Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03982g44744023190.0
Sklu_2164.250844818410.0
Scas_663.345744918080.0
YOR323C (PRO2)45644917930.0
Kwal_26.706745744817560.0
CAGL0F00693g45544916830.0
ADR351C45244416110.0
Kwal_47.1660779744750.35
CAGL0K03509g527270720.87
Sklu_2186.282269701.7
AAR089C161886682.5
Sklu_2412.499645682.9
KLLA0E07898g895117673.1
Scas_717.74522141664.7
ABL204W47973655.5
ADR322W50877647.9
YDR470C (UGO1)502109638.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03982g
         (440 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03982g 354208..355551 highly similar to sp|P54885 Saccharo...   897   0.0  
Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement         713   0.0  
Scas_663.3                                                            701   0.0  
YOR323C (PRO2) [5105] chr15 complement(921530..922900) Gamma-glu...   695   0.0  
Kwal_26.7067                                                          681   0.0  
CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomy...   652   0.0  
ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH] (1324789..1...   625   0.0  
Kwal_47.16607                                                          33   0.35 
CAGL0K03509g complement(326043..327626) similar to sp|Q04458 Sac...    32   0.87 
Sklu_2186.2 YHR028C, Contig c2186 1993-4461 reverse complement         32   1.7  
AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505...    31   2.5  
Sklu_2412.4 YMR124W, Contig c2412 7729-10719                           31   2.9  
KLLA0E07898g 712370..715057 similar to sp|P40462 Saccharomyces c...    30   3.1  
Scas_717.74                                                            30   4.7  
ABL204W [388] [Homologous to ScYNL239W (LAP3) - SH] complement(2...    30   5.5  
ADR322W [2063] [Homologous to ScYKR042W (UTH1) - SH; ScYJL116C (...    29   7.9  
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    29   8.8  

>KLLA0A03982g 354208..355551 highly similar to sp|P54885
           Saccharomyces cerevisiae YOR323c PRO2 gamma-glutamyl
           phosphate reductase singleton, start by similarity
          Length = 447

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/440 (100%), Positives = 440/440 (100%)

Query: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60
           MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL
Sbjct: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60

Query: 61  SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV 120
           SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV
Sbjct: 61  SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV 120

Query: 121 IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV 180
           IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV
Sbjct: 121 IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV 180

Query: 181 QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI 240
           QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI
Sbjct: 181 QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI 240

Query: 241 GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENGVTLHVSKEVKKQYKEH 300
           GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENGVTLHVSKEVKKQYKEH
Sbjct: 241 GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENGVTLHVSKEVKKQYKEH 300

Query: 301 NSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIVTENSENAE 360
           NSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIVTENSENAE
Sbjct: 301 NSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIVTENSENAE 360

Query: 361 YFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQLRGNG 420
           YFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQLRGNG
Sbjct: 361 YFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQLRGNG 420

Query: 421 QIASDYLGAGGKKAFVHKDL 440
           QIASDYLGAGGKKAFVHKDL
Sbjct: 421 QIASDYLGAGGKKAFVHKDL 440

>Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement
          Length = 508

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/448 (77%), Positives = 389/448 (86%), Gaps = 9/448 (2%)

Query: 2   SVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNLS 61
           S +E IA+ AR AGNILKTLSDE+RS ILY IHDGLKANA SIE ANK+DL+ AK TNLS
Sbjct: 54  STAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLS 113

Query: 62  DSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLVI 121
           DSL+KRLDLFKGDKFETMLQGI DVA L+DPVGK+  ARE+DENLTLYQ+TAPVGVLLVI
Sbjct: 114 DSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVI 173

Query: 122 FESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQ 181
           FESRPEVIANITALSIKSGNAAILKGGKES+NTF+EMSRI+N ++ +NEK T VP GAVQ
Sbjct: 174 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQ 233

Query: 182 LIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADIG 241
           LIETR+DVSDLL QD YIDLV+PRGSNALVRQIK STKIPVLGHADGICSIY+DE AD+ 
Sbjct: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLE 293

Query: 242 KAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSL-IENGVTLHVSKEVKKQY--- 297
           KAKRI +DAKTNYPAGCNAVET+LINP L++WWEVL +L +E  V +H++K+VK+ Y   
Sbjct: 294 KAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSK 353

Query: 298 -----KEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIV 352
                K   +    IV+ +E++DFDKEFLSLD AV FV ST+ AV HIN HSSKHTDAI+
Sbjct: 354 LKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAII 413

