Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03905g1550152677250.0
Kwal_26.70551555153655050.0
ADR354W1558153753840.0
CAGL0F00671g1566154450600.0
Sklu_2164.51350135650470.0
YOR326W (MYO2)1574155350450.0
Scas_663.261567154949000.0
YAL029C (MYO4)1471149432500.0
Scas_592.13*1419149432480.0
CAGL0G06336g141897527510.0
Kwal_23.5534190776312911e-149
Scas_688.22187681612821e-148
YHR023W (MYO1)192885112671e-146
ACR068W180572612551e-145
KLLA0E11572g184875812311e-141
CAGL0J00693g188477112201e-139
KLLA0B12562g126075711341e-131
Kwal_26.7587125076611231e-130
YMR109W (MYO5)121976410941e-126
CAGL0K07590g125275610901e-126
Scas_721.119123272710691e-123
YKL129C (MYO3)127176610701e-123
AEL306C129275710631e-122
CAGL0K03487g121776610381e-119
KLLA0E15598g905156860.079
ABR111C78973810.30
YJR134C (SGM1)70793770.92
Kwal_55.2210649542751.7
CAGL0K06369g33083722.7
KLLA0C15851g75173732.9
Scas_683.381928140715.3
Scas_704.4444359705.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03905g
         (1526 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  2980   0.0  
Kwal_26.7055                                                         2125   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  2078   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  1953   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          1948   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  1947   0.0  
Scas_663.26                                                          1892   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1256   0.0  
Scas_592.13*                                                         1255   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1064   0.0  
Kwal_23.5534                                                          501   e-149
Scas_688.22                                                           498   e-148
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   492   e-146
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   488   e-145
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   478   e-141
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   474   e-139
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   441   e-131
Kwal_26.7587                                                          437   e-130
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   426   e-126
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   424   e-126
Scas_721.119                                                          416   e-123
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   416   e-123
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   414   e-122
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   404   e-119
KLLA0E15598g 1388626..1391343 weakly similar to sp|P38853 Saccha...    38   0.079
ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH] (59...    36   0.30 
YJR134C (SGM1) [3025] chr10 complement(673644..675767) Protein w...    34   0.92 
Kwal_55.22106                                                          33   1.7  
CAGL0K06369g 624706..625698 highly similar to tr|Q03290 Saccharo...    32   2.7  
KLLA0C15851g complement(1378324..1380579) some similarities with...    33   2.9  
Scas_683.38                                                            32   5.3  
Scas_704.44                                                            32   5.6  

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 2980 bits (7725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1453/1526 (95%), Positives = 1453/1526 (95%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60
            MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60

Query: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180
            SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVXXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD 240
            FASV           LEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD
Sbjct: 181  FASVEENNEENAHHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD 240

Query: 241  TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG 300
            TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG
Sbjct: 241  TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG 300

Query: 301  GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS 360
            GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS
Sbjct: 301  GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS 360

Query: 361  DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF 420
            DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF
Sbjct: 361  DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF 420

Query: 421  DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480
            DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE 540
            FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE
Sbjct: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE 540

Query: 541  TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET 600
            TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET
Sbjct: 541  TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET 600

Query: 601  LLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETINST 660
            LLSILETVD                   PGPASRKIVRKPTLGSMFKQSLIDLMETINST
Sbjct: 601  LLSILETVDKNAEKLAEKQAQKQESQKKPGPASRKIVRKPTLGSMFKQSLIDLMETINST 660

Query: 661  NVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHIL 720
            NVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHIL
Sbjct: 661  NVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHIL 720

Query: 721  VPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKLRTD 780
            VPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKLRTD
Sbjct: 721  VPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKLRTD 780

Query: 781  KLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLIQSA 840
            KLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLIQSA
Sbjct: 781  KLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLIQSA 840

Query: 841  YRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKSFLH 900
            YRG                   MARKQITCKELLERRRGDAAVTIQKSVRSFQPRKSFLH
Sbjct: 841  YRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKSFLH 900

Query: 901  EKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVKENK 960
            EKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVKENK
Sbjct: 901  EKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVKENK 960

Query: 961  ELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLXXXXXXXX 1020
            ELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQL        
Sbjct: 961  ELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLIAAKEEII 1020

Query: 1021 XXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVARLQS 1080
                 VDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVARLQS
Sbjct: 1021 SAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVARLQS 1080

Query: 1081 SMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDVSALMSQIND 1140
            SMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDVSALMSQIND
Sbjct: 1081 SMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDVSALMSQIND 1140

Query: 1141 ELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMWRLGLT 1200
            ELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMWRLGLT
Sbjct: 1141 ELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMWRLGLT 1200

Query: 1201 SQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDETYNSG 1260
            SQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDETYNSG
Sbjct: 1201 SQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDETYNSG 1260

Query: 1261 MNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLPGFVVPE 1320
            MNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLPGFVVPE
Sbjct: 1261 MNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLPGFVVPE 1320

Query: 1321 PSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDALCFNDL 1380
            PSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDALCFNDL
Sbjct: 1321 PSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDALCFNDL 1380

Query: 1381 ILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHIXXXXXXXXXXXRIVADIDI 1440
            ILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHI           RIVADIDI
Sbjct: 1381 ILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHILQAAKLLQLKKRIVADIDI 1440

Query: 1441 IWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKNDTSKAEVGNNDVFLPVD 1500
            IWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKNDTSKAEVGNNDVFLPVD
Sbjct: 1441 IWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKNDTSKAEVGNNDVFLPVD 1500

Query: 1501 NGPFEDPYQKVEVRAFGKIEAYIPAW 1526
            NGPFEDPYQKVEVRAFGKIEAYIPAW
Sbjct: 1501 NGPFEDPYQKVEVRAFGKIEAYIPAW 1526

>Kwal_26.7055
          Length = 1555

 Score = 2125 bits (5505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1015/1536 (66%), Positives = 1241/1536 (80%), Gaps = 17/1536 (1%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTL-QGDSYNLELTLEDGQKVELLVSSLDETKEPS 59
            M +EVGTRCWYP K +GW+G+EVTK +  +   + LEL LE+G+ VE+   +L+E++   
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLNESQNEK 60

Query: 60   LPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQL 119
            LPLLRNPPILE  EDLTSLSYLNEPAVLHAIKARY QLNIYTYSGIVLIATNPFDRV+QL
Sbjct: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120

Query: 120  YSQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMR 179
            YSQ+MIQAYAG+ RGELEPHLFAIA+EAYRLMK   QNQTI+VSGESGAGKTVSAKYIMR
Sbjct: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASVXXXXX--XXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILF 237
            YFASV             L+MSETE++ILATNPIMEAFGNAKT RNDNSSRFGKYLEILF
Sbjct: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240

Query: 238  DDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYM 297
            D+ TSIIGAR+RTYLLERSRLVFQP+ ERNYHIFYQ++ GLS+ EK +L LT ++DYHY+
Sbjct: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300

Query: 298  NQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDAS 357
             QGGD  I+GVDDA+EY  TV+AL +VG S+DTQ QLFKILAALLHIGNIEVKK RNDAS
Sbjct: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360

Query: 358  LSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYS 417
            LSSDEPNL+IA DLLGIDA  F+KW+TKKQI TRSEKIVS+L ++QA+V+RDSVAKFI+S
Sbjct: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420

Query: 418  ALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFN 477
            ALFDWLV+NINTVLCNP+V  +I +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHK 537
            QHVFKLEQEEYV EQIEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT K
Sbjct: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 538  LYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASN 597
            LY+TL+KPPTN VFSKPRFGQT+F+VSHYALDV YDV GFIEKNRDTVSDGHLEVLKAS 
Sbjct: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600

Query: 598  NETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETI 657
            N+TLLSIL+T+D                   PGPA  ++V+KPTLGSMFKQSLI+LM TI
Sbjct: 601  NDTLLSILDTID----KNAAALAEKQDANKKPGPA--RMVKKPTLGSMFKQSLIELMNTI 654

Query: 658  NSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRY 717
            +STNVHYIRCIKPNE+KEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTY EF LRY
Sbjct: 655  DSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRY 714

Query: 718  HILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKL 777
            HIL+PS+ W+ I  S+ SE+D++NLCK+IL  T+DD+ KYQ GNTKIFFKAGMLA+LEKL
Sbjct: 715  HILIPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKL 774

Query: 778  RTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLI 837
            R+ K+ +S V+IQKKIKG++YRK YL   +AI  +QA ++G   R   ++EFK  AA+ +
Sbjct: 775  RSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISL 834

Query: 838  QSAYRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKS 897
            Q+ +RG                   + RKQI  KE+LE+R+ +AAVTIQK +R F PR+S
Sbjct: 835  QTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQS 894

Query: 898  FLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVK 957
            +   +  +V IQS +R+  AQ++LKQLK++AKSVNHLQEVSYKLENKVI+LT+SLA KVK
Sbjct: 895  YNATRGSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLAEKVK 954

Query: 958  ENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLXXXXX 1017
            EN+++ +++++LQKSLNES NIKS L+ +K+ H++ L +QK+ H+ E      +L     
Sbjct: 955  ENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNAKA 1014

Query: 1018 XXXXXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVAR 1077
                    +++LL++Q+ LK ++ + +EEL + + E   S+++N+DL+ EV SLK+E+ R
Sbjct: 1015 EVEAAKKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINR 1074

Query: 1078 LQSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNF--NTEDVSALM 1135
            LQ+S+RSG      +  TP K+RRFSA+S+L D +SP+QLNV+S+NN    +    ++ +
Sbjct: 1075 LQTSIRSGANSNTILAHTPTKSRRFSAHSSLTD-ASPRQLNVISMNNGMEDDARSTASAL 1133

Query: 1136 SQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMW 1195
            SQINDELYK+ ED++SLN EI+EGLLKG K+P TGV+  LTRKEVLYP+R++II+LSDMW
Sbjct: 1134 SQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMW 1193

Query: 1196 RLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDE 1255
            RLGLT QSE+FLAE +  IQK++S LK D MI HGAFW TNVREL+SFVV+A ESI  D+
Sbjct: 1194 RLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDD 1253

Query: 1256 TYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLPG 1315
            +YNSG+NE+EY  Y+ LV ELKDDFE+LS+N+YN+W+KKL+K+LEK AV AVV+SQSLPG
Sbjct: 1254 SYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPG 1313

Query: 1316 FVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDAL 1375
            F+  E SQFL K    S+ YKMDD+LTFFNNIYW+MK+Y +E EVF +VI  LL+ +D++
Sbjct: 1314 FIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDSI 1373

Query: 1376 CFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHIXXXXXXXXXXXRIV 1435
            CFNDLI+R+NFLSWKRGLQLNYNVTR+EEWCKSHHI E + CLQH+             +
Sbjct: 1374 CFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMLQASKLLQLKKANL 1433

Query: 1436 ADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKNDTS-----KAEV 1490
             DIDIIW+IC+ LKP Q+++LITQY+VADYE PI  EIL +VA +VK+++S     K++ 
Sbjct: 1434 DDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKSESSLSSNGKSQT 1493

