLRATLRTGNLCNNSTYSHEHAKY-LGNPTDIALLE 445

Query: 665  GAADLGF---RFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKL 721
                 G    R  + R + +S                  FNS RK M+   +  +G   +
Sbjct: 446  VLHKFGLEDERPQVTRSDEIS------------------FNSKRKFMAVKVKEANGKFVV 487

Query: 722  FCKGADTVILER----LDSEFNPYVQ--STLRHL-----EDYAAEGLRTLCIASRTIPEK 770
              KGA   ILE+    +++E N  V+  S LR       +  A++GLRTL  A       
Sbjct: 488  HVKGAYEKILEKSTHFINAE-NKVVKLDSNLRQAITDSADALASDGLRTLAFAQ------ 540

Query: 771  EYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEA 830
                     E ++   K  TE+         + L F G   + D  +  V   +  L E 
Sbjct: 541  --------LELSNGNSKKLTED-------DINGLTFAGLLGMNDPPRPSVKAAVERLSEG 585

Query: 831  GLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQ 890
             + + ++TGD + TA++I       +  + + +VN ET   T                  
Sbjct: 586  SVHIIMITGDAENTAVSI-------ARQIGIPVVNPETAVLT------------------ 620

Query: 891  QDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSS 950
                           G  L+   EDQ  +I  +    I  R +P  K  +V+ ++++   
Sbjct: 621  ---------------GDKLDHMSEDQLASI--IDHVNIFARATPEHKLNIVRALQKR-GD 662

Query: 951  LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA--------DFAI---------GQF 993
            ++   GDG ND   ++ A +GV +  M G   A+ A        DF+          G F
Sbjct: 663  IVAMTGDGVNDAPALKLADIGVSMGKM-GTDVAKEASDMVLTDDDFSTILTAIEEGKGIF 721

Query: 994  RFLRKLLIVHGSWSYQRISLAILYSFYK 1021
              ++  L    S S   +SL  + + +K
Sbjct: 722  NNIQNFLTFQLSTSVAALSLVAIATAFK 749

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 121/307 (39%), Gaps = 73/307 (23%)

Query: 701 FNSTRKRMSAIFRMPDGSIK-----LFCKGADTVI-------------LERLDSEFNPYV 742
           F S+RK    + +  +G  K      F KGA  ++             LE ++ +     
Sbjct: 615 FESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKET 674

Query: 743 QSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELI-- 800
              +++L   A++ LR + +A +   E   + W          ++D+      A +L+  
Sbjct: 675 DDEIKNL---ASDALRAISVAHKDFCE--CDSW------PPEQLRDKDSPNIAALDLLFN 723

Query: 801 -EHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDM 859
            +  L   G   I+D L+ GV E++   Q AG+ V ++TGD   TA  I  +C +LS D+
Sbjct: 724 SQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDI 783

Query: 860 NLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLT 919
           +             +   S +   E  ++++ +                           
Sbjct: 784 S-------------SEAYSAMEGTEFRKLTKNE--------------------------R 804

Query: 920 IGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEG 979
           I  L    +  R SP  K L+V+ +K     ++   GDG ND   ++ A VG  + G+ G
Sbjct: 805 IRILPNLRVLARSSPEDKRLLVETLK-GMGDVVAVTGDGTNDAPALKLADVGFSM-GISG 862

Query: 980 MQAARSA 986
            + AR A
Sbjct: 863 TEVAREA 869

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 66/323 (20%), Positives = 131/323 (40%), Gaps = 37/323 (11%)

Query: 258 LLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSE 317
           + VV++VSA  +  ++L+ +  +K+  +    V+  R+ + +      + VGD+I +++ 
Sbjct: 164 VFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI--RNDQEILISIHHVLVGDVISLQTG 221

Query: 318 EAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSE 377
           + +PAD +++S     G C  + +++ GE+N   K        +  + +L         +
Sbjct: 222 DVVPADCVMIS-----GKCEADESSITGESNTIQK--------FPVDNSLRDFKKFNSID 268

Query: 378 HPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATL-----RNTAWIFGLIVFTGHE-TKLM 431
             N S     G +  +G+      D ML+ G+ +     R      G+    G   T L 
Sbjct: 269 SHNHSKPLDIGDVNEDGNKI---ADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLN 325

Query: 432 RNATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNK 491
               +TP++    +   N+ +      +I+  ++ +     +   D     +  ++   K
Sbjct: 326 AEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGR---FHDLDPAQK 382

