Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03938g42041421250.0
Sklu_2164.44651612346e-21
CAGL0G06314g6532191878e-15
Kwal_26.70633781471634e-12
YAL028W5281421502e-10
Scas_663.275591511396e-09
Scas_592.145491801235e-07
ADR353C2751471039e-05
Kwal_23.326438964682.3
Kwal_14.2543711136682.6
Scas_591.366592673.4
Kwal_23.3922661121673.6
YBR121C (GRS1)66792664.0
CAGL0G01364g663112655.0
KLLA0B08932g66395656.2
YPR106W (ISR1)443134646.7
YGL086W (MAD1)74963639.2
Kwal_33.1463660847639.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03938g
         (414 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03938g 351240..352502 some similarities with sp|P39734 Sac...   823   0.0  
Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement         95   6e-21
CAGL0G06314g complement(603668..605629) some similarities with s...    77   8e-15
Kwal_26.7063                                                           67   4e-12
YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown fu...    62   2e-10
Scas_663.27                                                            58   6e-09
Scas_592.14                                                            52   5e-07
ADR353C [2094] [Homologous to NOHBY] (1327148..1327975) [828 bp,...    44   9e-05
Kwal_23.3264                                                           31   2.3  
Kwal_14.2543                                                           31   2.6  
Scas_591.3                                                             30   3.4  
Kwal_23.3922                                                           30   3.6  
YBR121C (GRS1) [309] chr2 complement(481320..483323) Glycyl-tRNA...    30   4.0  
CAGL0G01364g 130059..132050 highly similar to sp|P38088 Saccharo...    30   5.0  
KLLA0B08932g 783004..784995 highly similar to sp|P38088 Saccharo...    30   6.2  
YPR106W (ISR1) [5527] chr16 (740057..741388) Serine-threonine pr...    29   6.7  
YGL086W (MAD1) [1896] chr7 (347120..349369) Protein involved in ...    29   9.2  
Kwal_33.14636                                                          29   9.3  

>KLLA0A03938g 351240..352502 some similarities with sp|P39734
           Saccharomyces cerevisiae YAL028w, hypothetical start
          Length = 420

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/414 (96%), Positives = 400/414 (96%)

Query: 1   MEVSHREHTNHIGSQVNPLFRGSVFHKNDAADLRVPWDGKRRKSGASINSKTQMGDLTEF 60
           MEVSHREHTNHIGSQVNPLFRGSVFHKNDAADLRVPWDGKRRKSGASINSKTQMGDLTEF
Sbjct: 1   MEVSHREHTNHIGSQVNPLFRGSVFHKNDAADLRVPWDGKRRKSGASINSKTQMGDLTEF 60

Query: 61  NPSHHASNKNIYHDDITCGSLRFSDALLDGSFKCQDEHSSNRSGHMASSKPGSGNSSLGL 120
           NPSHHASNKNIYHDDITCGSLRFSDALLDGSFKCQDEHSSNRSGHMASSKPGSGNSSLGL
Sbjct: 61  NPSHHASNKNIYHDDITCGSLRFSDALLDGSFKCQDEHSSNRSGHMASSKPGSGNSSLGL 120

Query: 121 LKXXXXXXXXXXXXXXFKKTHTKLLNFSQLKPDLTTASSFESQPSKGNSLARQFLETASK 180
           LK              FKKTHTKLLNFSQLKPDLTTASSFESQPSKGNSLARQFLETASK
Sbjct: 121 LKNQSYSNISISSTQSFKKTHTKLLNFSQLKPDLTTASSFESQPSKGNSLARQFLETASK 180

Query: 181 AKCNREIIPTLFYSPSANSCGDTSGALDYLSSGFTDKLFPIFNSKETDPKDMKIDVDCKD 240
           AKCNREIIPTLFYSPSANSCGDTSGALDYLSSGFTDKLFPIFNSKETDPKDMKIDVDCKD
Sbjct: 181 AKCNREIIPTLFYSPSANSCGDTSGALDYLSSGFTDKLFPIFNSKETDPKDMKIDVDCKD 240

Query: 241 IPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLHMDI 300
           IPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLHMDI
Sbjct: 241 IPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLHMDI 300