Query: 1491 GNNDVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPAW 1526
             + D+FLPV+NGPF+DP+  +E R FGKIEAYIPAW
Sbjct: 1494 HSIDIFLPVENGPFKDPFNLIETRRFGKIEAYIPAW 1529

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 2078 bits (5384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1000/1537 (65%), Positives = 1210/1537 (78%), Gaps = 18/1537 (1%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60
            M YEVGTRCWYP K+QGWIG E+TKH L GD Y L+LTLE+G+ VE+   S++E     L
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60

Query: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE TEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180
            SQ+MIQAYAG+ RGELEPHLFAIAEEAY LMK + QNQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVXXXX---XXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILF 237
            FA+V              +EMSETEKKILATNPIMEAFGNAKT RNDNSSRFGKYLEILF
Sbjct: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 238  DDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYM 297
            D D SIIGAR+RTYLLERSRLVFQP +ERNYHIFYQ+L+GL ++ K +LKL  +++YHYM
Sbjct: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300

Query: 298  NQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDAS 357
            NQGG S I+GVDD  EY  T +ALSLV I++ TQ  LFK+LAALLHIGNI+VKK RNDAS
Sbjct: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360

Query: 358  LSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYS 417
            +S+ +P+L+IA +LLGIDA++FAKW+TKKQI TRSEKIVS+L Y QA+V+RDSVAKFIYS
Sbjct: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420

Query: 418  ALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFN 477
            ALFDWLV+NIN VLCNP V++EI +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHK 537
            QHVFKLEQEEYVKE+I+WSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT K
Sbjct: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540

Query: 538  LYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASN 597
            LY+TL+KPPTN VFSKPRFGQT+F+VSHYA DV YDV+GFIEKNRDTVSDGHLEVLK S 
Sbjct: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600

Query: 598  NETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETI 657
            NETLL+ILET+D                   PGP +R + RKPTLGS+FKQSL++LM TI
Sbjct: 601  NETLLAILETID----RNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTI 656

Query: 658  NSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRY 717
            NSTNVHYIRCIKPNE+KEAWKFDNLMVLSQLRACGVLETIRISCAGFP+RWTY EFALRY
Sbjct: 657  NSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRY 716

Query: 718  HILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKL 777
            HILVPS  W+ I  +  +EE++  LCK IL  T+ D  KYQ GNTKIFFKAGMLA LEK 
Sbjct: 717  HILVPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKK 776

Query: 778  RTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLI 837
            RTDKL SSS MIQKKIKG++YR+ YL   +AIKR  +   G ++R R + EFK  AA+ I
Sbjct: 777  RTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITI 836

Query: 838  QSAYRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKS 897
            QS YRG                   + R+ +  KEL  R   DAA+TIQK++R+F+PR S
Sbjct: 837  QSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTS 896

Query: 898  FLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVK 957
            ++  ++ T+V+QS +R+ +A+RKL+ LK EAKSV+HL+EVSYKLENKVIELTESLA+KVK
Sbjct: 897  YITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVK 956

Query: 958  ENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLXXXXX 1017
            ENK+L SR++ LQ SLNES NI+  L+ ++E + K++  QK  H   Y +V  +L     
Sbjct: 957  ENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMK 1016

Query: 1018 XXXXXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVAR 1077
                    +D+L +KQ++LK E+ + +EEL+  R +L  S+++N+DL  EV SLKEE+AR
Sbjct: 1017 EVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIAR 1076

Query: 1078 LQSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDVSALM-- 1135
            L +++R+    G     +P +++R S+ S L++  SPKQ NVVS+NN    E+  ++M  
Sbjct: 1077 LHNAIRNAPATG---TLSPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQ 1133

Query: 1136 -SQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDM 1194
             SQINDELYK+  D R L +EI+EGLLK GK+P  G + NLTRKEVLYP+RVLIIILSDM
Sbjct: 1134 LSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDM 1193

Query: 1195 WRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTD 1254
            WRLGLT QSE FLAEVL  IQ +++NLK D +I +GAFW TNVREL+SF +YA++SI  D
Sbjct: 1194 WRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILND 1253

Query: 1255 ETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLP 1314
              Y   +NE+EY +YV LV  LKDDFE+LS+N+YN+W+KKL+K LEK AV AVV+SQSLP
Sbjct: 1254 NAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLP 1313

Query: 1315 GFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDA 1374
            GF+VPE S FL K   +SS+YKMDD+LTFFN IYW+MK+Y +E EV+ +VI +LL+ +DA
Sbjct: 1314 GFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDA 1373

Query: 1375 LCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHIXXXXXXXXXXXRI 1434
            +CFNDLI+++NFLSWKRGLQLNYNVTR+EEWCK HHI E S CL+H+             
Sbjct: 1374 ICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMLQASKLLQLKKAN 1433

Query: 1435 VADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKNDTS-----KAE 1489
            + DI+IIW+IC+ LKP Q+++LI+QYS ADYE PI  EIL +VA++VK +++     K+ 
Sbjct: 1434 MEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKESALSNDGKSA 1493

Query: 1490 VGNNDVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPAW 1526
              ++D+FLPV  G F DP+ ++E R   KIEA+IPAW
Sbjct: 1494 SHSSDIFLPVATGSFADPFSQIEPREINKIEAHIPAW 1530

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 1953 bits (5060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 957/1544 (61%), Positives = 1171/1544 (75%), Gaps = 19/1544 (1%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60
            M +EVGTRCWYPSK+ GWIGAEVTK+ L+  +Y++EL LEDG+ V +    L +  + SL
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60

Query: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE TEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180
            SQ+MIQAYAGK RGE+EPHLFAIAEEAYRLMK   +NQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVXXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD 240
            FASV           +EMSETE+KILATNPIMEAFGNAKT RNDNSSRFGKYLEILFD D
Sbjct: 181  FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240

Query: 241  TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG 300
            TSIIGA++RTYLLERSRLV+QP+TERNYHIFYQ+++GLS  EK++L L   +DY+YMNQG
Sbjct: 241  TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG 300

Query: 301  GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS 360
            GD  IEGVDD  EY  TV+AL+LVGIS +TQ  +FKILAALLHIGNIE+KK RNDASLSS
Sbjct: 301  GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS 360

Query: 361  DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF 420
            DE NL+IA +LLGID+F+FAKW+TKKQI+TRSEKIVS+L Y QA+V+RDSVAKFIYSALF
Sbjct: 361  DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420

Query: 421  DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480
            DWLV+NINTVLCNP VV ++ +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE 540
            FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT KLY+
Sbjct: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540

Query: 541  TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET 600
            TL+KPPTN+VFSKPRFGQT+F+VSHYALDV YDV+GFIEKNRDTVSDGHLEVLKAS NET
Sbjct: 541  TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LLSILETVDXXXXXXXXXXXXXXXXX-XXPGPASRKIVRKPTLGSMFKQSLIDLMETINS 659
            L++IL+T++                    PGP  R + RKPTLGSMFKQSLI+LM TI S
Sbjct: 601  LINILDTLERNANKLEDAKKAEQESKPAKPGPM-RTVQRKPTLGSMFKQSLIELMTTIRS 659

Query: 660  TNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHI 719
            TN HYIRCIKPN DKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EF LRY+I
Sbjct: 660  TNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYI 719

Query: 720  LVPSELWSNILL-SDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKLR 778
            L+P+  WS I    D +E+DV  LC +IL  T+ +  KYQ GNTKIFFKAGMLA LEKLR
Sbjct: 720  LLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLR 779

Query: 779  TDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLIQ 838
            +DK+  SSV+IQK I+  +YR+ +LR + AI  LQ  V G++ R   + EFKN AA  IQ
Sbjct: 780  SDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQ 839

Query: 839  SAYRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKSF 898
            S  RG                     RK++  K    +   DAAV IQ  VRSF+PRK+F
Sbjct: 840  SLLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAF 899

Query: 899  LHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVKE 958
            L +++ TVV+QS IR+ +AQ+KLKQLK++AKSVNHL+EVSYKLENKV+ELT++LA+KVKE
Sbjct: 900  LEDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLAAKVKE 959

Query: 959  NKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLXXXXXX 1018
            NK L +R+  LQ SL ES  ++  L++ K  H   L +QK +  E+  ++ ++L      
Sbjct: 960  NKSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQ 1019

Query: 1019 XXXXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVARL 1078
                   + +L  + +  K    S LEEL   + EL+  Q+ N+DL+ EV SLKEE++RL
Sbjct: 1020 VEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRL 1079

Query: 1079 QSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSP-KQLNVVSIN-------NNFNTED 1130
            Q+ +  G      +  TP K+     N T      P  +LNV  +N       +N   + 
Sbjct: 1080 QTQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGMDS 1139

Query: 1131 VSA---LMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVL 1187
             ++    ++QIN+EL+++ ED   LN EI +GLLK  +VP  GV + L+R++V+YP+R+L
Sbjct: 1140 YASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPARIL 1199

Query: 1188 IIILSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYA 1247
            IIILS+MWR GLT QSE FLA+VL  IQK+++ LK + +I  GAFW  NVREL+SFVV+A
Sbjct: 1200 IIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFVVFA 1259

Query: 1248 YESITTDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAV 1307
              SI T+E++ SGM ++EY  YV+LV ELK+DFE+LS+N+YN+W+KKL++ L+K AV AV
Sbjct: 1260 QHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAVNAV 1319

Query: 1308 VVSQSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITN 1367
            V+S++LPGF   +    L K   +   Y MDD+LTFFN+IYW+MKS+ IE EVF  V+T 
Sbjct: 1320 VLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKVVTT 1379

Query: 1368 LLKLLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHIXXXXXX 1427
            LL  +DA+CFNDLI+++NFLSWKRGLQLNYNVTR+EEWCK+H + + + CLQH+      
Sbjct: 1380 LLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQTSKL 1439

Query: 1428 XXXXXRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKND--- 1484
                   + DIDI+  IC+ L P QL++LITQY VADYE PI  EIL+YVA+ VK++   
Sbjct: 1440 LQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVKSEASL 1499

Query: 1485 --TSKAEVGNNDVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPAW 1526
              +SKA   +ND+F+  + GPF DP+  +E   F ++EAYIPAW
Sbjct: 1500 SASSKAPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPAW 1543

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 1948 bits (5047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 944/1356 (69%), Positives = 1116/1356 (82%), Gaps = 9/1356 (0%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60
            M YEVGTRCWYP K QGWIG E+TKHT   + + LELTLED Q VE+   +LDETK+  L
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60

Query: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE TEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRV+QLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120

Query: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180
            SQ+MIQAYAGK RGELEPHLFAIAEEAYRLMK   QNQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVXXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD 240
            FASV           LEMSETEKKILATNPIMEAFGNAKT RNDNSSRFGKYLEILFD +
Sbjct: 181  FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 240

Query: 241  TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG 300
             SIIGAR+RTYLLERSRLVFQPK+ERNYHIFYQ+L+GL+++EKSQLKLT ++DYHYMNQG
Sbjct: 241  ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG 300

Query: 301  GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS 360
            G++ I+G+DDA EY  TVEALSLVGISKDTQ+QLFKILAALLHIGN+E+KK RNDASLSS
Sbjct: 301  GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS 360

