Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03960g22522211491e-162
ADR352C2542182446e-25
Scas_592.152542212238e-22
Kwal_26.70662042192181e-21
YAL027W2612212011e-18
CAGL0G06292g2532231605e-13
CAGL0L10472g63888760.091
YMR294W (JNM1)37347642.3
AAL068C66448643.2
KLLA0F26290g66168625.8
CAGL0J02904g54355608.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03960g
         (222 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03960g 353119..353796 weakly similar to sp|P39735 Saccharo...   447   e-162
ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)...    99   6e-25
Scas_592.15                                                            91   8e-22
Kwal_26.7066                                                           89   1e-21
YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown fu...    82   1e-18
CAGL0G06292g complement(602454..603215) similar to sp|P39735 Sac...    66   5e-13
CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces...    34   0.091
YMR294W (JNM1) [4248] chr13 (856965..858086) Coiled-coil protein...    29   2.3  
AAL068C [119] [Homologous to ScYHR035W - SH] (229091..231085) [1...    29   3.2  
KLLA0F26290g complement(2436415..2438400) similar to sp|P25298 S...    28   5.8  
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...    28   8.6  

>KLLA0A03960g 353119..353796 weakly similar to sp|P39735
           Saccharomyces cerevisiae YAL027w hypothetical protein
           singleton, hypothetical start
          Length = 225

 Score =  447 bits (1149), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/222 (100%), Positives = 222/222 (100%)

Query: 1   MKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDV 60
           MKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDV
Sbjct: 1   MKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDV 60

Query: 61  YNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSN 120
           YNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSN
Sbjct: 61  YNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSN 120

Query: 121 TGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQ 180
           TGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQ
Sbjct: 121 TGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQ 180

Query: 181 DPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKRG 222
           DPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKRG
Sbjct: 181 DPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKRG 222

>ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)
           [765 bp, 254 aa]
          Length = 254

 Score = 98.6 bits (244), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 109/218 (50%), Gaps = 34/218 (15%)

Query: 4   LLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDVYNP 63
           LL E+RD LL+++YEL SP  EE  L K KI    DF D++   ++G   E        P
Sbjct: 67  LLAELRDDLLYIIYELGSPGAEE-TLRKFKIGGLADFRDIVRAAEQGDRPE-------QP 118

Query: 64  IDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSNTGQ 123
           I G+D+H  + ER  K+ + LHF HNW ++I++ +I KL  WR+L  LL  +  +     
Sbjct: 119 IPGLDLHTMTFERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRL--LLCDIAPIGVPAA 176

Query: 124 SIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQDPN 183
           + P  +P  +  VL+R  +   S     + + P        +G   VPR+          
Sbjct: 177 AAPAPMPAGAPYVLLRERRGRVSPQGMLQEDAP--------EG---VPREG--------- 216

Query: 184 DIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKR 221
               D   ++KP+ DY+YK +      I+IHVL RP+R
Sbjct: 217 ----DLNVEQKPVLDYRYKSVTNLGPGIEIHVLQRPRR 250

>Scas_592.15
          Length = 254

 Score = 90.5 bits (223), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 102/221 (46%), Gaps = 34/221 (15%)

Query: 1   MKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDV 60
           M+ L NEIRD+++ ++Y+L SP + E VL KL+I +  DF    EIL K     T S D+
Sbjct: 65  MERLTNEIRDTIILIVYDLSSPEVMETVLGKLRIGSSADFET--EILPKLMDENTLSKDL 122

Query: 61  YNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSN 120
            N      V + ++ R  K  YKL F  NW LDI I N+ KL   R  L   D   S + 
Sbjct: 123 VN------VPLQTVTRVAKFKYKLRFKGNWELDIFINNMKKLIKIRHFLLFTDGHMSAAR 176

Query: 121 TGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQ 180
           T +  P            R I   E  T+      P I +E + D + +  +D +E    
Sbjct: 177 TLELPP-----------NRRILLTEQKTSLESEGSPMIPLEVDGDEMIETTQDAVE---- 221

Query: 181 DPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKR 221
              D+K D K    PI +          +C+ IH+L RP+R
Sbjct: 222 ---DVKPDIKLKYNPIIN--------LGECLSIHILQRPRR 251

>Kwal_26.7066
          Length = 204

 Score = 88.6 bits (218), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 106/219 (48%), Gaps = 29/219 (13%)

Query: 13  LFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDVYNPIDGIDVHIT 72
           + +LYEL +  + E+VL K+K+   ++  D++   +  S   T+ +D  +       H+T
Sbjct: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMKDIM--TRFPSFRHTKHSDTTS------CHLT 52

Query: 73  SIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSNTGQSIPLFIPFK 132
           ++ER+GK  YKLH+ +NW LDI + +I KL   R  L    + +  S++G   P+     
Sbjct: 53  TLERSGKHQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIG-DLS 111

Query: 133 STNVLVRSIKPLESDTNSSKSEDPPILIE-------PEDDGLGQVPRDEI--EMVDQDPN 183
            T VL R  + + S   +S   +P +L+E       PE  G  + P   +  EM+D D  
Sbjct: 112 KTKVLRRVREEIVSKQEASS--EPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVD-- 167

Query: 184 DIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKRG 222
                   +KKP F +    M     CI IH+L RP R 
Sbjct: 168 -------SEKKPKFKFSNVQMLNLGNCIDIHILKRPARA 199

>YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown
           function [786 bp, 261 aa]
          Length = 261