Query: 301 EKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELEAKK 360
           EKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELEAKK
Sbjct: 301 EKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELEAKK 360

Query: 361 LQLRKLENLIKLNDMIGDFKRNMKLSEKLKEYYGTFGDVTVLALSISLIMYLFR 414
           LQLRKLENLIKLNDMIGDFKRNMKLSEKLKEYYGTFGDVTVLALSISLIMYLFR
Sbjct: 361 LQLRKLENLIKLNDMIGDFKRNMKLSEKLKEYYGTFGDVTVLALSISLIMYLFR 414

>Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement
          Length = 465

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 93/161 (57%)

Query: 238 CKDIPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLH 297
           C+  P+Y  +DY ++I  ++   E  +K+ +  V+  +E     +   +S L K + ++ 
Sbjct: 284 CEKTPDYNIVDYKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIR 343

Query: 298 MDIEKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELE 357
             I ++ ++ K+ YL +L   FN +DSESF+S+L  ++  H+S L+ LE +  + ++ L 
Sbjct: 344 TRIVELHYEVKENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLA 403

Query: 358 AKKLQLRKLENLIKLNDMIGDFKRNMKLSEKLKEYYGTFGD 398
            +K  L  +E+++KL  ++ D K+NM  S++LKEY G   D
Sbjct: 404 RQKNALEDMESIVKLKQLVADSKKNMTFSDRLKEYKGILWD 444

>CAGL0G06314g complement(603668..605629) some similarities with
           sp|P39734 Saccharomyces cerevisiae YAL028w, hypothetical
           start
          Length = 653

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 107/219 (48%), Gaps = 11/219 (5%)

Query: 202 DTSGALDYLSSGFTDKLFPIFNSKETDPKDMK----IDVDCKDIPEYFAMD----YIKHI 253
           D+  A+    SG     F   N+K T  + +K    I+ +  D   +   +    Y +HI
Sbjct: 431 DSRSAIGSYRSGLATSSFFFSNAKLTSKEKIKNSEIINSNANDSNMFLGTNETDYYQQHI 490

Query: 254 HRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLHMDIEKIKHDTKDIYLE 313
           +  LT LE ++K+ L  VIL  E++   NI    NL+  +  L   I  +K+   + YL 
Sbjct: 491 NSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGLKNTIANEYLT 550

Query: 314 KLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRKLENLIKLN 373
            L A F+ ++ ESF S+L   ++ +V  L+ LE K  + Q++L  +K  +RK+E+L+ L 
Sbjct: 551 VLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETMRKMESLLYLE 610

Query: 374 DMIGDFKRNMKLSEKLKEYYGTFGDVTVLALSISLIMYL 412
           + +   K+N  L+ K   Y     D+  L   + +  YL
Sbjct: 611 NSLMVSKKNTGLAYK---YRYMLYDILTLGFLVLIGYYL 646

>Kwal_26.7063
          Length = 378

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 73/147 (49%)

Query: 268 LMKVILPQEMDFTQNINHVSNLSKSVTQLHMDIEKIKHDTKDIYLEKLAAAFNGSDSESF 327
           LM  I   E   T+    + +L + + +    I+ I    +D  ++ L  +F   D  SF
Sbjct: 225 LMASISSDESRITKTRTELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRKSFESEDESSF 284

Query: 328 VSKLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRKLENLIKLNDMIGDFKRNMKLSE 387
           +S+ +  + ++   L + E +    + +L  +K  + KLE  IKLN+MI D + NM   +
Sbjct: 285 ISRFSAAIATYSESLASFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLD 344

Query: 388 KLKEYYGTFGDVTVLALSISLIMYLFR 414
           +++EY G   D   L L I+LI+ L R
Sbjct: 345 RIREYKGLIYDFCALILLIALIVVLKR 371

>YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown
           function [1587 bp, 528 aa]
          Length = 528

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 74/142 (52%)

Query: 249 YIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSVTQLHMDIEKIKHDTK 308
           Y +HI   L   E  LKH L   +L  E D  +NI +   + K +  L       K   +
Sbjct: 361 YQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVE 420