Query: 361  DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF 420
            DEPNL IA +LLGID+F+FAKW+TKKQI TRSEKIVS+L Y+QA+V+RDSVAKFIYSALF
Sbjct: 361  DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF 420

Query: 421  DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480
            +WLVDNINTVLCNPEV SEI +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE 540
            FKLEQEEYVKE+IEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT KLY+
Sbjct: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ 540

Query: 541  TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET 600
            TL+KPPTN VFSKPRFGQT+F+VSHYALDV+YDV+GFIEKNRDTVSDGHLEVLKAS NET
Sbjct: 541  TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETINST 660
            LLSILET+D                   PGPA R + RKPTLGS+FKQSLI+LM TINST
Sbjct: 601  LLSILETLD----KHAAKLAEKEQVNKKPGPA-RMVNRKPTLGSIFKQSLIELMGTINST 655

Query: 661  NVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHIL 720
            NVHYIRCIKPNE KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWTY EF LRYHIL
Sbjct: 656  NVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHIL 715

Query: 721  VPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKLRTD 780
            +PSE WS +  SD +EED+++LC+ IL   ++D  KYQ GNTKIFFKAGMLA+LEKLR+D
Sbjct: 716  IPSEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSD 775

Query: 781  KLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLIQSA 840
            +L +SSV+IQKK+K ++YRK YL  + +I+   +   G + R + + EFK  AA+LIQS 
Sbjct: 776  RLHNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSM 835

Query: 841  YRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKSFLH 900
             R                    + RKQ+  KELL+RR+ DAAV+IQK +R+F+PR+SF  
Sbjct: 836  VRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNT 895

Query: 901  EKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVKENK 960
             ++ TVV+QS +RK +AQ+KLK LK+EAKSVNHL+EVSYKLENKVI+LTESLA KVKENK
Sbjct: 896  TRRSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENK 955

Query: 961  ELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLXXXXXXXX 1020
             + +R++ LQ+SLNES NIK  L  +K+ H+K L  QK  H+ ++ +V ++L        
Sbjct: 956  GMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLVNAKKEVE 1015

Query: 1021 XXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVARLQS 1080
                 +++L+ KQ  LK E+ + +EEL  A+      Q++N+DLK EV SLK+E+ARLQ+
Sbjct: 1016 EAKEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQA 1075

Query: 1081 SMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDV---SALMSQ 1137
            ++RS       I +TP  +RRFSA+S++ DG+SP+QLNV+S+NN    +D    ++ +SQ
Sbjct: 1076 AVRS-GVTSSTITSTPTASRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQ 1134

Query: 1138 INDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMWRL 1197
            INDELYK+ ED++SLNTEI+EGLLKG K+P TGV+V LTRKEVLYP+R+LII+LSDMWRL
Sbjct: 1135 INDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRL 1194

Query: 1198 GLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDETY 1257
            GLT QSE+FLAEVL  IQK+++NLK D MI HGAFW TNVREL+SFVV+A ESI  D++Y
Sbjct: 1195 GLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSY 1254

Query: 1258 NSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLPGFV 1317
            N+G+NE+EY  YV LV ELKDDFE+LS+N+YN+W+KKL+K+LE+ A+ AVV+SQSLPGF+
Sbjct: 1255 NNGLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFI 1314

Query: 1318 VPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKS 1353
             PE S FL K    SS YKMDD++TFFNNIYW+ ++
Sbjct: 1315 APESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 1947 bits (5045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 966/1553 (62%), Positives = 1172/1553 (75%), Gaps = 28/1553 (1%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60
            M +EVGTRCWYP K+ GWIGAEV K+      Y+LEL LED + V +    L+  K+ SL
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60

Query: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE TEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180
            +Q+MIQAYAGK RGELEPHLFAIAEEAYRLMK   QNQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVXXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD 240
            FASV           +EMSETE+KILATNPIMEAFGNAKT RNDNSSRFGKYLEILFD D
Sbjct: 181  FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240

Query: 241  TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG 300
            TSIIGAR+RTYLLERSRLV+QP  ERNYHIFYQ+++GL    K +L LTD  DY YMNQG
Sbjct: 241  TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG 300

Query: 301  GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS 360
            GD+ I G+DDA EY  TV+AL+LVGI+K+TQ Q+FKILAALLHIGNIE+KK RNDASLS+
Sbjct: 301  GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA 360

Query: 361  DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF 420
            DEPNL++A +LLGIDA++FAKWVTKKQI+TRSEKIVS+L Y QA+V++DSVAKFIYSALF
Sbjct: 361  DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420

Query: 421  DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480
            DWLV+NINTVLCNP V  +I +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE 540
            FKLEQEEYVKE+IEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT KLY+
Sbjct: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540

Query: 541  TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET 600
            TL+K PTN+VFSKPRFGQT+FIVSHYALDV YDV+GFIEKNRDTVSDGHLEVLKAS NET
Sbjct: 541  TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LLSILETVDXXXXX--XXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETIN 658
            L++ILE ++                     PGP  R + RKPTLGSMFKQSLI+LM TIN
Sbjct: 601  LINILEGLEKAAKKLEEAKKLELEQAGSKKPGPI-RTVNRKPTLGSMFKQSLIELMNTIN 659

Query: 659  STNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYH 718
            STNVHYIRCIKPN DKEAW+FDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EF LRY+
Sbjct: 660  STNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYY 719

Query: 719  ILVPSELWSNIL-LSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKL 777
            IL+P E W  I    + +EED+ ++ K IL  T+ D +KYQ GNTKIFFKAGMLA+LEKL
Sbjct: 720  ILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKL 779

Query: 778  RTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLI 837
            R++K+ +S VMIQKKI+  +YRK YL+   AIK LQ N+ G IIR R  +E K N A L+
Sbjct: 780  RSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLL 839

Query: 838  QSAYRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKS 897
            Q+AYRG                     RK++  ++L +    +AAVTIQ  VR+F+PR  
Sbjct: 840  QAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSR 899

Query: 898  FLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVK 957
            FL  KK TVV+QS IR+  AQRKLKQLK++AKSVNHL+EVSYKLENKVIELT++LASKVK
Sbjct: 900  FLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVK 959

Query: 958  ENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLXXXXX 1017
            ENKE+  R++ LQ  + ES  ++ +LE  K+ H   + +QKS   E    + + L     
Sbjct: 960  ENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQ 1019

Query: 1018 XXXXXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVAR 1077
                    +++++ +   LK+E    LEEL   +  L+  Q+ N DL+ EV SLKEE+AR
Sbjct: 1020 TLKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKSLKEEIAR 1079

Query: 1078 LQSSMRSGVYVGGGINATPVKNRRFSANSTLND------GSSPKQLNV------VSINNN 1125
            LQ++M  G      +  TP+K+      S  N+        SP  LN+       S NN+
Sbjct: 1080 LQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSGNNH 1139

Query: 1126 FNTEDV----SALMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVL 1181
             ++  V        +QIN+ELY++ ED+  LN EI EGLLKG +VP  GV++ L++++V+
Sbjct: 1140 IDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRDVV 1199

Query: 1182 YPSRVLIIILSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELH 1241
            YP+R+LII+LS+MWR GLT QSE+FLA+VL  IQK+++ LK + +I  G FW  NVREL+
Sbjct: 1200 YPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELY 1259

Query: 1242 SFVVYAYESITTDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEK 1301
            SFVV+A  SI T+ET+ +GM +EEY  YV+LV ELKDDFEALS+N+YN+W+KKL+K L+K
Sbjct: 1260 SFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQKQLQK 1319

Query: 1302 IAVPAVVVSQSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVF 1361
             A+ AVV+S+SLPGF   E S FL K   N+  Y MDD+LTFFN+IYW MKS+ IE EVF
Sbjct: 1320 KAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIENEVF 1379

Query: 1362 EDVITNLLKLLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHI 1421
              V+T LL  +DA+CFN+LI+++NFLSWKRGLQLNYNVTR+EEWCK+H +++ + CLQH+
Sbjct: 1380 HAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTECLQHL 1439

Query: 1422 XXXXXXXXXXXRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKV 1481
                         + DIDI+  IC  L P QL++LI+QY VADYE PI  EIL+YVA+ V
Sbjct: 1440 IQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYVADIV 1499

Query: 1482 KNDTSKAEVGNN--------DVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPAW 1526
            K + + +  GN+         +F+  + GPF DP+  ++ R F ++EAYIPAW
Sbjct: 1500 KKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVEAYIPAW 1552

>Scas_663.26
          Length = 1567

 Score = 1892 bits (4900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 935/1549 (60%), Positives = 1168/1549 (75%), Gaps = 27/1549 (1%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60
            M +EVGTRCWYPSK+QGWIGAEVTK+ L+  +Y +ELTLED + V +    L   K+PSL
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60

Query: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDR+DQLY
Sbjct: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120

Query: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180
            SQ+MIQAY+GK RGE+EPHLFAIAEEAYRLMK   QNQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVXXXXXXXX---XXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILF 237
            FAS                EMSETE++ILATNPIMEAFGNAKT RNDNSSRFGKYLEILF
Sbjct: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 238  DDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYM 297
            D +T+IIGA++RTYLLERSRLV+QPKTERNYHIFYQIL+GL +D K +L LT   DY YM
Sbjct: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300

Query: 298  NQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDAS 357
            NQGG+  I G+DD SEYG T++AL+LVG++ +TQ  +FKILAALLHIGNIE+KK RND+S
Sbjct: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360

Query: 358  LSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYS 417
            LSSDEPNL+IA +LLG+D  +FAKW+TKKQIVTRSEKIVS+L Y QA+V+RDSVAKFIYS
Sbjct: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420

Query: 418  ALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFN 477
            ALFDWLV NINTVLCNP V+ +I++FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHK 537
            QHVFKLEQEEY+KE+IEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT K
Sbjct: 481  QHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 538  LYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASN 597
            LY+TL+KPPTN+VFSKPRFGQT+F+VSHYALDV YDV+GFIEKNRDTVSDGHLEVLKA+ 
Sbjct: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600

Query: 598  NETLLSILETVDXXXX----XXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDL 653
            N+TL +ILE+V+                       P P  R++ RKPTLGSMFK SLI+L
Sbjct: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPI-RQVQRKPTLGSMFKLSLIEL 659

Query: 654  METINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEF 713
            M+TINSTNVHYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EF
Sbjct: 660  MQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEF 719

Query: 714  ALRYHILVPSELWSNILL-SDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLA 772
             LRY+IL+P   W+ I   +D +E+DV NLCK+IL  T+ D  KYQ GNTKIFFKAGMLA
Sbjct: 720  ILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLA 779

Query: 773  HLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNN 832
            + EKLR+ K+ S+ V+IQK I+  +YRK Y+    ++  L A   G +IR R E E + +
Sbjct: 780  YFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQH 839

Query: 833  AALLIQSAYRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVRSF 892
            AA LIQ+ YRG                     R+++  +E+  +   +AA++IQ  +R+F
Sbjct: 840  AATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAF 899

Query: 893  QPRKSFLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESL 952
             PRK++  +++ T+V+QS IR+  AQR  K+LK++AKSV+HL+EVSYKLENKVI+LT++L
Sbjct: 900  VPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNL 959