Query: 492 AGLFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSL 551
              F    +T   +    VP  L + V +   +    +  D +L          VR    
Sbjct: 383 GSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNL----------VRVLRS 432

Query: 552 VEELGQIEYIFSDKTGTLTRNVM 574
            E +G    + SDKTGTLT NVM
Sbjct: 433 CETMGSATAVCSDKTGTLTENVM 455

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 114/506 (22%), Positives = 188/506 (37%), Gaps = 137/506 (27%)

Query: 545  VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEI 604
            +VR    VE LG +  I +DKTGTLT N M    +     C       D   T E+ I  
Sbjct: 359  IVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKL----FCL------DSSGTYENAI-- 406

Query: 605  GFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQ 664
                    +D   D  D++   V E LT+   C+      + +  I     +P + AL++
Sbjct: 407  -----SPEEDSEFDVHDND---VKETLTIANICNNAKYSEEHNLYI----GNPTDVALIE 454

Query: 665  GAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCK 724
                 G       P+         ++  ++ +    FNS RK M+       G   L+ K
Sbjct: 455  VLTKFGI------PD---------QRDSHEKMEELSFNSKRKYMAIKSSKESGEHVLYIK 499

Query: 725  GADTVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSK--IYEAA 782
            GA     ER+  + + Y+        D A E              +E++E SK  + EAA
Sbjct: 500  GA----FERILDKSSYYL--------DKAGE-------------VREFDEHSKVMVLEAA 534

Query: 783  STTMKDRTEELDRAAELIEHD----------LFFLGATAIEDKLQEGVPETIHHLQEAGL 832
             +   D    +  A +  + D          L F G   + D  +  V  +I  L   G+
Sbjct: 535  HSCASDGLRTIACAFKPTDSDNVISEDDINGLTFTGLFGLADPPRPNVKASIEKLHRGGV 594

Query: 833  KVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQD 892
             + ++TGD   TA++I       +E + L + + E+            + +   ++S+  
Sbjct: 595  HIIMITGDSVNTAVSI-------AEKIGLSVQDRES------------SVMTGDKVSELT 635

Query: 893  MNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLL 952
             + L+ VID                       K  I  R +P  K  +VK + RK   ++
Sbjct: 636  EDELSKVID-----------------------KVNIFARATPENKLNIVKAL-RKRGDIV 671

Query: 953  LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA--------DFAI---------GQFRF 995
               GDG ND   ++ A +G+ + G+ G   A+          DF+          G F  
Sbjct: 672  AMTGDGVNDAPALKLADIGIAM-GISGTDVAKEVSDMILTDDDFSSILTAIEEGKGIFNN 730

Query: 996  LRKLLIVHGSWSYQRISLAILYSFYK 1021
            +R  L    S S   +SL  + +  K
Sbjct: 731  IRNFLTFQLSISVATLSLIAITTIAK 756

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 103/460 (22%), Positives = 174/460 (37%), Gaps = 119/460 (25%)

Query: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEI 604
           +VR    VE LG +  I SDKTGTLT N M    +   G    +T               
Sbjct: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKT--------------- 391

Query: 605 GFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQ 664
              +   +K++    E D A       T L   +     T S   +KY   +P + A+++
Sbjct: 392 NCLALSKVKERPIKMEQDVA-------TTLRIGNICNNGTYSQEHLKY-LGNPTDIAILE 443

Query: 665 GAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCK 724
                G   D R  NSV+             +N   FNS RK M+      +  + ++ K
Sbjct: 444 SLQHFGIN-DCR--NSVN------------KINEIPFNSKRKFMAVKTIDANDKVVVYVK 488

Query: 725 GADTVILER------LDSEFNPYVQSTLRHLED----YAAEGLRTLCIA----SRTIPEK 770
           GA   I+E+       D + +    +    + D     A+EGLRTL  A    S T  +K
Sbjct: 489 GAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDK 548

Query: 771 EYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEA 830
           E+ E                       +++E  L F G  A+ D  +  V   I  L + 
Sbjct: 549 EFNE-----------------------DMVE-GLTFTGLIAMNDPPRPTVRSAIEELLQG 584

Query: 831 GLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQ 890
            + V ++TGD + TA++I       +  + + ++N E             + +   ++ Q
Sbjct: 585 SVHVIMITGDAENTAVSI-------ARQIGIPVINPE------------YSVLSGDKLDQ 625