Query: 309 DIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRKLEN 368
           + YL  L   F+  + ESF ++L+  ++++V++LQ LE +    ++ L ++K  +RK+E+
Sbjct: 421 EDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKMES 480

Query: 369 LIKLNDMIGDFKRNMKLSEKLK 390
           L+ L + +   K+N+  + K +
Sbjct: 481 LLSLENSLMISKKNVTFASKYR 502

>Scas_663.27
          Length = 559

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 78/151 (51%), Gaps = 5/151 (3%)

Query: 234 IDVDCKDIPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSV 293
           ++++C ++  Y    Y  HI   L   E  LK  L   ++  E D    ++   NL+  +
Sbjct: 381 LNINCNEL-NY----YQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHL 435

Query: 294 TQLHMDIEKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQ 353
             +   I+++     + YL K+  AFN  D  SF  +L T +++ + +L+ LE +    Q
Sbjct: 436 QNMKNRIDELYDVINEKYLSKIKTAFNEDDESSFEFELRTSVEASIKQLEELENRMEYCQ 495

Query: 354 NELEAKKLQLRKLENLIKLNDMIGDFKRNMK 384
            +L+ ++  +R+L+NLI + + + + K+N+K
Sbjct: 496 LKLQEQRETMRQLDNLILIENSLLESKKNVK 526

>Scas_592.14
          Length = 549

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 84/180 (46%), Gaps = 5/180 (2%)

Query: 234 IDVDCKDIPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSV 293
           + + C +I +Y    Y +HI   L   E  +K  L  +IL +E D   N+ +       +
Sbjct: 373 LSLSCNEI-DY----YQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDL 427

Query: 294 TQLHMDIEKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQ 353
            +L   I  ++   ++ YL  L   F+ ++  SF + LT +++ +V++LQ LE +     
Sbjct: 428 KKLKYQIISLQKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSG 487

Query: 354 NELEAKKLQLRKLENLIKLNDMIGDFKRNMKLSEKLKEYYGTFGDVTVLALSISLIMYLF 413
             L  +K  ++++ENLI L + +   ++N     K K        V +L LS  L+  L 
Sbjct: 488 ERLNEQKETMKRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYLLQKLI 547

>ADR353C [2094] [Homologous to NOHBY] (1327148..1327975) [828 bp,
           275 aa]
          Length = 275

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/147 (19%), Positives = 64/147 (43%), Gaps = 7/147 (4%)

Query: 268 LMKVILPQEMDFTQNINHVSNLSKSVTQLHMDIEKIKHDTKDIYLEKLAAAFNGSDSESF 327
           + + +LP+          +  L     +    + +++ +     +E  + A   ++ E+F
Sbjct: 131 VTRGLLPRADALAAVEAALGKLGAEAAREAGAVRRLQQE----VVEAPSDAVRAAEREAF 186

Query: 328 VSKLTTLMDSHVSRLQALEGKTVDFQNELEAKKLQLRKLENLIKLNDMIGDFKRNMKLSE 387
            ++L +     +  LQ LE +    ++   A + +LR+LE+   L     D +R  +L+ 
Sbjct: 187 SARLESAFRPALVTLQTLETRLAHGRSAAAALETRLRRLEHAAVLEKRAADMRRGERLAA 246

Query: 388 KLKEYYGTFGDVTVLA---LSISLIMY 411
           +L        D+  LA   L+I L+M+
Sbjct: 247 RLANQRAAMCDMAALAFAVLAIWLVMW 273

>Kwal_23.3264
          Length = 389

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 6/64 (9%)

Query: 154 LTTASSFESQPSKGNS-----LARQFLETASKAKCNREIIPTLFYSPSANSCGDTSGALD 208
           LT  S+ +  P K N      + R+      ++ C R   P L Y P  NS  D  G LD
Sbjct: 29  LTPPSTIQKAPRKSNEEETLIIPRKLFPDLKRS-CTRRRKPPLRYRPQTNSVFDIEGYLD 87

Query: 209 YLSS 212
            + S
Sbjct: 88  GVKS 91

>Kwal_14.2543
          Length = 711

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 53/136 (38%), Gaps = 21/136 (15%)