Query: 953  ASKVKENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQL 1012
            A+KVKEN++L  RLE LQ ++     ++  LE +K  + KALADQK     +   + DQL
Sbjct: 960  AAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQL 1019

Query: 1013 XXXXXXXXXXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLK 1072
                         +  L  K   ++ E  + L+EL   +  L  S+++N+DL  E+ SLK
Sbjct: 1020 IKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLK 1079

Query: 1073 EEVARLQSSMRSGVYVGGG--INATPVKNRRFSAN--STLNDGSSPKQL---------NV 1119
            EE+A LQ+S+  G        +  TP +  R  +       +  SP QL         + 
Sbjct: 1080 EELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADH 1139

Query: 1120 VSINNNFNTEDV--SALMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTR 1177
            VS+N     +D+  +  ++QIN+ELY++ E +  LN EI EGLLKG +VP  GV++ L+R
Sbjct: 1140 VSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSR 1199

Query: 1178 KEVLYPSRVLIIILSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNV 1237
            ++V+YP+R+LII+LS+MWR GLT QSE+FLA+VL  IQK+++ LK   +I  GAFW  NV
Sbjct: 1200 RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANV 1259

Query: 1238 RELHSFVVYAYESITTDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRK 1297
            REL+SFVV+A  SI T+E++  GMN+EEYN YV+LV ELK+DFE+LS+N+YN+W+KKL+K
Sbjct: 1260 RELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWLKKLQK 1319

Query: 1298 NLEKIAVPAVVVSQSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIE 1357
            +L+K A+ AVVVS+SLPGF   E + FL K   +   Y MDD+LTFFNNI+W MKS+ IE
Sbjct: 1320 DLQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSFHIE 1379

Query: 1358 MEVFEDVITNLLKLLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVC 1417
             EVF  VI  LL  +D +CFNDLI+++NFLSWKRGLQLNYNVTR+EEWCK+H + + +  
Sbjct: 1380 NEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQY 1439

Query: 1418 LQHIXXXXXXXXXXXRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYV 1477
            LQH+             + DID++  IC+ L P QL++LI+QY VADYE PI  +IL+YV
Sbjct: 1440 LQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYV 1499

Query: 1478 AEKVKNDTSKAEVGNNDVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPAW 1526
            A+ VK +++ A   +ND+FL  + GPF DP+  V+ R F ++EAYIP+W
Sbjct: 1500 ADIVKKESTSA---HNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSW 1545

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1256 bits (3250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/1494 (46%), Positives = 935/1494 (62%), Gaps = 84/1494 (5%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLD-ETKEPS 59
            M +EVGT+CWYP K+QGWIG EVTK+     +++LEL LEDG+ V +  +S + +   P+
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60

Query: 60   LPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQL 119
            LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVLIA NPFD+VD L
Sbjct: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120

Query: 120  YSQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMR 179
            YS+EMIQ Y+ K + ELEPHLFAIAEEAYR M     NQT++VSGESGAGKTVSAKYIMR
Sbjct: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASVXXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDD 239
            YFASV           +EMS+ E +ILATNPIMEAFGNAKT RNDNSSRFGKYL+ILFD+
Sbjct: 181  YFASVQESNNREGE--VEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDE 238

Query: 240  DTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQ 299
            +T+I G+++RTYLLE+SRLV+QP+TERNYHIFYQIL GL +  K +L L+  +DYHY NQ
Sbjct: 239  NTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQ 298

Query: 300  GGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLS 359
            GG  +I G+D+A EY  T +ALSLVGI+ +TQ  +FKILA LLHIGNIE+K  RNDASLS
Sbjct: 299  GGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLS 358

Query: 360  SDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSAL 419
            S+E NLQIA +LLGID F+FAKW+ KKQIVTRSEKIV++L Y+QA+++RDSVAKFIYS L
Sbjct: 359  SEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTL 418

Query: 420  FDWLVDNINTVLCNPEVVSE--IYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFN 477
            FDWLVDNIN  L +PE+  +  +++FIG+LDIYGFEHF+KNSFEQFCINYANEKLQQEFN
Sbjct: 419  FDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFN 478

Query: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHK 537
            QHVFKLEQEEYVKE+IEWSFIEF+DNQPCIDLIENK+GILSLLDEESRLP+G+DE W  K
Sbjct: 479  QHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASK 538

Query: 538  LYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASN 597
            LY   NKPP+NEVFSKPRFGQT+FIVSHYA+DV Y+V+GFIEKNRD+VS GHL+V KA+ 
Sbjct: 539  LYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATT 598

Query: 598  NETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETI 657
            N     IL+  +                   P   S+K   KPTLGSMFK+SL +LM  I
Sbjct: 599  NPIFKQILDNRE-LRSDDAPEEQNTEKKIMIPARLSQK---KPTLGSMFKKSLGELMAII 654

Query: 658  NSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRY 717
            NSTNVHYIRCIKPN +K+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EF  RY
Sbjct: 655  NSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRY 714

Query: 718  HILVPSELWSNILLS-DPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEK 776
             +L    LWS IL + D  +E + N C+ IL  T+ D+AKYQ GNTKIFFKAGMLA LEK
Sbjct: 715  FLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEK 774

Query: 777  LRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALL 836
            LRT+K+    ++IQKKI+  +YR  YL+T+++IK+ Q+ +   ++R R ++E K  AA+L
Sbjct: 775  LRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAIL 834

Query: 837  IQSAYRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVRSFQPRK 896
            +Q+  R                      ++++    +  +    AAV IQ  +RS+  + 
Sbjct: 835  LQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKT 894

Query: 897  SFLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKV 956
             +   K+ ++++QS +R   A+R+   L+ E +  N        L  + IE   S    +
Sbjct: 895  DYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSFILNL 954

Query: 957  KENKELVSRLENLQKSLNESENIKSSLEEEKE----GHTKALADQKSIHEEEYGKVNDQL 1012
            +   +  +RL  L +   +  NI S   +E E    G+   ++  K++  E    +N + 
Sbjct: 955  EMLNDSYTRLTQLLQG--DLSNIPSKQRQEYETIVNGYNDKISKLKTLQVEIMNTLNKK- 1011

Query: 1013 XXXXXXXXXXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLK 1072
                          + L  ++K     I S ++ L + +       ++ + L  EV S+K
Sbjct: 1012 --------------NALKERKKKQSSLIQSHMQSLAAIKG------NKPSRLSDEVKSMK 1051

Query: 1073 EEVARLQSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDVS 1132
            +E+A +++ +          N    KN +            PK +NV+   +        
Sbjct: 1052 QELAFIENVIAQDFTTTYSAN----KNDKVKGLGIAGQQVKPKLVNVIRRESG------- 1100

Query: 1133 ALMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILS 1192
                  N +L ++  D      E+ EG LK  KV  T V+ +     VL P  V+  ++S
Sbjct: 1101 ------NPDLLELLMDLNCYTLEVTEGYLK--KVNVTEVNGD----NVLGPIHVITTVVS 1148

Query: 1193 DMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESIT 1252
             + R GL  QS  F+++VL  ++ I+ +L  D  +  G FW +N+  L +F         
Sbjct: 1149 SLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWLSNLSRLPAFAA------N 1202

Query: 1253 TDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLE-KIAVPAVVVSQ 1311
                Y +   +E+    +  + +L+++   +   +Y+ W+ K  K+    I +  +V++ 
Sbjct: 1203 QKTLYEANGGDEKDKLTLIYLNDLENETLKVFDKIYSTWLVKFMKHASAHIEIFDMVLN- 1261

Query: 1312 SLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKL 1371
                          +K  +NS   K   + TF N     +  + +   +   +  + LK 
Sbjct: 1262 --------------EKLFKNSGDEKFAKLFTFLNEFDAVLCKFQVVDSMHTKIFNDTLKY 1307

Query: 1372 LDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHIXXXXXXXXXX 1431
            L+ + FNDLI +   L+WK G +++ N+ R+  W +   I +V   L  I          
Sbjct: 1308 LNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEP-RIEDVRPNLIQIIQAVKILQLK 1366

Query: 1432 XRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAP-EILQYVAEKVKND 1484
               + +  +++D    L P Q++ ++ +Y  A+  E   P EIL Y+A  +K +
Sbjct: 1367 ISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNEILNYLANVIKRE 1420

>Scas_592.13*
          Length = 1419

 Score = 1255 bits (3248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/1494 (45%), Positives = 918/1494 (61%), Gaps = 146/1494 (9%)

Query: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLD-----ET 55
            M +EVGTRCWYP+ + GWIG EVTK+  Q  +Y++ELT E G  + +    L+     E 
Sbjct: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 56   KEPSLPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115
                LP+LRNPPILE T DLT+LSYLNEPAVLHAIK RY Q NIYTYSGIVLIATNPFD+
Sbjct: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 116  VDQLYSQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAK 175
            V++LYS EMIQAYA K R E+ PH+FAIAEEAYR M   DQNQTIIVSGESGAGKTVSAK
Sbjct: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180

Query: 176  YIMRYFASVXXXXXXX---XXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKY 232
            YIMR+FASV               EMS+ E KILATNP+MEAFGNAKT RNDNSSRFGKY
Sbjct: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240

Query: 233  LEILFDDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQ 292
            L+ILFD + +IIG+ ++TYLLERSRLVFQP +ERNYHIFYQ+LSGLS D K QL LT+ +
Sbjct: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300

Query: 293  DYHYMNQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKV 352
            D+ Y+NQGG+S I G+DD+ EY  T+E+LS VGI  + Q Q+FKILAALLHIGNIE+KK 
Sbjct: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360

Query: 353  RNDASLSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVA 412
            R DA+LSS +P+LQ A +LLG+D   F+KW+TKKQI TRSEKI+S+L ++QA+V+RDSVA
Sbjct: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420

Query: 413  KFIYSALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKL 472
            KFIYS+LFDWLV NIN VLC  +V   I +FIGVLDIYGFEHF++NSFEQFCINYANEKL
Sbjct: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480

Query: 473  QQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDE 532
            QQEFN HVFKLEQEEYVKE+IEWSFIEF+DNQPCIDLIENK+GILSLLDEESRLPAG+DE
Sbjct: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540

Query: 533  GWTHKLYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEV 592
             WT KLY+T NKPP+N VF KPRFGQ +FI+SHYA+DVTY+VDGFIEKN+DT+S+  LEV
Sbjct: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600

Query: 593  LKASNNETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIV-RKPTLGSMFKQSLI 651
            LKA+ N TL +I E  +                    G   RK + RKPTLGS+FK+SL+
Sbjct: 601  LKATTNPTLATIFEFSE---------AENKTNITEQAGTIQRKTINRKPTLGSIFKRSLV 651

Query: 652  DLMETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYT 711
            +LMETINSTNVHYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETI+ISCAGFPSRW + 
Sbjct: 652  ELMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFE 711

Query: 712  EFALRYHILVPSELWSNILLS-DPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGM 770
            EF  RY++L P++ W  +    + S ED+   C  IL   +D   KYQ G TKIFFKAG+
Sbjct: 712  EFIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGV 771