Query: 353 TENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 412
           TEN E+AE+FLK VDSS VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+Y
Sbjct: 414 TENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 473

Query: 413 QYQLRGNGQIASDYLGAGGKKAFVHKDL 440
           QYQ+RG GQ+ASDYLGAGG KAF+HKDL
Sbjct: 474 QYQIRGTGQVASDYLGAGGNKAFIHKDL 501

>Scas_663.3
          Length = 457

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/449 (75%), Positives = 385/449 (85%), Gaps = 9/449 (2%)

Query: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60
           MS ++ IA+ AR AGN LKT+S++ RS+ILYKI D LKA A+ IEAANKLDL+ AK T+L
Sbjct: 1   MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL 60

Query: 61  SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV 120
           SDSL+KRLDLFKGDKFETMLQGI DVA+L+DPVGK+  ARE+DE LTLYQ+TAPVGVLLV
Sbjct: 61  SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV 120

Query: 121 IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV 180
           IFESRPEVIANITAL IKSGNA ILKGGKES+NTF+EMSRI+ND +E+NEK T VPVGAV
Sbjct: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV 180

Query: 181 QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI 240
           QLIETR+DV+DLL QDEYIDLV+PRGSNALVR IK+STKIPVLGHADGICS+Y+DE AD+
Sbjct: 181 QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL 240

Query: 241 GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENG-VTLHVSKEVKKQYKE 299
            KAKRI+ DAKTNYPAGCNA+ETLLINP   +WWEVL ++   G VTLH   +VKK Y +
Sbjct: 241 EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD 300

Query: 300 HNS---TSD-----HIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAI 351
             +   TSD     H VD+DE  DFDKEFLSLD AV FV STE A+ HIN HSS+HTDAI
Sbjct: 301 KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI 360

Query: 352 VTENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 411
           VTEN ++AE FLK VDSS VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+
Sbjct: 361 VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS 420

Query: 412 YQYQLRGNGQIASDYLGAGGKKAFVHKDL 440
           YQYQ+RGNGQIA DYLGAGG +AF+HKDL
Sbjct: 421 YQYQIRGNGQIAGDYLGAGGNRAFIHKDL 449

>YOR323C (PRO2) [5105] chr15 complement(921530..922900)
           Gamma-glutamyl phosphate reductase (phosphoglutamate
           dehydrogenase), proline biosynthetic enzyme [1371 bp,
           456 aa]
          Length = 456

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/449 (75%), Positives = 381/449 (84%), Gaps = 9/449 (2%)

Query: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60
           MS S+ IAK AR AGNILKT+S+E RS ILYKIHD LKANA +IE ANK+DL  AK T L
Sbjct: 1   MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL 60

Query: 61  SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV 120
           +DSL+KRLDLFKGDKFE MLQGI DVA L+DPVGKV  ARE+D+ LTLYQ+TAPVGVLLV
Sbjct: 61  ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV 120

Query: 121 IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV 180
           IFESRPEVIANITALSIKSGNAAILKGGKES+NTF+EM++IVND + Q +  T VPVG+V
Sbjct: 121 IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV 180

Query: 181 QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI 240
           QLIETR+DVSDLL QDEYIDLV+PRGSNALVR+IK +TKIPVLGHADGICSIY+DE AD+
Sbjct: 181 QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL 240

Query: 241 GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSL-IENGVTLHVSKEVKKQY-- 297
            KAKRI +DAKTNYPAGCNA+ETLLINPK   WWEVL +L +E GVT+H +K++K  Y  
Sbjct: 241 IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD 300

Query: 298 ------KEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAI 351
                 K   +     VD DE +DFDKEFLSLD+A  FV STE+A+ HINTHSS+HTDAI
Sbjct: 301 KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI 360

Query: 352 VTENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 411
           VTEN  NAE F+K VDSS VYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLV+
Sbjct: 361 VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS 420

Query: 412 YQYQLRGNGQIASDYLGAGGKKAFVHKDL 440
           YQYQ+RG+GQ+ASDYLGAGG KAFVHKDL
Sbjct: 421 YQYQIRGDGQVASDYLGAGGNKAFVHKDL 449

>Kwal_26.7067
          Length = 457

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/448 (73%), Positives = 382/448 (85%), Gaps = 9/448 (2%)

Query: 2   SVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNLS 61
           S SE+IAK AR  GN+LKT+S+E RSS+LYKIHDGLKANA SI+ ANK DLE AK  NL+
Sbjct: 3   SNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEANLA 62