Query: 141 HTKLLNFSQLKPDLTTASSFESQPSKGNSLARQFLE--------------TASKAKCNRE 186
           H+ L NF  +  DLT A +F  +     SL  Q ++              T +  +C+++
Sbjct: 191 HSSLPNF--IDCDLTCAPTFSEEDELFESLCAQCVDLDQHDPSSAHEHSHTTTHEQCSQQ 248

Query: 187 IIPTLFYSPSANSC-GDTSGALDYLSSGFTDKLFPIFNSKETDPKDMKIDVDCKDIPEYF 245
             P  +       C  D  G +   SS  T   + + N+      DMKI  +  +I   +
Sbjct: 249 ERPHSYNQGHTQQCHADEQGHVPCASSQSTSGHYHVINAS----TDMKIIEELANISNMY 304

Query: 246 AMDYIKHIHRDLTALE 261
              + KH+H   T  E
Sbjct: 305 DFPFGKHVHSHDTGKE 320

>Scas_591.3
          Length = 665

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 11/92 (11%)

Query: 191 LFYSPSANSCGDTSGALDYLSSG--FTDKLFPIFNSKETDPKDMKIDVDCKDIPEYFAMD 248
            FY+P+    G  SG  DY   G  F   +  ++       +DM ++VDC  +  Y  + 
Sbjct: 28  FFYAPAFELYGGVSGLYDYGPPGCAFQANIVDVWRKHFILEEDM-LEVDCTMLTPYEVLK 86

Query: 249 YIKHIH-------RDLTALE-FRLKHFLMKVI 272
              H+        RDL   E FR  H + +V+
Sbjct: 87  TSGHVDKFSDWMCRDLKTGEIFRADHLVEEVL 118

>Kwal_23.3922
          Length = 661

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 50/121 (41%), Gaps = 19/121 (15%)

Query: 162 SQPSKGNSLARQFLETASKAKCNREIIPTLFYSPSANSCGDTSGALDYLSSG--FTDKLF 219
           +Q  +    +R+ LE+  K +         F++PS    G  SG  DY   G  F   + 
Sbjct: 7   TQARRTVEFSRENLESVLKRR--------FFFAPSFELYGGVSGLYDYGPPGCAFQANVI 58

Query: 220 PIFNSKETDPKDMKIDVDCKDIPEYFAMDYIKHIH-------RDLTALE-FRLKHFLMKV 271
            ++       +DM ++VDC  +  Y  +    H+        RDL   E FR  H + +V
Sbjct: 59  DVWRKHFILEEDM-LEVDCSMLTPYEVLKTSGHVDKFSDWMCRDLKTGEIFRADHLVEEV 117

Query: 272 I 272
           +
Sbjct: 118 L 118

>YBR121C (GRS1) [309] chr2 complement(481320..483323) Glycyl-tRNA
           synthetase, also involved in 3'-end formation of mRNA
           [2004 bp, 667 aa]
          Length = 667

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 11/92 (11%)

Query: 191 LFYSPSANSCGDTSGALDYLSSG--FTDKLFPIFNSKETDPKDMKIDVDCKDIPEYFAMD 248
            FY+P+ +  G  SG  DY   G  F + +   +       +DM ++VDC  +  Y  + 
Sbjct: 28  FFYAPAFDLYGGVSGLYDYGPPGCAFQNNIIDAWRKHFILEEDM-LEVDCTMLTPYEVLK 86

Query: 249 YIKHIH-------RDLTALE-FRLKHFLMKVI 272
              H+        RDL   E FR  H + +V+
Sbjct: 87  TSGHVDKFSDWMCRDLKTGEIFRADHLVEEVL 118

>CAGL0G01364g 130059..132050 highly similar to sp|P38088
           Saccharomyces cerevisiae YBR121c GRS1, start by
           similarity
          Length = 663

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 48/112 (42%), Gaps = 12/112 (10%)