Query: 771  LAHLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFK 830
            LA+LEK+R+DK+   +V+IQK I+  +YR  YL+ + +IK  Q+ + G   R R + E K
Sbjct: 772  LAYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMK 831

Query: 831  NNAALLIQSAYRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKSVR 890
             +AA L+Q+ +R                      R+ +    +       +A+ IQ  +R
Sbjct: 832  TDAATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIR 891

Query: 891  SFQPRKSFLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTE 950
            +  P+  +   K GT++IQ+ +R+  +Q KLKQLK +A+S   L+  +  ++ ++I   E
Sbjct: 892  ANSPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIE 951

Query: 951  SLASKVKENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVND 1010
             L S +KEN    +  ++L K         +SL      + +  A   + ++ E  KV  
Sbjct: 952  ELISNIKENDAKTTEYKSLLK--------HTSLPVVTGTNERTAAYISTKNQVEEDKVT- 1002

Query: 1011 QLXXXXXXXXXXXXXVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFS 1070
                           +  +L K + LKD     L+ L S  ++ +  +   + L+  +  
Sbjct: 1003 ---------------IRTILTKYETLKDLCRKELKSLESL-EKGVNDEKFASSLQSSLEL 1046

Query: 1071 LKEEVARLQSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTED 1130
            +K +++ L+            INA    N R S +S L DG+      VV I      + 
Sbjct: 1047 IKRDISDLR------------INAIEKDNERTSTSSELKDGTDCTDNAVVQILTKRQGDL 1094

Query: 1131 VSALMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIII 1190
            ++ L++ +  E                       ++P  G + +    E  YP ++LI I
Sbjct: 1095 INDLVNVVFLEF----------------------QIPQRGRTKDC---EHFYPVKLLISI 1129

Query: 1191 LSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYES 1250
            ++ M + GL   S + L + +  +   IS++     +  G +W  ++ +L          
Sbjct: 1130 VNLMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKL---------- 1179

Query: 1251 ITTDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVS 1310
                    S + +E       ++ +L+D F       Y  W+K+    ++ +        
Sbjct: 1180 --------SSLPQEPA-----VLNKLQDKF-------YKTWLKQCFNQMKTV-------- 1211

Query: 1311 QSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLK 1370
                                       D +L  F+ I      +    E+  ++IT LL+
Sbjct: 1212 ---------------------------DSILILFDTISEFTLFFQGTTELLTNIITALLQ 1244

Query: 1371 LLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHIXXXXXXXXX 1430
             ++A  FNDL++++N LSW  GL+ +  + ++ +WC SH I   +  L+++         
Sbjct: 1245 HINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQL 1304

Query: 1431 XXRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKND 1484
                ++D  ++ + C  L  +Q+  L+T+Y    +E+PI  ++L +++   + +
Sbjct: 1305 RISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTARRE 1358

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
           cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
           cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1064 bits (2751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/975 (55%), Positives = 700/975 (71%), Gaps = 33/975 (3%)

Query: 1   MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPS- 59
           M +EVGTRCWYPS++ GWI  EV+K+  +   Y+L+ TLEDG  ++L   S+D     S 
Sbjct: 1   MTFEVGTRCWYPSEN-GWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59

Query: 60  ----LPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDR 115
               +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF +
Sbjct: 60  EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119

Query: 116 VDQLYSQEMIQAYAG-KLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSA 174
           +++LYS +MI+ Y+    R EL+PHLFAIA +AY  M +  +NQTI+VSGESGAGKTVSA
Sbjct: 120 MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179

Query: 175 KYIMRYFASVXXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLE 234
           KYIMRYFAS+            EMS+ EKKILATNPIMEAFGNAKTIRNDNSSRFGKYL+
Sbjct: 180 KYIMRYFASLDDNNAAVVS---EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQ 236

Query: 235 ILFDDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDY 294
           I+FD   +IIGA++RTYLLERSRLVFQ ++ERNYHIFYQ+L+GL    K +L +++ + +
Sbjct: 237 IMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQF 296

Query: 295 HYMNQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRN 354
           +Y+NQG D  I+GVDDA E+ DT+ ALS++GI+   Q ++FKILA LLHIGNIE+K+   
Sbjct: 297 YYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQSST 356

Query: 355 DASLSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKF 414
            +S+S DEPNL++A +LLG+D ++F+KW+TKK+I TRSEKIV++L   QA+V RDSV+KF
Sbjct: 357 SSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKF 416

Query: 415 IYSALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQ 474
           IYS LFDWLV+ INT+L   EV  ++ +FIGVLDIYGFEHF+ NSFEQFCINYANEKLQQ
Sbjct: 417 IYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQ 476

Query: 475 EFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGW 534
           EFNQHVFKLEQEEYV+E+IEWSFIEFNDNQPCIDLIEN++GILSLLDEESRLP+GTDE W
Sbjct: 477 EFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESW 536

Query: 535 THKLYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLK 594
           T KLY+TL+KPP N+VFSKP+FGQT+F++SHYA +V YDV+GFIEKNRDTVS+  + VLK
Sbjct: 537 TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596

Query: 595 ASNNETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVR------KPTLGSMFKQ 648
            S N+TL+S+ +  +                   P P +  I R      KPTLG MFK+
Sbjct: 597 NSQNDTLISLTKPTE---------------ETSTPPPQTASISRPKLINKKPTLGFMFKK 641

Query: 649 SLIDLMETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRW 708
           SL +LME IN+TNVHYIRC+KPN  K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSRW
Sbjct: 642 SLGELMEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRW 701

Query: 709 TYTEFALRYHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKA 768
           ++ EF  RY++LV + LWS++  S+ + E     CKEIL  T     K Q G TKIFFK+
Sbjct: 702 SFQEFIDRYYMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKS 761

Query: 769 GMLAHLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENE 828
           G+LA LE LR  K+   ++ IQKKI+    R  YL  V+ ++ LQ  +  K++RL  E++
Sbjct: 762 GVLAELESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQ 821

Query: 829 FKNNAALLIQSAYRGXXXXXXXXXXXXXXXXXXXMARKQITCKELLERRRGDAAVTIQKS 888
            K   AL++Q+  R                      R  +  + L E +R  A++ IQ  
Sbjct: 822 LKTKLALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSY 881

Query: 889 VRSFQPRKSFLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSY-KLENKVIE 947
           +R ++ +  + + +K    IQ+  R   A+  + +L+SE++ V  +  V+Y +L + V +
Sbjct: 882 IRGYKHKTQYRYFRKNYQAIQALSRSMLARSLMLKLRSESE-VTQINGVTYTELHSIVKD 940

Query: 948 LTESLASKVKENKEL 962
           + +S+ S  +  KEL
Sbjct: 941 IHDSMTSNNQIIKEL 955

>Kwal_23.5534
          Length = 1907

 Score =  501 bits (1291), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 300/763 (39%), Positives = 444/763 (58%), Gaps = 68/763 (8%)

Query: 65  NPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEM 124
           NP   +  +D++ L++LNEP+VLH ++ RYA  NIYTYSG+ L+A NP+  + ++YSQ+ 
Sbjct: 55  NPSTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNI-RIYSQDY 113

Query: 125 IQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASV 184
           +  Y G  + + +PH+FAIAEEAY+ + +  ++Q+I+V+GESGAGKT + K I++Y AS+
Sbjct: 114 VNLYHGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASI 173

Query: 185 XXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSII 244
                       E    E+KIL +NPI+E+FGNA+T+RN+NSSRFGK+++I FD+   I 
Sbjct: 174 TSDDKLSPDTSQES--FERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELGKIN 231

Query: 245 GARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDE--KSQLKLTDIQDYHYMNQGGD 302
           GA V  YLLE+SR++ Q   ERNYHIFYQ+LSG+S  E  +  L+   I+DY Y+     
Sbjct: 232 GAHVDWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYLRNSNP 291

Query: 303 SHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSSDE 362
           S I GVDD+ ++   + +  +VG S+D    +   ++ +LHIGNIE   V   A  +S +
Sbjct: 292 S-IPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEF--VSERAEQASFD 348

Query: 363 PNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALFDW 422
            +++   +LLG+   DF   V K +     + +  +   HQA    +S+++ +Y  LF  
Sbjct: 349 GSVETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENLFAH 408

Query: 423 LVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVFK 482
           +V  IN  L +  +      +IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F 
Sbjct: 409 IVQRINNNLDHGSMTE---NYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHMFV 465

Query: 483 LEQEEYVKEQIEWSFIEFN-DNQPCIDLIE---NKVGILSLLDEESRLPAGTDEGWTHKL 538
           LEQ EY+KE ++W+FI++  D Q  IDLIE    K GIL LLDEES LP  TDE +  KL
Sbjct: 466 LEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFYSKL 525

Query: 539 YETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNN 598
            ET     +++        Q  F++ HYA DV Y+VDG++ KN+D + +  L++L  S+N
Sbjct: 526 -ETFYSDKSSKFKRSK--KQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSNSSN 582

Query: 599 ETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLI------- 651
           E +                            G  S K  R    GS FK + I       
Sbjct: 583 ELI---------------------------RGFYSEKDSR----GSSFKTTSIRHRDQLK 611

Query: 652 DLMETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYT 711
            L++ ++ST  H++RCI PN+ K+A  F+  ++L QLR  GVLE IRI+  G+P+R  + 
Sbjct: 612 SLLDRLSSTEPHFVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFFK 671

Query: 712 EFALRYHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGML 771
           EF  RY IL     +SN           K  C+ +L     D + ++ GN+K+FFKAG+L
Sbjct: 672 EFFQRYKILSDEYRFSNT---------SKKNCEIVLSSLRLDPSVFKVGNSKLFFKAGVL 722

Query: 772 AHLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQA 814
           A LE  +  ++   +  +  +I G   R++   T   +K+LQA
Sbjct: 723 ASLEAKKEGRISDMASKLNARINGNAVRRS---TSQKLKKLQA 762

>Scas_688.22
          Length = 1876

 Score =  498 bits (1282), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 295/816 (36%), Positives = 470/816 (57%), Gaps = 75/816 (9%)

Query: 9   CWYPSKDQGWIGAEVTK-HTLQGDSYNLE------LTLEDGQKVELLVSSLDETKEPSLP 61
            W P  D+ +  AEV +  +++    N+E        +E G+++++  S+L     PS  
Sbjct: 8   VWIPDPDKIFTLAEVARIESVKNARTNVEEEMATVRIMETGEELQIEKSNLS----PS-- 61

Query: 62  LLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYS 121
              NP   +  ++++ L++LNE +VLH ++ RY    IYTYSG+ L+A NP+  + ++Y+
Sbjct: 62  ---NPTSFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNI-KIYT 117

Query: 122 QEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYF 181
           QE I  Y G  + + +PH++AIAEEAY+ + T  Q+Q+++V+GESGAGKT + K I++Y 
Sbjct: 118 QEYINLYNGSSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYL 177

Query: 182 ASVXXXXXXXXXXXLEMSET----------EKKILATNPIMEAFGNAKTIRNDNSSRFGK 231
           AS+           L +S+           E KIL +NPI+E+FGNA+T+RN+NSSRFGK
Sbjct: 178 ASITSNKSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGK 237