Query: 62  DSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLVI 121
           DSL +RLDLFKGDKF+TML GI DVA L+DPVGK+  ARE+DENL LYQ+TAPVG LLVI
Sbjct: 63  DSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALLVI 122

Query: 122 FESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQ 181
           FESRPEVIANIT+L+IKSGNAAILKGGKES++TF+E+SRI+N V+ +NE ++ +P   +Q
Sbjct: 123 FESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQ 182

Query: 182 LIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADIG 241
           LIETR+DVSDLLQQD YIDLV+PRGSN LVR+IK+STKIPVLGHADGICSIY+DE AD+ 
Sbjct: 183 LIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEADLQ 242

Query: 242 KAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENG-VTLHVSKEVKKQY--- 297
           KA RI +DAKT+YPAGCNA+ETLLINPK+  WW+VL +L + G VTLHV+++VK  Y   
Sbjct: 243 KALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYFAK 302

Query: 298 -KEHNSTSDHI----VDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIV 352
             E N   D I    VD + S+DFDKEFLSLD AV FV STE AV HIN HSSKHTDAI+
Sbjct: 303 LAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDAII 362

Query: 353 TENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 412
           TEN  NAEYF+K VDSS VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+Y
Sbjct: 363 TENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 422

Query: 413 QYQLRGNGQIASDYLGAGGKKAFVHKDL 440
           QYQLRG+GQIASDY+G+GGK+AFVHK+L
Sbjct: 423 QYQLRGDGQIASDYVGSGGKRAFVHKNL 450

>CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomyces
           cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
           reductase, start by similarity
          Length = 455

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/449 (71%), Positives = 369/449 (82%), Gaps = 10/449 (2%)

Query: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60
           MS +E IAK AR AGN+LKT+SDE RS ILY+I D L      IE+ANK DLEQA++  L
Sbjct: 1   MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL 60

Query: 61  SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV 120
           +DSLVKRLDLFKGDKF+ MLQGI DVA+L+DPVGKV  AREID  L LYQ+TAPVGV+LV
Sbjct: 61  ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV 120

Query: 121 IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV 180
           IFESRPEVIANITAL IKSGNA ILKGGKES+NTFK M+++VN  +EQ +  T VPVGAV
Sbjct: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV 180

Query: 181 QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI 240
           QLIETR+DVSDLL QDEYIDLV+PRGSN+LVRQIK STKIPVLGHADGICSIYVD  AD+
Sbjct: 181 QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL 240

Query: 241 GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLI-ENGVTLHVSKEVKKQY-- 297
            KAKRI++DAKTNYPAGCNA+E LL+NP    W +VL+ LI E GVT+H + +VK+ +  
Sbjct: 241 EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK 300

Query: 298 ------KEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAI 351
                 K ++     IVD  +  DFDKEFLSLD AV F+ +T  A+ HIN HSSKHTDAI
Sbjct: 301 KLQDSGKLNDDIKAKIVDAKDG-DFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAI 359

Query: 352 VTENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 411
           +TE+ E+AE FLK +DSS VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT
Sbjct: 360 ITESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 419

Query: 412 YQYQLRGNGQIASDYLGAGGKKAFVHKDL 440
           YQYQ+RG+GQ+ASDYLGAGG KAFVHKD+
Sbjct: 420 YQYQIRGDGQVASDYLGAGGNKAFVHKDI 448

>ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH]
           (1324789..1326147) [1359 bp, 452 aa]
          Length = 452

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/444 (67%), Positives = 368/444 (82%), Gaps = 6/444 (1%)

Query: 2   SVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNLS 61
           +++ESIAK AR AGN+LKTLS+E+R+ +L +IHDGL A    I  AN+ DLE A   NL+
Sbjct: 3   TLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNNLA 62

Query: 62  DSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLVI 121
            +LV+RL+LFKGDKFE MLQGI+DVA L+DPVGK+   RE+DE LTLY++TAPVGV+L+I
Sbjct: 63  PALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVMLII 122

Query: 122 FESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQ 181
           FESRPEVIANI+AL IKSGNA ILKGGKE++NTF+E++ ++N V+ ++E  T VPV AVQ
Sbjct: 123 FESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQ 182

Query: 182 LIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADIG 241
           L+E+R +VSDLLQQDEYIDLV+PRGSNALV+QIK+STKIPVLGHADGICSIY+D  AD+ 
Sbjct: 183 LVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYLDADADLA 242

Query: 242 KAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENG-VTLHVSKEVKKQY--- 297
           KAKRI++D+KTNY A CNA E+LLINP+   W EVL  LI  G V LHV+ +VK+ +   
Sbjct: 243 KAKRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFFAY 302