Query: 891 QDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSS 950
              + LA VID  +                       +  R +P  K  +V+ ++++   
Sbjct: 626 MTDDQLASVIDHVN-----------------------VFARATPEHKLNIVRALQKR-GD 661

Query: 951 LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAI 990
           ++   GDG ND   ++ A +GV +  M    A  ++D  +
Sbjct: 662 IVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVL 701

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 294 RSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGE 346
           RSG+       ++  GD++R +  + IPADL I+ S +   LC ++ +NL GE
Sbjct: 152 RSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESID---LC-VDESNLTGE 200

>Kwal_47.17522
          Length = 899

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 114/297 (38%), Gaps = 79/297 (26%)

Query: 692 EYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLED 751
           +Y++L+   F+   K+++A+   P+G   +  KGA   +L+ ++              ED
Sbjct: 423 KYKVLDFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVE--------------ED 468

Query: 752 YAAEGLRTLCIASRTIPEKEYEEW-SKIYEAASTTMKDRTEELDRAAELIEHDLFFLGAT 810
           +              IPE  +E + +K+ E AS   +     L  A +  E     LG  
Sbjct: 469 HP-------------IPEDVHENYENKVAELASRGFR----ALGVARKRGEGHWEILGVM 511

Query: 811 AIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM-SCRLLSEDMNLLIVNEETK 869
              D  ++   +T+H  +  GL+V +LTGD    A+ I   +CR L    N+        
Sbjct: 512 PCMDPPRDDTAQTVHEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTNI-------- 559

Query: 870 EDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVIC 929
                      NA         DM        G  L   +E    D F            
Sbjct: 560 ----------YNAERLGLGGGGDM-------PGSELADFVEN--ADGF------------ 588

Query: 930 CRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
             V P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 589 AEVFPQHKYSVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 544 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 572
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 111/300 (37%), Gaps = 85/300 (28%)

Query: 692 EYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLED 751
           +Y+LL    F+   K+++AI   P+G   +  KGA   +L+ ++ E +P  +    + E+
Sbjct: 423 KYKLLEFHPFDPVSKKVTAIVESPEGERIICVKGAPLFVLKTVEEE-HPIPEDVRENYEN 481

Query: 752 YAAE----GLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFL 807
             AE    G R L +A R   E  +E                                 L
Sbjct: 482 KVAELASRGFRALGVA-RKRGEGHWE--------------------------------IL 508

Query: 808 GATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM-SCRLLSEDMNLLIVNE 866
           G     D  ++   +T++  +  GL+V +LTGD    A+ I   +CR L    N+     
Sbjct: 509 GVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNI----- 559

Query: 867 ETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKA 926
                         NA         DM        G  L   +E    D F         
Sbjct: 560 -------------YNAERLGLGGGGDM-------PGSELADFVEN--ADGF--------- 588

Query: 927 VICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
                V P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 589 ---AEVFPQHKYNVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 544 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 572
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 112/297 (37%), Gaps = 79/297 (26%)

Query: 692 EYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLED 751
           +Y++L    F+   K+++A+   P+G   +  KGA   +L+ ++              ED
Sbjct: 471 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVE--------------ED 516

Query: 752 YAAEGLRTLCIASRTIPEKEYEEW-SKIYEAASTTMKDRTEELDRAAELIEHDLFFLGAT 810
           +              IPE  +E + +K+ E AS   +     L  A +  E     LG  
Sbjct: 517 HP-------------IPEDVHENYENKVAELASRGFR----ALGVARKRGEGHWEILGVM 559

Query: 811 AIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM-SCRLLSEDMNLLIVNEETK 869
              D  ++   +TI+  +  GL++ +LTGD    A+ I   +CR L    N+        
Sbjct: 560 PCMDPPRDDTAQTINEARNLGLRIKMLTGD----AVGIAKETCRQLGLGTNI-------- 607

Query: 870 EDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVIC 929
                      NA         DM        G  L   +E    D F            
Sbjct: 608 ----------YNAERLGLGGGGDM-------PGSELADFVEN--ADGF------------ 636

Query: 930 CRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
             V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 637 AEVFPQHKYRVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 690

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRN 572
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 388 IVQKLSAIESLAGVEILCSDKTGTLTKN 415

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 111/297 (37%), Gaps = 79/297 (26%)