 Score = 82.0 bits (201), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 103/221 (46%), Gaps = 44/221 (19%)

Query: 2   KFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFA-DVLEILKKGSSLETRSTDV 60
           K L +EI++ LL ++YEL SP +   VL+K+++    DF  +VL  L  G+      TD 
Sbjct: 71  KNLCDEIKEDLLLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKLFAGAD-----TD- 124

Query: 61  YNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSN 120
               + +  HI S+ R  K  YKLH+ H W LDI I +I K+ + R  L      Q+++ 
Sbjct: 125 ----NAVTSHIQSVTRLAKFKYKLHYKHKWELDIFINSIKKIANLRHYLMF----QTLTL 176

Query: 121 TGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQ 180
            G S+                           +  P  L+  + +   QVP   IE  D 
Sbjct: 177 NGFSL---------------------------NAGPKTLLARKIEKQPQVPNLLIENGDA 209

Query: 181 DPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKR 221
           D  D  ++  +D KP+ ++ YK +    + I +HVL RP+R
Sbjct: 210 DALDTPVE--EDIKPVIEFMYKPVINLGEIIDVHVLHRPRR 248

>CAGL0G06292g complement(602454..603215) similar to sp|P39735
           Saccharomyces cerevisiae YAL027w, start by similarity
          Length = 253

 Score = 66.2 bits (160), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 102/223 (45%), Gaps = 38/223 (17%)

Query: 1   MKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDV 60
           +K L+ E+ D ++ +LYEL SP +++ + +K+++    DF +  + LKK           
Sbjct: 64  LKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYDFDE--DTLKKFPQ-------- 113

Query: 61  YNPIDGI--DVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSV 118
              I G   + ++TS++R GK  YKL +  NW +DI I NI+KL   R  L   D     
Sbjct: 114 --SIQGSLKESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRTYLIFKDQYPQ- 170

Query: 119 SNTGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMV 178
                  P     K  ++LV   K L   TN    +DP IL E E+  L      E    
Sbjct: 171 ---WNEYPCL--QKQQSLLVMGQK-LSESTN----QDPIILQEEEELNLNYEQSAE---- 216

Query: 179 DQDPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKR 221
                    D  +++KP   + Y+      +C+ +++L RPKR
Sbjct: 217 ---------DQPNNEKPEIAFTYEPQLSLIQCLDLYILKRPKR 250

>CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w, start by similarity
          Length = 638

 Score = 33.9 bits (76), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 8/88 (9%)

Query: 112 LDSVQSVSNTGQSIPLFIPFKSTNVLVRSIK-PLESDTNSSKSEDPPILIEPEDDGLGQV 170
           L +    +  G S P  + F S+ +  R+IK PL SD NS+KSE    +I+P    LGQ 
Sbjct: 111 LSASSYTAAKGHSTPRKL-FDSSRIR-RNIKVPLNSDGNSAKSESSHSVIDP----LGQA 164

Query: 171 PRDEIEMVDQDPNDIKLDTKDDKKPIFD 198
            +D  E VD+  +D   +++   + IF+
Sbjct: 165 EKDR-EFVDEPLDDRVTNSQHANRSIFE 191

>YMR294W (JNM1) [4248] chr13 (856965..858086) Coiled-coil protein
           involved in nuclear migration and control of astral
           microtubules during mitotic growth [1122 bp, 373 aa]
          Length = 373

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 37  FMDFADVL----EILKKGSSLETRSTDVYNPIDGIDVHITSIERTGK 79
           F  + D L    E +K  + +  R  +VY    G+D  ITSI+  GK
Sbjct: 283 FKQYQDSLPLLAERMKSLNKMNNRVIEVYETTKGLDSQITSIQEQGK 329

>AAL068C [119] [Homologous to ScYHR035W - SH] (229091..231085) [1995
           bp, 664 aa]
          Length = 664

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 56  RSTDVYNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENIDKLH 103
           RS   + P    DV ITS+++TG     L  +H  + D L+E  D+ H
Sbjct: 282 RSLREFAPAVSYDVFITSLDQTGVWEMALCLNHVVQYDTLVE--DRFH 327

>KLLA0F26290g complement(2436415..2438400) similar to sp|P25298
           Saccharomyces cerevisiae YMR061w RNA14 component of
           pre-mRNA 3 -end processing factor CF I singleton, start
           by similarity
          Length = 661

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 143 PLESDTNSSKSEDPPILIEPEDDGLGQVPRDEIEMVDQDPNDIKLDTKDDKKPIFDYQYK 202
           PL S +N+S S  P   +  E D +G++     +M+++ P DI L  K  K  +   Q+K
Sbjct: 10  PLPSSSNTSTSLRPTSRVRDESDVIGKLN----DMIEEQPTDIFLYVKLLKHHVSLKQWK 65

Query: 203 GM-RLFDK 209
            +   FDK
Sbjct: 66  QVYETFDK 73

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score = 27.7 bits (60), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 16  LYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLET-RSTDVYNPIDGIDV 69
           LY    PIL  K    LK++ F++ +   E+  +  SL   R    Y+P  G+D+
Sbjct: 369 LYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRERAFYSPGSGVDI 423

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.139    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,960,505
Number of extensions: 380370
Number of successful extensions: 1427
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1416
Number of HSP's successfully gapped: 32
Length of query: 222
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 124
Effective length of database: 13,203,545
Effective search space: 1637239580
Effective search space used: 1637239580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)