Query: 298 -KEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIVTENS 356
             +  +   ++VD +E  DF +EFLSLDIAV F++S + AV+HIN HSSKHTDAIVTE  
Sbjct: 303 AGDDAALKGNVVDAEEG-DFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTECK 361

Query: 357 ENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQL 416
           + A++FLK +DS+ VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQ+
Sbjct: 362 QTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQYQV 421

Query: 417 RGNGQIASDYLGAGGKKAFVHKDL 440
           RG GQ+ASDY+GAGG +AFVHKDL
Sbjct: 422 RGTGQVASDYIGAGGDRAFVHKDL 445

>Kwal_47.16607
          Length = 797

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%)

Query: 247 LVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENGVTLHVS 290
           L  AK+      N +E L  +PKL+ ++  LN+ ++ G++LH+S
Sbjct: 144 LTGAKSALDYTVNQLENLGFSPKLEKYYPWLNTPVDAGMSLHIS 187

>CAGL0K03509g complement(326043..327626) similar to sp|Q04458
           Saccharomyces cerevisiae YMR110c aldehyde-dehydrogenase
           like protein, hypothetical start
          Length = 527

 Score = 32.3 bits (72), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 116/270 (42%), Gaps = 37/270 (13%)

Query: 9   KTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNLSDSLVKRL 68
           K  R+A N       ++R   L K++  +K +   I  A + D  +++  ++S   VK L
Sbjct: 35  KNVRSADN-------KQRQFWLKKLYWSVKDHEEQILEALEKDFHRSRQESISLEYVKLL 87

Query: 69  DLFKGDKFETMLQGIVDVANLQDPVGKV--NFAREIDENLTLYQITAPVGVLLVIFESRP 126
               GD    +L  I  +     P  KV  N A  +  N+ + +I+   G +LVI     
Sbjct: 88  ----GD----ILHLIEGIPKWNKP-KKVRDNSAPFMFGNINIEKISR--GNVLVISPFNF 136

Query: 127 EVIANI--TALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQLIE 184
            V+  +   A ++ +GN  ILK          EM+     V+E   K+  +P G +Q+++
Sbjct: 137 PVLLALAPVACALSAGNTVILKPS--------EMTPHCALVLEDIVKSCQLPEGVLQIVQ 188

Query: 185 TREDVSDLLQQDEYIDLVIPRGS---NALVRQIKSSTKIPVLGHADGICSIYVD---ESA 238
              + +  L   E +D++   GS    ++V Q  +   +P +    G    ++    +  
Sbjct: 189 GGVEQTTKLINSESLDMIFYTGSPRVGSIVAQAAAKNLVPCVLELGGKSPTFITGSLQKK 248

Query: 239 DIGKA-KRILVDAKTNYPAGCNAVETLLIN 267
           ++  A KRI   A  N    C + + LL++
Sbjct: 249 NLETALKRIFFGAFGNAGQICVSPDYLLVH 278

>Sklu_2186.2 YHR028C, Contig c2186 1993-4461 reverse complement
          Length = 822

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 13/69 (18%)

Query: 227 DGICSIYVDESADIGKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENGVT 286
           D I +   D S+D+     ILVDA  N      + +T+ +NP    WWE+ ++      T
Sbjct: 341 DSILAKVTDRSSDVLSV--ILVDASNN-----ASFKTVRVNPSEGDWWEITHN------T 387

Query: 287 LHVSKEVKK 295
           L V K+V +
Sbjct: 388 LFVPKDVSR 396

>AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505807)
            [4857 bp, 1618 aa]
          Length = 1618

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 13/86 (15%)

Query: 154  TFKEMSRIVNDVVEQNEKTTHVPVGAVQLIETREDVSDLLQQDEYIDLVIPRGSNALVRQ 213
            TF  +   +ND++E+N +TT + V +V  I+T+ED  +  ++   +D    +    L+R+
Sbjct: 1190 TFALLMEELNDIIEKNNRTTSIEVTSV--IKTKEDRREWWEERYSLD----KRMCDLMRR 1243

Query: 214  IKSSTKIPVLGHADGICSIYVDESAD 239
            I+ S          G C  +  +  D
Sbjct: 1244 IEDSWIC-------GFCGFFSQKQLD 1262