Query: 692 EYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLED 751
           +Y++L    F+   K+++A+   P+G   +  KGA   +L+ ++              ED
Sbjct: 442 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVE--------------ED 487

Query: 752 YAAEGLRTLCIASRTIPEKEYEEW-SKIYEAASTTMKDRTEELDRAAELIEHDLFFLGAT 810
           +              IPE  +E + +K+ E AS   +     L  A +  E     LG  
Sbjct: 488 HP-------------IPEDVHENYENKVAELASRGFR----ALGVARKRGEGHWEILGVM 530

Query: 811 AIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM-SCRLLSEDMNLLIVNEETK 869
              D  ++   +T+   +  GL+V +LTGD    A+ I   +CR L    N+        
Sbjct: 531 PCMDPPRDDTAQTVSEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNI-------- 578

Query: 870 EDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVIC 929
                      NA         DM        G  L   +E    D F            
Sbjct: 579 ----------YNAERLGLGGGGDM-------PGSELADFVEN--ADGF------------ 607

Query: 930 CRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
             V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 608 AEVFPQHKYRVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 661

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRN 572
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 359 IVQKLSAIESLAGVEILCSDKTGTLTKN 386

>Scas_688.1
          Length = 913

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 113/299 (37%), Gaps = 83/299 (27%)

Query: 692 EYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLED 751
           +Y++L    F+   K+++A+   P+G   +  KGA   +L+ ++              ED
Sbjct: 437 KYKVLEFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVE--------------ED 482

Query: 752 YAAEGLRTLCIASRTIPEKEYEEW-SKIYEAASTTMKDRTEELDRAAELIEHDLFFLGAT 810
           +              IPE  +E + +K+ E AS   +     L  A +  E     LG  
Sbjct: 483 HP-------------IPEDIHENYENKVAELASRGFR----ALGVARKRGEGHWEILGVM 525

Query: 811 AIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM-SCRLLSEDMNLLIVNEETK 869
              D  ++   ET+   +  GL+V +LTGD    A+ I   +CR L    N  + N E  
Sbjct: 526 PCMDPPRDDTGETVAEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTN--VYNAE-- 577

Query: 870 EDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLE--DQFLTIGKLCKAV 927
                                     L L   G   G  L + +E  D F          
Sbjct: 578 -------------------------RLGLSGGGDMPGSELADFVENADGF---------- 602

Query: 928 ICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
               V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 603 --AEVFPQDKYRVVEILQTR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 656

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 544 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 572
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 353 AIVQKLSAIESLAGVEILCSDKTGTLTKN 381

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 111/297 (37%), Gaps = 79/297 (26%)

Query: 692 EYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLED 751
           +Y++L    F+   K+++AI   P+G   +  KGA   +L+ ++            HL  
Sbjct: 423 KYKVLEFHPFDPVSKKVTAIVESPEGERIVCVKGAPLFVLKTVEE----------NHL-- 470

Query: 752 YAAEGLRTLCIASRTIPEKEYEEW-SKIYEAASTTMKDRTEELDRAAELIEHDLFFLGAT 810
                          IPE   E + +K+ E AS   +     L  A +  E     LG  
Sbjct: 471 ---------------IPEDVKENYENKVAELASRGYR----ALGVARKRGEGHWEILGVM 511

Query: 811 AIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM-SCRLLSEDMNLLIVNEETK 869
              D  ++   +T++  +  GL+V +LTGD    A+ I   +CR L    N+        
Sbjct: 512 PCMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTNI-------- 559

Query: 870 EDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVIC 929
                      NA         DM        G  L   +E    D F            
Sbjct: 560 ----------YNAERLGLGGGGDM-------PGSELADFVEN--ADGF------------ 588

Query: 930 CRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
             V P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 589 AEVFPQHKYNVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 544 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 572
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 107/287 (37%), Gaps = 77/287 (26%)

Query: 692 EYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLED 751
           +Y+++    F+   K+++A+   P+G   +  KGA   +L+ ++              ED
Sbjct: 426 KYKVIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVE--------------ED 471

Query: 752 YAAEGLRTLCIASRTIPEKEYEEW-SKIYEAASTTMKDRTEELDRAAELIEHDLFFLGAT 810
           +              IPE  +E + +K+ E AS   +     L  A +  E     LG  
Sbjct: 472 HP-------------IPEDVHENYENKVAELASRGFR----ALGVARKRGEGHWEILGVM 514