Query: 232 YLEILFDDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLT-- 289
           +++I FD+   I GA +  YLLE+SR++ Q   ERNYHIFYQ+L+GLS  E  +L+LT  
Sbjct: 238 FIKIEFDERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSK 297

Query: 290 DIQDYHYMNQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEV 349
            + DY Y+++   S I GV+DA ++ D ++A + VG + +    ++++L+ +LHIGN++ 
Sbjct: 298 SVSDYKYLSKSNPS-IPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDF 356

Query: 350 KKVRNDASLSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRD 409
              ++  +   ++P+    A LLG+   +F   V   +     E +  S    QA    +
Sbjct: 357 TSEKSQQATFKNDPS--TLAKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFILN 414

Query: 410 SVAKFIYSALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYAN 469
           S+++ +Y  LF ++V+ IN  L +  + +    +IG+LDI GFE F+ NSFEQ CINY N
Sbjct: 415 SLSRTLYEKLFSFIVERINNSLDHSSMTA---NYIGLLDIAGFEIFKHNSFEQLCINYTN 471

Query: 470 EKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFN-DNQPCIDLIENK---VGILSLLDEESR 525
           EKLQQ FN H+F LEQ EY+KE I+W+F++F  D Q  IDLIENK    G+L LLDEES 
Sbjct: 472 EKLQQFFNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEESI 531

Query: 526 LPAGTDEGWTHKLYETLN-KPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDT 584
           LP  +D+ +  KL  T + K P    F + +  Q  F++ HYA +V Y+++G++ KN+D 
Sbjct: 532 LPNSSDDSFFSKLISTWDQKSPK---FIRSKLPQC-FVLKHYAGEVEYNIEGWLSKNKDP 587

Query: 585 VSDGHLEVLKASNNETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGS 644
           +S+  + +L +S NE + S     +                    G + R      T  +
Sbjct: 588 LSECMISMLSSSTNEIVTSFFNESNKNVR----------------GSSFR------TASA 625

Query: 645 MFKQSLIDLMETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGF 704
             ++  + L++ + +T+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+
Sbjct: 626 RHREQQMLLLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIRIAREGY 685

Query: 705 PSRWTYTEFALRYHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKI 764
           P+R  + EF  RY +L     ++            K  C+ +L     D + Y+ G +K+
Sbjct: 686 PNRIFFKEFFQRYRLLSDENHFAT---------GFKKNCEILLSSLHLDPSLYKIGTSKL 736

Query: 765 FFKAGMLAHLEKLRTDKLFSSSVMIQKKIKGLHYRK 800
           FFKAG+LA LE  +  ++ S  +     ++G   RK
Sbjct: 737 FFKAGVLAELETKKDQRIRSIVIRFNSHLRGRIIRK 772

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  492 bits (1267), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 311/851 (36%), Positives = 473/851 (55%), Gaps = 66/851 (7%)

Query: 9   CWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVEL-LVSSLDETKEPSLPLLR--- 64
            W P + + ++  E+    +  + +        GQ+ ++ +V  LD T+  +L  +R   
Sbjct: 13  VWIPDEKEVFVKGELMSTDINKNKFT-------GQEEQIGIVHPLDSTEVSNLVQVRISD 65

Query: 65  ----NPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120
               NP   +  E+++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  ++ LY
Sbjct: 66  VFPVNPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN-LY 124

Query: 121 SQEMIQAYAGK------------LRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGA 168
           S++ I  Y  K               +L PH+FAIAEEAY  + +  ++Q+I+V+GESGA
Sbjct: 125 SEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGA 184

Query: 169 GKTVSAKYIMRYFASVXXXXXXXXXXXLEMS---ETEKKILATNPIMEAFGNAKTIRNDN 225
           GKT + K I++Y AS+              S     E KIL +NPI+E+FGNA+T+RN+N
Sbjct: 185 GKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNN 244

Query: 226 SSRFGKYLEILFDDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQ 285
           SSRFGK+++I F++   I GA +  YLLE+SR+V Q   ERNYHIFYQ+LSGL D E   
Sbjct: 245 SSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKN 304

Query: 286 LKLT--DIQDYHYMNQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLH 343
           L+L   +++DY  ++      I G++D   + + + AL+++G SKD    +F+++A +L 
Sbjct: 305 LRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILL 364

Query: 344 IGNIEVKKVRNDASLSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQ 403
           IGNIE   V + A  +S + ++      LG+D  DF   + + +     E +  S    Q
Sbjct: 365 IGNIEF--VSDRAEQASFKNDVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQ 422

Query: 404 AIVSRDSVAKFIYSALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQF 463
           A    +++++ +Y  LF ++VD IN    N +  S    +IG+LDI GFE F+ NSFEQ 
Sbjct: 423 AKFILNALSRNLYERLFGYIVDMINK---NLDHGSATLNYIGLLDIAGFEIFENNSFEQL 479

Query: 464 CINYANEKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFN-DNQPCIDLIENK---VGILSL 519
           CINY NEKLQQ FN H+F LEQ EY+KE I+W +I++  D Q  IDLIE+K    G+L L
Sbjct: 480 CINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPL 539

Query: 520 LDEESRLPAGTDEGWTHKLYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIE 579
           LDEE+ LP  TDE +  KL  T ++  +   F + R  +  FI+ HYA DV Y V+G++ 
Sbjct: 540 LDEEAVLPKSTDESFYSKLISTWDQNSSK--FKRSRL-KNGFILKHYAGDVEYTVEGWLS 596

Query: 580 KNRDTVSDGHLEVLKASNNETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRK 639
           KN+D ++D  L +L +S N+ +  + +                          S + V+K
Sbjct: 597 KNKDPLNDNLLSLLSSSQNDIISKLFQP-----------EGEKSSSAGVEANISNQEVKK 645

Query: 640 PTLGSMFK-------QSLIDLMETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACG 692
               S FK       +  I L+  + ST+ H++RCI PN  K+   F+  ++L QLR  G
Sbjct: 646 SARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNG 705

Query: 693 VLETIRISCAGFPSRWTYTEFALRYHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMD 752
           VLE IR++  G+P+R  + EF  RY IL P E  +    S   +   K  C+ +L     
Sbjct: 706 VLEGIRLAREGYPNRIAFQEFFQRYRILYP-ENSTTTTFSSKLKASTKQNCEFLLTSLQL 764

Query: 753 DTAKYQAGNTKIFFKAGMLAHLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRL 812
           DT  Y+ GNTK+FFKAG+LA LEK +  KL +  + +   I+G   RK     +  +K+ 
Sbjct: 765 DTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKT 824

Query: 813 QANVSGKIIRL 823
           +  V G   RL
Sbjct: 825 R--VIGNTFRL 833

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  488 bits (1255), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 288/726 (39%), Positives = 425/726 (58%), Gaps = 57/726 (7%)

Query: 65  NPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEM 124
           NP   +  +D++ L++LNE +VL+ ++ RY    IYTYSG+ L+A NP+  + ++Y+Q+ 
Sbjct: 59  NPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLVALNPYSNI-KVYTQDY 117

Query: 125 IQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASV 184
           +  Y G  + + EPH+FA+AE+AYR + T  Q+Q+++V+GESGAGKT + K I++Y AS+
Sbjct: 118 VNLYHGSPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYLASI 177

Query: 185 XXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSII 244
                        +   E+KIL  NPI+E+FGNA+T+RN+NSSRFGK+++I FD+   I 
Sbjct: 178 TSDEKLAHTN---LESFERKILQANPILESFGNAQTVRNNNSSRFGKFIKIEFDEFGKIN 234

Query: 245 GARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKL--TDIQDYHYMNQGGD 302
           GA +  YLLE+SR++ Q   ERNYH+FYQ+LSG+   +   L+L    I DY Y+     
Sbjct: 235 GAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLELVSNSITDYAYLRDSNP 294

Query: 303 SHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRND-ASLSSD 361
           S I GVDDA ++   + A ++VG  +D    +F+ +A +LHIGN+E    R + A++ +D
Sbjct: 295 S-IPGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILHIGNVEFTSTRAEQATIKND 353

Query: 362 EPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALFD 421
              L     L+G+D   F   V K +     E +  S    Q+    +S+++ +Y  LF 
Sbjct: 354 VAPL---CKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLYEKLFA 410

Query: 422 WLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVF 481
            +V  IN  L +  +      +IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F
Sbjct: 411 HIVRRINRSLDHGSMTE---NYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHHMF 467

Query: 482 KLEQEEYVKEQIEWSFIEFN-DNQPCIDLIE---NKVGILSLLDEESRLPAGTDEGWTHK 537
            LEQ EYVKE I+W FI++  D +  I+LIE   N  GILS+LDEES LP  TDE +  K
Sbjct: 468 VLEQREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILSILDEESILPKSTDESFYSK 527

Query: 538 LYETLN-KPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKAS 596
           L    + K P    F + +  Q  F++ HYA DV Y+V  ++ KN+D ++D  L +L  S
Sbjct: 528 LMSAWDGKSPK---FKRSKLQQC-FVLEHYAADVEYNVKDWLSKNKDPLNDHLLTLLSES 583

Query: 597 NNETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMET 656
           +N+ L+S   T                      G  S+      T  +  K+ L  L++ 
Sbjct: 584 SNK-LISEFYT------------------EQSRGHFSK------TASNRHKEQLTLLLDQ 618

Query: 657 INSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALR 716
           ++ST+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P+R  + EF  R
Sbjct: 619 LSSTDPHFVRCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQR 678

Query: 717 YHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEK 776
           Y IL     +SN         + K  C+ +L     D + Y+ GNTK+FFKAG+LA LE 
Sbjct: 679 YKILGADPKFSN---------NSKKNCEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLET 729

Query: 777 LRTDKL 782
            + +K+
Sbjct: 730 QKEEKI 735

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  478 bits (1231), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 294/758 (38%), Positives = 430/758 (56%), Gaps = 58/758 (7%)

Query: 65  NPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEM 124
           NP   +  +DL+ L++LNE +VL  ++ RY    IYTYSG+ L+A NP+  + ++YS   
Sbjct: 59  NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNI-KIYSNSY 117

Query: 125 IQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASV 184
           I+ Y G  + + +PH+FA+AE+AY+ +    Q+Q+I+V+GESGAGKT + K I++Y AS+
Sbjct: 118 IKLYHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLASI 177

Query: 185 XXXXXXXXXXXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSII 244
                       E    E+KIL +NPI+E+FGNA+T+RN+NSSRFGK+++I FD+   I 
Sbjct: 178 TTDDKILLNQTNE--SFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFDEYGKIN 235

Query: 245 GARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKL--TDIQDYHYMNQGGD 302
           GA +  YLLE+SR++     ERNYHIFYQILSG+S  E   + L    I DY Y+     
Sbjct: 236 GAHIEWYLLEKSRVIQAHARERNYHIFYQILSGMSKQELRAIGLESNSIVDYQYLRHSNP 295