>Sklu_2412.4 YMR124W, Contig c2412 7729-10719
          Length = 996

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 346 KHTDAIVTENSENAEYFLKAVDSSSVYWN--ASTRFADGFRYGFG 388
           KH++    EN E+ E  +    SS V +N  ++ R   G +YGFG
Sbjct: 120 KHSNGRTKENEEDEEVIMSDQSSSMVTFNDLSTLRNNGGHKYGFG 164

>KLLA0E07898g 712370..715057 similar to sp|P40462 Saccharomyces
           cerevisiae YIL137c, start by similarity
          Length = 895

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 8/117 (6%)

Query: 73  GDKFETML--QGIVDVANLQDPVGKVNFAREI----DENLTLYQIT-APVGVLLVIFE-S 124
            D FE  +  +GI  + +LQ  VGK NF R +     E+ T ++    P+ +   + E  
Sbjct: 393 SDAFEPHIYHKGISLLRSLQQSVGKENFNRALAQIFSESSTFHETCIKPMDIFRRMGEIL 452

Query: 125 RPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQ 181
           + E IAN  +   ++    I+    ++  T  E  R + +  +  +   H+P+ AVQ
Sbjct: 453 KSENIANFYSSWTRTPGIPIISVNTDTERTTLEQHRFLLEKTDVEDIPYHIPLFAVQ 509

>Scas_717.74
          Length = 522

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 63/141 (44%), Gaps = 15/141 (10%)

Query: 134 ALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQLIETREDVSDLL 193
           A +I +GN+ ILK  + + +T   M RI+ +           P G VQ+++   D +  L
Sbjct: 145 AHAIGAGNSVILKPSERTAHTALVMQRIIEEA--------GFPDGLVQVVQGAIDETQRL 196

Query: 194 QQDEYIDLVIPRGS---NALVRQIKSSTKIPVLGHADGICSIYVDES---ADIGKA-KRI 246
              + +D++   GS    +++ Q  +    P +    G    ++ E+    ++  A KRI
Sbjct: 197 ITSKDLDMIFYTGSPTVGSIIAQEAAKNLTPCVLELGGKSPTFITENFNDKNLKTALKRI 256

Query: 247 LVDAKTNYPAGCNAVETLLIN 267
              A  N    C + + LL++
Sbjct: 257 FFGAFGNSGQICVSPDYLLVH 277

>ABL204W [388] [Homologous to ScYNL239W (LAP3) - SH]
           complement(24591..26030) [1440 bp, 479 aa]
          Length = 479

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 14/73 (19%)

Query: 46  AANKLDLEQAKSTNLSDSLVKRLDLFKGDKFET---MLQGIVDVANLQDPVGKVNFAREI 102
           A N+L L  A+  NL +  + +  LF  DK E     L  IVD AN            E+
Sbjct: 108 ATNELRLNVAQKLNLKEFELSQAYLFFYDKLEKANYFLDQIVDTAN-----------EEV 156

Query: 103 DENLTLYQITAPV 115
           +  L  Y +T+PV
Sbjct: 157 ESRLVQYLLTSPV 169

>ADR322W [2063] [Homologous to ScYKR042W (UTH1) - SH; ScYJL116C
           (NCA3) - SH] complement(1270810..1272336) [1527 bp, 508
           aa]
          Length = 508

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 226 ADGICSIYVDESADIGKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENGV 285
           AD +C   VD +A + K  + +   +T+YPA  N V   ++ P      + ++ +  N  
Sbjct: 340 ADYLCQWDVDSAAAVNKVGQPIAMCRTDYPASENMVVPTVLEPGSS---KPVSVVDANNY 396

Query: 286 TLHVSKEVKKQYKEHNS 302
            +   K+   QY  +N+
Sbjct: 397 YMWQGKKTSTQYYVNNA 413

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 7/109 (6%)

Query: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60
           ++V  S   T R A  + K+   ++ S+    ++DGL    ++ E     + E A+  N+
Sbjct: 50  LNVINSSPTTKRMANALFKSSPMKKLSN---SVNDGLSLEGSNGEITGLNNFEWAELVNI 106

Query: 61  SDS---LVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVN-FAREIDEN 105
                   + LD+F    F+ ++Q   DVA L   VG+   F   +D N
Sbjct: 107 QKWRKIFGQLLDMFFRKYFQLLIQQPFDVARLLIQVGEFKIFKTTVDTN 155

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,586,296
Number of extensions: 592608
Number of successful extensions: 1732
Number of sequences better than 10.0: 39
Number of HSP's gapped: 1721
Number of HSP's successfully gapped: 39
Length of query: 440
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 335
Effective length of database: 12,961,219
Effective search space: 4342008365
Effective search space used: 4342008365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)