Query: 811 AIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM-SCRLLSEDMNLLIVNEETK 869
              D  ++   ET++  +  GL+V +LTGD    A+ I   +CR L    N+        
Sbjct: 515 PCMDPPRDDTAETVNEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTNI-------- 562

Query: 870 EDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVIC 929
                      NA         DM        G  L   +E    D F            
Sbjct: 563 ----------YNAERLGLGGGGDM-------PGSELADFVEN--ADGF------------ 591

Query: 930 CRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISG 976
             V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G
Sbjct: 592 AEVFPQHKYKVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG 637

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 544 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 572
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 342 AIVQKLSAIESLAGVEILCSDKTGTLTKN 370

>Scas_710.41
          Length = 904

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 109/303 (35%), Gaps = 91/303 (30%)

Query: 692 EYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLED 751
           +Y++L    F+   K+++A+ + P+G      KGA   +L+ ++ E +P  +    + E+
Sbjct: 429 KYKILEFHPFDPVSKKVTAVVKSPEGETITCVKGAPLFVLKTVE-EDHPVPEDVHENYEN 487

Query: 752 YAAE----GLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFL 807
             AE    G R+L +A R   E  +E                                 L
Sbjct: 488 KVAELASRGFRSLGVA-RKRGEGYWE--------------------------------IL 514

Query: 808 GATAIEDKLQEGVPETIHHLQEAGLKVWVLTGD----RQETAINIGMSCRLLSEDMNLLI 863
           G     D  ++    TI   +  GL+V +LTGD     +ET+  +G+   +         
Sbjct: 515 GVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNI--------- 565

Query: 864 VNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKL 923
                            NA +       DM        G  L   +E    D F      
Sbjct: 566 ----------------YNAEKLGLGGGGDM-------PGSELADFVEN--ADGF------ 594

Query: 924 CKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 983
                   V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AA
Sbjct: 595 ------AEVFPQHKYKVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAA 645

Query: 984 RSA 986
           RSA
Sbjct: 646 RSA 648

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRN 572
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 346 IVQKLSAIESLAGVEILCSDKTGTLTKN 373

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 89/216 (41%), Gaps = 41/216 (18%)

Query: 861  LLIVNEETKEDTRTNLQS-KLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLT 919
            L  +N+E K D+   +Q  + N  E++ I+  D NS A  +  + +G + E    D    
Sbjct: 758  LFEINDEVKHDSYATVQYLQRNGYETYMITG-DNNSAAKRV-AREVGISFENVYSD---- 811

Query: 920  IGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAI-GDGANDVSMIQAAHVGVGIS-GM 977
                        VSP  K  +VK ++ K  +  +A+ GDG ND   +  + +G+ IS G 
Sbjct: 812  ------------VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGT 859

Query: 978  EGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANA 1037
            E   A  +AD  I     L        + S + ++ AI  S      + +  FW +  N 
Sbjct: 860  E--IAIEAADIVILCGNDLN-------TNSLRGLANAIDISLKTFKRIKLNLFWALCYNI 910

Query: 1038 FS---GQSIMESWTLTFYNVFFTVMPPFVIGIFDQF 1070
            F       ++  W +T        +PP + G+   F
Sbjct: 911  FMIPIAMGVLIPWGIT--------LPPMLAGLAMAF 938

>Scas_297.1
          Length = 800

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 928 ICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
           +  R SP  K L+V+ +K     ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 51  VMARSSPEDKRLLVETLK-GMGDVVAVTGDGTNDAPALKLADVGFSM-GISGTEVAREA 107

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 18/107 (16%)

Query: 305 DIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDE 364
           ++ VGDII +++ + IPAD +++     EG C ++ +++ GE++  IK+ +   A     
Sbjct: 615 NLLVGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESD-TIKKVKVFNA----- 663

Query: 365 KALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPLSPDQMLLRGATL 411
               K    +     N  +    G  T NG      PD ML+ G+ L
Sbjct: 664 ---LKTFDVINEGKSNDQILDI-GFKTPNGDKI---PDCMLISGSKL 703

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 762 IASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVP 821
           I + TI  K+      + + AS+T+ +    +D +          +G   I D+++E   
Sbjct: 706 IHTITIGNKKLFPDESLSDIASSTLTESYVSIDGS---------LVGKFEISDRVKEDAH 756