Query: 303 SHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRND-ASLSSD 361
           S I G+DD   Y + V A   VG +KD    + K ++ +LHIGN+E    R++ AS+ +D
Sbjct: 296 S-IPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSERSEQASIKND 354

Query: 362 EPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALFD 421
              ++    LLG+   DF   V K +     E +  +    QA    +S+++ +Y  LF+
Sbjct: 355 ---IKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSLYEKLFE 411

Query: 422 WLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVF 481
           ++V+ IN  L   E  S    FIG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F
Sbjct: 412 YIVNQINKSL---EHGSMTEYFIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHHMF 468

Query: 482 KLEQEEYVKEQIEWSFIEFN-DNQPCIDLIENK----VGILSLLDEESRLPAGTDEGWTH 536
            LEQ EY KE I+W+FI++  D Q  IDLIE K     GIL +L+EES LP  +D  +  
Sbjct: 469 VLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSSDASFYS 528

Query: 537 KLYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKAS 596
           KL  + +   T   F + +     FI+ HYA DV Y+V  ++ KN+D +++  L+VL   
Sbjct: 529 KLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVEYNVTDWLSKNKDPLNENLLQVLNDC 585

Query: 597 NNETLLSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMET 656
            N  +                            G + R      T  +  ++ L  L+E 
Sbjct: 586 ANPLVSQFF-------------------ADRIRGSSFR------TSSNKHREQLHTLIEQ 620

Query: 657 INSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALR 716
           + +T+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P+R  + EF  R
Sbjct: 621 LGNTDPHFVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIARDGYPNRIFFKEFFQR 680

Query: 717 YHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEK 776
           Y IL     ++N         + K  C+ +L     D   Y+ GNTK+FFKAG+LA+LE 
Sbjct: 681 YKILSDECRFTN---------NSKKNCEILLSSLHLDPTIYKVGNTKLFFKAGVLANLEL 731

Query: 777 LRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQA 814
           L+  +L ++   +   I     RK  +R+   +K+LQA
Sbjct: 732 LKEQRLSAAVTRLNAIISANSVRKE-IRS--HLKKLQA 766

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  474 bits (1220), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 293/771 (38%), Positives = 431/771 (55%), Gaps = 40/771 (5%)

Query: 65  NPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEM 124
           NP   +  ++++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LYS   
Sbjct: 61  NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLYSNST 120

Query: 125 IQAY-AGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFAS 183
           I++Y +       +PH+F +AE AYR +K+  Q+Q+I+V+GESGAGKT + K I++Y AS
Sbjct: 121 IKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQYLAS 180

Query: 184 VXXXXXXXXXXXLEMSET-EKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTS 242
           +            E+S   E KIL +NP++E+FGNA+T+RN+NSSRFGK+++I FD    
Sbjct: 181 ITSDS-------FEVSNNFEMKILQSNPVLESFGNAQTVRNNNSSRFGKFIKIEFDQSGK 233

Query: 243 IIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSD-DEKSQLKLTDIQDYHYMNQGG 301
           I GA +  YLLE+SR+  + + ERNYHIFYQ+L G S  D +S  KL+     HY     
Sbjct: 234 INGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAHYQILAN 293

Query: 302 DSH-IEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIE-VKKVRNDASLS 359
            +H I GVDDA+E+   + AL  VG  KD    +FKI+A +LH GNIE V +    AS  
Sbjct: 294 SNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKSEQASFK 353

Query: 360 SDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSAL 419
           SD   +   A LLG+   DF   + K +     E +  +   +QA    +S+ + +Y  L
Sbjct: 354 SD---ISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRTLYEHL 410

Query: 420 FDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQH 479
           F ++VD IN  L +  + +    +IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H
Sbjct: 411 FGYIVDTINMSLNHGSMTA---NYIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQFFNHH 467

Query: 480 VFKLEQEEYVKEQIEWSFIEFN-DNQPCIDLIENK---VGILSLLDEESRLPAGTDEGWT 535
           +F LEQ EY+KE I+W ++++  D Q  I+L+E K    GIL LLDEE+ LP   D  + 
Sbjct: 468 MFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSEDSSFY 527

Query: 536 HKLYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKA 595
            KL  T  +  T   F + +     F++ HYA DV Y V+G++ KN+D +++  + +L  
Sbjct: 528 SKLISTWQQNSTK--FKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLNENLVNILSV 584

Query: 596 SNNETL---LSILETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLID 652
           S+N  +    S  E++                         R  ++  T  S  ++    
Sbjct: 585 SSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLK--TALSRHREQQSS 642

Query: 653 LMETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTE 712
           L+  +  TN H++RCI PN  K +  FD  ++L QLR  GVLE IRI+  G+P+R  + E
Sbjct: 643 LLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGYPNRILFKE 702

Query: 713 FALRYHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLA 772
           F  RY IL      S  L       + K   + ++     D   Y+ G +K+FFKAG LA
Sbjct: 703 FYERYRIL------SEHLDKSSDAINYKQSSQILISELHLDPTTYKVGTSKLFFKAGTLA 756

Query: 773 HLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQAN-VSGKIIR 822
            LE  +   LF  +V     I+G   RK   RT   I++++A+ + G + R
Sbjct: 757 ELESKKESILFEITVRFNSIIRGWSQRK---RTKGEIQKMRASEMIGNVFR 804

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  441 bits (1134), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 273/757 (36%), Positives = 415/757 (54%), Gaps = 57/757 (7%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEMIQAYAGKLR 133
           DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y GK R
Sbjct: 38  DLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPF-RDLGIYTDAVLESYKGKNR 96

Query: 134 GELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASVXXXXXXXXX 193
            E+ PH+FAIAE  Y  +K  ++NQ +I+SGESGAGKT +AK IM+Y A+          
Sbjct: 97  LEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHEASIG 156

Query: 194 XXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLL 253
              +M      +LATNP++E+FG AKT+RN+NSSR GKYLEI F++       ++  YLL
Sbjct: 157 KIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQITNYLL 210

Query: 254 ERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASE 313
           E+ R+V Q + ERN+HIFYQ   G SD  +    +     Y Y +  G + ++ +DD  +
Sbjct: 211 EKQRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDTIDDLHD 270

Query: 314 YGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSSDEPNLQIAADLLG 373
           Y +T++A+ ++G+S++ Q Q+F++L+A+L IGN+   +     +   D       A L+ 
Sbjct: 271 YQETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTFVENNEGNAEVRDTSVTDFVAYLMQ 330

Query: 374 IDAFDFAKWVTKKQIVTRSEKIVSSLPYH------QAIVSRDSVAKFIYSALFDWLVDNI 427
           +D+    K + ++ + T       S+ YH      QA   RD++AK IY+ LFDW+VD +
Sbjct: 331 VDSGLLIKCLVERVMETGHGSRRGSV-YHVPLNVVQATAVRDALAKAIYNNLFDWIVDRV 389

Query: 428 NTVL-CNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVFKLEQE 486
           N  L   P  V      IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQE
Sbjct: 390 NVSLKAFPGAVKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQE 445

Query: 487 EYVKEQIEWSFIEFNDNQPCIDLIENK--VGILSLLDEESRLPAGTDEGWTHKLYETLNK 544
           EY KEQI+W+ I++ DN+   DLIE+K   GI + LD+                 + LN 
Sbjct: 446 EYNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAFAQRLNL 505

Query: 545 PPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNETLLSI 604
             TN  F       ++F++ HYA DVTYD+ G  +KN+D +     E+++ + N  L +I
Sbjct: 506 FSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTNPFLSTI 562

Query: 605 L-ETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETINSTNVH 663
             +T+D                      +S++  R PT G+   +S  +L+ET++     
Sbjct: 563 FPDTIDK---------------------SSKR--RPPTAGNKIIKSANELVETLSKAQPS 599

Query: 664 YIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHILVPS 723
           YIR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+ +F  R+++L P 
Sbjct: 600 YIRTIKPNQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPK 659

Query: 724 ELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAG-MLAHLEKLRTDKL 782
             ++        + D     K+IL+     T +YQ G TK+F K    L  LE +R    
Sbjct: 660 CSYAGDYT---WQGDTLGAVKQILQDASIPTTEYQLGVTKVFIKTPETLFALEHMRDRYW 716

Query: 783 FSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGK 819
           ++ +  IQ+      +R+   R +D+  ++Q  +  K
Sbjct: 717 YNMAARIQRA-----WRRFIQRRIDSAIKIQRAIREK 748

>Kwal_26.7587
          Length = 1250

 Score =  437 bits (1123), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 276/766 (36%), Positives = 411/766 (53%), Gaps = 57/766 (7%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEMIQAYAGKLR 133
           DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y GK R
Sbjct: 40  DLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPF-RDLGIYTDSVLRSYVGKNR 98

Query: 134 GELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASVXXXXXXXXX 193
            E+ PH+FAIAE  Y  MK  ++NQ +I+SGESGAGKT +AK IM+Y A+          
Sbjct: 99  LEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASETHSDSIG 158

Query: 194 XXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLL 253
              +M      +LATNP++E+FG AKT+RN+NSSR GKYLEI F+         +  YLL
Sbjct: 159 KIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITNYLL 212

Query: 254 ERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASE 313
           E+ R+V Q K ERN+HIFYQ   G SD+ +    +   + Y Y +  G + ++ +DD S+
Sbjct: 213 EKQRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDTIDDLSD 272

Query: 314 YGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSSDEPNLQIAADLLG 373
           + +T+ A+S++GI++  Q ++F+ LAA+L IGNI   +     +   D       A LL 
Sbjct: 273 FQETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENEEGNAQVRDTSVTDFVAYLLQ 332

Query: 374 IDAFDFAKWVTKKQIVTRSEKIVSSLPYH------QAIVSRDSVAKFIYSALFDWLVDNI 427
           +D+    + + ++ + T       S+ YH      QA   +D++AK IY+ LFDW VD +
Sbjct: 333 VDSNLLVQALVERVMETNHGMKRGSI-YHVPLNVVQATAVKDALAKAIYNNLFDWTVDRV 391

Query: 428 NTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 487
           N  L   + +      IG+LDIYGFE F  NSFEQ CINY NEKLQQ F Q   K EQEE
Sbjct: 392 NLSL---QALPGANKSIGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSEQEE 448

Query: 488 YVKEQIEWSFIEFNDNQPCIDLIENK--VGILSLLDEESRLPAGTDEGWTHKLYETLNKP 545
           Y +EQIEW+ I++ DN+   DLIE +   GI++ +++         +       + LN  
Sbjct: 449 YAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQRLNLF 508

Query: 546 PTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNETLLSIL 605
            +N  F       ++FI+ HYA DVTYD+ G  +KN+D +    +E++K S+NE L S+ 
Sbjct: 509 SSNPHF---ELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNEFLCSLF 565

Query: 606 ETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETINSTNVHYI 665
            TV                             R P+ G    +S  +L+ET++     YI
Sbjct: 566 PTVVDKNSKR----------------------RPPSAGDKIIKSANELVETLSKAQPSYI 603

Query: 666 RCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHILVPSEL 725
           R IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R  + +F  R+++L P   
Sbjct: 604 RTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLSPQCS 663

