Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03916g75743791e-49
Kwal_14.72261124562.8
KLLA0A07293g58324563.0
AER159C119131545.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03916g
         (74 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03916g 349889..350116 similar to sp|Q05401 Saccharomyces c...   150   1e-49
Kwal_14.722                                                            26   2.8  
KLLA0A07293g 652702..654453 weakly similar to sgd|S0005477 Sacch...    26   3.0  
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    25   5.5  

>KLLA0A03916g 349889..350116 similar to sp|Q05401 Saccharomyces
          cerevisiae Orf 06169 protein, start by similarity
          Length = 75

 Score =  150 bits (379), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%)

Query: 1  MMCVFLIIFFHTSEISHNIFSRNSLTCTGFTRNDDCLVLICCLHQPIRFLCDSKKMWFQF 60
          MMCVFLIIFFHTSEISHNIFSRNSLTCTGFTRNDDCLVLICCLHQPIRFLCDSKKMWFQF
Sbjct: 1  MMCVFLIIFFHTSEISHNIFSRNSLTCTGFTRNDDCLVLICCLHQPIRFLCDSKKMWFQF 60

Query: 61 TSKFPCICLDHLLR 74
          TSKFPCICLDHLLR
Sbjct: 61 TSKFPCICLDHLLR 74

>Kwal_14.722
          Length = 611

 Score = 26.2 bits (56), Expect = 2.8,   Method: Composition-based stats.
 Identities = 9/24 (37%), Positives = 17/24 (70%), Gaps = 5/24 (20%)

Query: 46  PIRFLCDSKKMWFQFTSKFPCICL 69
           P+R+     ++++QFT+ FPCI +
Sbjct: 182 PLRW-----RLFYQFTASFPCIII 200

>KLLA0A07293g 652702..654453 weakly similar to sgd|S0005477
           Saccharomyces cerevisiae YOL117w, hypothetical start
          Length = 583

 Score = 26.2 bits (56), Expect = 3.0,   Method: Composition-based stats.
 Identities = 9/24 (37%), Positives = 13/24 (54%)

Query: 50  LCDSKKMWFQFTSKFPCICLDHLL 73
           LC S K+W +    + CI L  L+
Sbjct: 413 LCQSNKLWKRIAPTYSCIALQDLM 436

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 25.4 bits (54), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 40  ICCLHQPIRFLCDSKKMWFQFTSKFPCICLD 70
           I C H+ + FLCDS + W+   +K+  I LD
Sbjct: 820 IPCYHEEL-FLCDSYQAWWNLLNKY-HIVLD 848

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.340    0.146    0.530 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,475,115
Number of extensions: 82625
Number of successful extensions: 243
Number of sequences better than 10.0: 5
Number of HSP's gapped: 243
Number of HSP's successfully gapped: 5
Length of query: 74
Length of database: 16,596,109
Length adjustment: 46
Effective length of query: 28
Effective length of database: 15,003,681
Effective search space: 420103068
Effective search space used: 420103068
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.9 bits)
S2: 54 (25.4 bits)