Query: 822 ETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQS 878
             + +LQ  G+K  ++TGD  ++A+ +     + + D+    V  E K D    LQ+
Sbjct: 757 FVVEYLQNLGIKCCMVTGDAHQSALKVAQQLGISANDV-FSEVTPEQKRDIVIQLQN 812

>Scas_569.0d
          Length = 468

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 927 VICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986
           ++  R SP  K  +++ + R+        GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 103 LVIARCSPQTKVRMIEALHRR-DKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDVAKDA 160

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 6/72 (8%)

Query: 283 LNHSLCDVLDERSGEFVRKKWIDI-AVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETA 341
           L  S C ++D+      ++  I++  VGDI  V+    IP+D I+      +G+  ++ +
Sbjct: 408 LTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIV-----TKGISEVDES 462

Query: 342 NLDGETNLKIKQ 353
            + GETNL +K+
Sbjct: 463 LMTGETNLVVKE 474

>Kwal_26.8333
          Length = 422

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 34/85 (40%)

Query: 1025 LYMTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYK 1084
            +Y T   + F N  SG S+   +      +  +V  P  +G   Q V  + +      +K
Sbjct: 169  MYTTSSAFHFGNPASGSSVSHLYANVMKQIGLSVFVPLFVGQILQNVFPKQVSWCLSTFK 228

Query: 1085 LGQKGQFFSVTIFWGWVLNGFYHSA 1109
            LG+ G F  + I W      FY  A
Sbjct: 229  LGKVGSFCLILIMWSSFSTAFYQKA 253

>Scas_665.1
          Length = 392

 Score = 31.6 bits (70), Expect = 4.6,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 11/84 (13%)

Query: 738 FNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAA 797
            NP++Q TL+ + D   E  + +          E EE+ KI E     + + +  LD+  
Sbjct: 81  LNPFIQQTLQLIIDTINEKKKKV---------SENEEFKKILETQKAELLEYS--LDKEN 129

Query: 798 ELIEHDLFFLGATAIEDKLQEGVP 821
           + +   +F   ATAI D   +G+P
Sbjct: 130 DRLFDGIFKNSATAIVDDSDDGIP 153

>YBL088C (TEL1) [113] chr2 complement(51016..59379)
            Phosphatidylinositol 3-kinase (PI kinase) homolog
            involved in control of telomere length and protection of
            telomeres from homologous recombination, involved with
            Mec1p in maintenance of genome stability and DNA damage
            checkpoint control [8364 bp, 2787 aa]
          Length = 2787

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 46/109 (42%), Gaps = 16/109 (14%)

Query: 279  ADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYI 338
            A+K L  SL  + D R     + +W+D  +  II      AIP D+    +S P+ L  I
Sbjct: 1895 AEKSLEKSLLTIFDSRQHFISQTEWMD-TLNAIIEFIKIAAIPQDV----TSFPQTLMSI 1949

Query: 339  ETAN---------LDGETNLKIKQARQE--TANYLDEKALCKLHGRVQS 376
              A+          D +T LK +       + N LDE   C  + R+ S
Sbjct: 1950 MKADKERLNTIDFYDHKTTLKSRHTLMNVLSRNSLDENVKCSKYLRLGS 1998

>KLLA0B04455g 396805..397698 no similarity, hypothetical start
          Length = 297

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 822 ETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLN 881
           E  H+  E  +K W +  D  E   N+    + L +D+ +     ++ ED  T LQSK N
Sbjct: 27  EITHYENEQSVKEWAI-KDLNEKLNNLNEQIQTLRQDLRIETERCQSLEDANTELQSKYN 85

Query: 882 AIESHQISQQDM 893
             E+   S+Q+M
Sbjct: 86  KSEA---SRQEM 94

>Scas_630.14
          Length = 701

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%)

Query: 515 FVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNV 573
           +V V+++++Y   M  S+ D   E +   T+V TS ++     I YI+ DK   +  N+
Sbjct: 282 YVQVQLLRWYSLTMYPSNTDTLEEITIVNTLVSTSLMLGLHQDINYIYMDKLPNIIPNL 340

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 42,683,172
Number of extensions: 1895394
Number of successful extensions: 6008
Number of sequences better than 10.0: 97
Number of HSP's gapped: 5920
Number of HSP's successfully gapped: 190
Length of query: 1322
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1208
Effective length of database: 12,649,657
Effective search space: 15280785656
Effective search space used: 15280785656
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)