Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03993g1031024459e-59
KLLA0F23199g94032611.3
Kwal_27.1228820130591.8
ADR221C61456574.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03993g
         (102 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03993g complement(354306..354617) similar to sp|Q05393 Sac...   176   9e-59
KLLA0F23199g complement(2159245..2162067) some similarities with...    28   1.3  
Kwal_27.12288                                                          27   1.8  
ADR221C [1962] [Homologous to ScYKR084C (HBS1) - SH; ScYOR076C (...    27   4.2  

>KLLA0A03993g complement(354306..354617) similar to sp|Q05393
           Saccharomyces cerevisiae Orf 06157 protein, start by
           similarity
          Length = 103

 Score =  176 bits (445), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 89/102 (87%)

Query: 1   MDKAVILAMTSGLDSKITNNTPTGAVIWYKVKFSSISLAKFTFPTGSCKLATSTIPCSIV 60
           MDKAVILAMTSGLDSKITNNTPTGAVIWYKVKFSSISLAKFTFPTGSCKLATSTIPCSIV
Sbjct: 1   MDKAVILAMTSGLDSKITNNTPTGAVIWYKVKFSSISLAKFTFPTGSCKLATSTIPCSIV 60

Query: 61  SNLSPLNKSNLFTRESERLVXXXXXXXXXXXXXIDAAFAFKP 102
           SNLSPLNKSNLFTRESERLV             IDAAFAFKP
Sbjct: 61  SNLSPLNKSNLFTRESERLVLLACSKSSLLAASIDAAFAFKP 102

>KLLA0F23199g complement(2159245..2162067) some similarities with
           sp|P43596 Saccharomyces cerevisiae YFR013w IOC3,
           hypothetical start
          Length = 940

 Score = 28.1 bits (61), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 10  TSGLDSKITNNTPTGAVIWYKVKFSSISLAKF 41
           T GL   + N T TG V WY++  +S SL  F
Sbjct: 683 TPGLVHDLMNGTNTGKVYWYEMCHNSSSLQDF 714

>Kwal_27.12288
          Length = 201

 Score = 27.3 bits (59), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 14  DSKITNNTPTGAVIWYKVKFSSISLAKFTF 43
           DS  +  TP GA++WY++   ++ +A  +F
Sbjct: 149 DSTTSTKTPYGALVWYRLLRRALEIAGPSF 178

>ADR221C [1962] [Homologous to ScYKR084C (HBS1) - SH; ScYOR076C
           (SKI7) - SH] (1090209..1091800,1092378..1092630) [1845
           bp, 614 aa]
          Length = 614

 Score = 26.6 bits (57), Expect = 4.2,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 5   VILAMTSGLDSKITNNTPTGAVIWYKVKFSSISLAKFTF--PTGSCKLATSTIPCS 58
           +ILA + G+   I        V W++ +F +I L   +F    G  +  TS +PCS
Sbjct: 307 IILARSLGVKHIILAMNKMDTVEWHEGRFKAIRLELLSFLEDIGFKEPQTSWVPCS 362

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.129    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,608,472
Number of extensions: 84795
Number of successful extensions: 209
Number of sequences better than 10.0: 8
Number of HSP's gapped: 209
Number of HSP's successfully gapped: 8
Length of query: 102
Length of database: 16,596,109
Length adjustment: 73
Effective length of query: 29
Effective length of database: 14,068,995
Effective search space: 408000855
Effective search space used: 408000855
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)