Query: 171 ARQFLETASKAKCNREIIPTLFYSPSANSCGDTSGALDYLSSG--FTDKLFPIFNSKETD 228
           ARQ +E  S+ K    +    FY+P+ +  G  SG  DY   G  F   +   +      
Sbjct: 9   ARQAVEF-SREKLESVLRGRFFYAPAFDLYGGVSGLYDYGPPGCSFQANVVDQWRKHFIL 67

Query: 229 PKDMKIDVDCKDIPEYFAMDYIKHIH-------RDLTALE-FRLKHFLMKVI 272
            +DM ++VDC  +  Y  +    H+        RDL   E FR  H + +V+
Sbjct: 68  EEDM-LEVDCTMLTPYEVLKTSGHVDKFSDWMCRDLKTGEIFRADHLVEEVL 118

>KLLA0B08932g 783004..784995 highly similar to sp|P38088
           Saccharomyces cerevisiae YBR121c GRS1 glycine--tRNA
           ligase, start by similarity
          Length = 663

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 11/95 (11%)

Query: 163 QPSKGNSLARQFLETASKAKCNREIIPTLFYSPSANSCGDTSGALDYLSSG--FTDKLFP 220
           Q  K    +R+ LE+  K +         FY+P+    G  SG  DY   G  F   +  
Sbjct: 8   QAKKAVEFSRESLESVLKRR--------FFYAPAFELYGGVSGLYDYGPPGCSFQANIVD 59

Query: 221 IFNSKETDPKDMKIDVDCKDIPEYFAMDYIKHIHR 255
           ++       +DM ++VDC  +  Y  +    H+ +
Sbjct: 60  VWRKHFVLEEDM-LEVDCTMLTPYEVLKTSGHVDK 93

>YPR106W (ISR1) [5527] chr16 (740057..741388) Serine-threonine
           protein kinase involved in staurosporine resistance
           [1332 bp, 443 aa]
          Length = 443

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 59/134 (44%), Gaps = 32/134 (23%)

Query: 242 PEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQN---------------INHV 286
           PE  A+ +   +   +++LEF L  FLM ++L  EMDF  N                ++V
Sbjct: 93  PENLALMF--RLSNTVSSLEF-LDEFLMGILLAPEMDFLSNPSYSLPSNKLVGQGSYSYV 149

Query: 287 SNLSKSVTQ-------LHMDIEKIKHDTKDIYLEKLAAAF----NGSDSESFVSK---LT 332
             +S S +        + +   K +H +K I  E L  A+    + S +ES +     LT
Sbjct: 150 YPISSSASSRCNNDSGVVLKFAKSQHKSKVILQEALTLAYLQYMSPSTNESHIIPFYGLT 209

Query: 333 TLMDSHVSRLQALE 346
            +  SH  RL++ E
Sbjct: 210 YITKSHFRRLRSNE 223

>YGL086W (MAD1) [1896] chr7 (347120..349369) Protein involved in
           spindle-assembly checkpoint, required for cell cycle
           delay in response to impaired kinetochore function [2250
           bp, 749 aa]
          Length = 749

 Score = 28.9 bits (63), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 13/63 (20%)

Query: 341 RLQALEGKTVDFQNELEAKKLQLRKLENLIK-------------LNDMIGDFKRNMKLSE 387
           ++QAL+ K    QNE E +KLQL+K  N+++             LND    ++ N KL +
Sbjct: 63  QIQALQFKLNTLQNEYEIEKLQLQKQTNILEKKYKATIDELEKALNDTKYLYESNDKLEQ 122

Query: 388 KLK 390
           +LK
Sbjct: 123 ELK 125

>Kwal_33.14636
          Length = 608

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 230 KDMKIDVDCKDIPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQE 276
           KDMK ++ CKD  E F +   + IHR       R KH  +K+ L  E
Sbjct: 51  KDMKTEILCKDCEENFCVVCFEMIHRSGR----RKKHEYVKISLEPE 93

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,203,555
Number of extensions: 567580
Number of successful extensions: 2142
Number of sequences better than 10.0: 70
Number of HSP's gapped: 2178
Number of HSP's successfully gapped: 73
Length of query: 414
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 310
Effective length of database: 12,995,837
Effective search space: 4028709470
Effective search space used: 4028709470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)