Query: 726 WSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAG-MLAHLEKLRTDKLFS 784
           ++        + D     K ILK       +YQ G +K+F K    L  LE +R     +
Sbjct: 664 YAGDYT---WQGDTLEAVKLILKDASIPPTEYQLGVSKVFIKTPESLFALETMRDKYWHN 720

Query: 785 SSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFK 830
            +  IQ+      +R+  LR +DA  R+Q  +  K    +  NEF+
Sbjct: 721 MAARIQRA-----WRRFLLRRIDAASRIQRAIREK----KGGNEFE 757

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  426 bits (1094), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 273/764 (35%), Positives = 401/764 (52%), Gaps = 60/764 (7%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEMIQAYAGKLR 133
           DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++  Y GK R
Sbjct: 40  DLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPF-RDLGIYTDAVMNEYKGKNR 98

Query: 134 GELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASVXXXXXXXXX 193
            E+ PH+FAIAE  Y  MK+ ++NQ +I+SGESGAGKT +AK IM+Y A+          
Sbjct: 99  LEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTESIG 158

Query: 194 XXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLL 253
              +M      +LATNP++E+FG AKT+RN+NSSR GKYLEI F++        +  YLL
Sbjct: 159 KIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLL 212

Query: 254 ERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASE 313
           E+ R+V Q K ERN+HIFYQ   G SD  +    +   + Y Y    G    E +DD  +
Sbjct: 213 EKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQD 272

Query: 314 YGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSSDEPNLQIAADLLG 373
           Y +T++A+ ++G+ ++ Q Q+F++LAA+L IGN+   +     +   D       A LL 
Sbjct: 273 YQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAYLLQ 332

Query: 374 IDAFDFAKWVTKKQIVTRSEKIVSSLPYH------QAIVSRDSVAKFIYSALFDWLVDNI 427
           ID+    K + ++ + T       S+ YH      QA   RD++AK IY+ LFDW+V  +
Sbjct: 333 IDSQLLIKSLVERIMETNHGMKRGSV-YHVPLNIVQADAVRDALAKAIYNNLFDWIVSRV 391

Query: 428 NTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 487
           N  L   +        IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQE 
Sbjct: 392 NKSL---QAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQET 448

Query: 488 YVKEQIEWSFIEFNDNQPCIDLIENK--VGILSLLDEESRLPAGTDEGWTHKLYETLNKP 545
           Y +E+I+W+ I++ DN+   DLIE +   GI + +++                 + LN  
Sbjct: 449 YEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLNLF 508

Query: 546 PTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNETLLSIL 605
            TN  F        +F++ HYA DVTYD+DG  +KN+D +    +E++  + N  L +I 
Sbjct: 509 TTNPHFD---LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIF 565

Query: 606 -ETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETINSTNVHY 664
            +TVD                            R PT G    +S  DL+ET++     Y
Sbjct: 566 PDTVDRESKR-----------------------RPPTAGDKIIKSANDLVETLSKAQPSY 602

Query: 665 IRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHILVPSE 724
           IR IKPNE K    +D+  VL Q++  G+ E +RI  AGF  R  + +F  R+++L P  
Sbjct: 603 IRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHC 662

Query: 725 LWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAG-MLAHLEKLRTDKLF 783
            ++        + D  +  K IL+ +     +YQ G T +F K    L  LE +R     
Sbjct: 663 SYAGDYT---WQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWH 719

Query: 784 SSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTEN 827
           + +  IQ+      +R+   R +DA  ++Q     + IR R E 
Sbjct: 720 NMAARIQRA-----WRRFLQRRIDAATKIQ-----RTIRERKEG 753

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  424 bits (1090), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 274/756 (36%), Positives = 405/756 (53%), Gaps = 55/756 (7%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEMIQAYAGKLR 133
           DLT LS +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+ + +++Y GK R
Sbjct: 40  DLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPF-RDLGIYTDDTMKSYQGKNR 98

Query: 134 GELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASVXXXXXXXXX 193
            E  PH+FAIAE  Y  +K+ ++NQ +I+SGESGAGKT +AK IM+Y A+          
Sbjct: 99  LEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAATSSTHSE--- 155

Query: 194 XXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLL 253
               +S+ +  +LATNP++E+FG AKT+RN+NSSR GKYLEI FD         +  YLL
Sbjct: 156 ---SISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITNYLL 212

Query: 254 ERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASE 313
           E+ R+V Q K ERN+HIFYQ   G  ++ +    +   + Y Y +    + +E +DD  E
Sbjct: 213 EKQRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDDVEE 272

Query: 314 YGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS--DEPNLQIAADL 371
           + +T+ A+  +G++K  Q Q+F+ LAA+L IGNI    V N+A  +   D+      A L
Sbjct: 273 FNETLNAMRTIGLTKSEQDQIFRALAAILWIGNISF--VENEAGNAEIRDKSVTTFVAYL 330

Query: 372 LGIDAFDFAKWVTKKQIVT-----RSEKIVSSLPYHQAIVSRDSVAKFIYSALFDWLVDN 426
           L +      K + ++ I T     R     S L   QA   RD++AK IY+ LF+W+V+ 
Sbjct: 331 LEVQEELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIVER 390

Query: 427 INTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVFKLEQE 486
           +N  L   +        IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQ+
Sbjct: 391 VNNSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQD 447

Query: 487 EYVKEQIEWSFIEFNDNQPCIDLIENK--VGILSLLDEESRLPAGTDEGWTHKLYETLNK 544
            Y KEQI W+ IE+ DN+   DLIE K   GI + +++         +       + LN 
Sbjct: 448 TYKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRLNL 507

Query: 545 PPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNETLLSI 604
             TN  F      Q +F+V HYA DVTYD+ G  +KN+D +    +E+L  ++N  +  I
Sbjct: 508 FTTNPHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVREI 564

Query: 605 LETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETINSTNVHY 664
                                   P   SR+  R PT G    +S  +L+ET++     Y
Sbjct: 565 FP--------------------DQPQTDSRR--RPPTSGDKIIKSANELVETLSKAQPSY 602

Query: 665 IRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHILVPSE 724
           IR IKPN+ K +  +D+  VL Q++  G+ E +RI  AGF  R  + +F  R+++L P  
Sbjct: 603 IRTIKPNDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSPQC 662

Query: 725 LWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFK-AGMLAHLEKLRTDKLF 783
            ++   + D    D     K IL+     T +Y+ G T+IF K    L  LE +R    +
Sbjct: 663 SYAGDYVWDGETLDA---VKLILQDASIPTTEYEIGVTQIFIKHPETLFALENMRDKYWY 719

Query: 784 SSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGK 819
           + +  IQ+      +R+   + +DA  R+Q  + GK
Sbjct: 720 NMAARIQRA-----WRRYLQKRIDAAIRIQNAIRGK 750

>Scas_721.119
          Length = 1232

 Score =  416 bits (1069), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 259/727 (35%), Positives = 386/727 (53%), Gaps = 50/727 (6%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEMIQAYAGKLR 133
           DLT LS +++  +   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y GK R
Sbjct: 40  DLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPF-RDLGIYTDAIVESYKGKNR 98

Query: 134 GELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASVXXXXXXXXX 193
            E+ PH+FAIAE  Y  MK+ ++NQ +I+SGESGAGKT +AK IM+Y AS          
Sbjct: 99  LEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIASASTTHSESIG 158

Query: 194 XXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLL 253
              +M      +LATNP++E+FG AKT+RN+NSSR GKYLEI F+         +  YLL
Sbjct: 159 KIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLL 212

Query: 254 ERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASE 313
           E+ R+V Q K ERN+HIFYQ   G SD  +    +   + Y Y +  G + ++ +DD ++
Sbjct: 213 EKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDTIDDVND 272

Query: 314 YGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSSDEPNLQIAADLLG 373
           Y +T++A+ ++G+ ++ Q Q+F++LAA+L IGN+   +     +   D       A LL 
Sbjct: 273 YRETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSFVENEEGNAQVRDTSVTDFVAYLLQ 332

Query: 374 IDAFDFAKWVTKKQIVTRSEKIVSSLPYH------QAIVSRDSVAKFIYSALFDWLVDNI 427
           IDA    K + ++ + T       S+ YH      QA   RD++AK IY+ LF+W+V  +
Sbjct: 333 IDAPLLIKSLVERVMETNHGMRRGSV-YHVPLNIVQATAVRDALAKAIYNNLFEWIVGRV 391

Query: 428 NTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 487
           N  L   +        IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQE 
Sbjct: 392 NVSL---QAYPGADRSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQET 448

Query: 488 YVKEQIEWSFIEFNDNQPCIDLIENK--VGILSLLDEESRLPAGTDEGWTHKLYETLNKP 545
           Y +E+I+W+ I++ DN+   DLIE K   GI + +++                 + LN  
Sbjct: 449 YKREKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQRLNMF 508

Query: 546 PTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNETLLSIL 605
            +N  F        +F++ HYA DVTYDV+G  +KN+D +    +E++  + N  L  I 
Sbjct: 509 SSNPHF---ELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIATTTNPFLSGIF 565

Query: 606 ET-VDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETINSTNVHY 664
              VD                            R PT G    +S  +L+ET++     Y
Sbjct: 566 PVEVDKESKR-----------------------RPPTAGDKIIKSANELVETLSKAQPSY 602

Query: 665 IRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHILVPSE 724
           IR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+ +F  R+++L P  
Sbjct: 603 IRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPHC 662

Query: 725 LWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAG-MLAHLEKLRTDKLF 783
            ++        + +  +  + IL       ++YQ G T +F K    L  LE +R     
Sbjct: 663 SYAGDYT---WQGETLDAVQHILNDASIPASEYQLGTTSVFIKTPETLFALEHMRDRYWH 719

Query: 784 SSSVMIQ 790
           + +  IQ
Sbjct: 720 NMAARIQ 726

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  416 bits (1070), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 270/766 (35%), Positives = 402/766 (52%), Gaps = 61/766 (7%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEMIQAYAGKLR 133
           DLT LS +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y GK R
Sbjct: 40  DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPF-RDLGIYTNAVLESYKGKNR 98

Query: 134 GELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASVXXXXXXXXX 193
            E+ PH+FAIAE  Y  +K+ ++NQ +I+SGESGAGKT +AK IM+Y A+          
Sbjct: 99  LEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESIG 158

Query: 194 XXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLL 253
              +M      +LATNP++E+FG AKT+RN+NSSR GKYLEI F+         +  YLL
Sbjct: 159 KIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLL 212

Query: 254 ERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASE 313
           E+ R+V Q K ERN+HIFYQ   G SD  K    +   + Y Y    G +  + +    +
Sbjct: 213 EKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTSADQL-MRKD 271

Query: 314 YGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSSDEPNLQIAADLLG 373
           Y  T+EA+  +G+ ++ Q Q+F++LAA+L IGNI   +     +   D       A LL 
Sbjct: 272 YEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTDFVAYLLQ 331

Query: 374 IDAFDFAKWVTKKQIVTRSEKIVSSLPYH------QAIVSRDSVAKFIYSALFDWLVDNI 427
           +DA    K + ++ I+  S  +     YH      QA   RD++AK IY+ LFDW+VD +
Sbjct: 332 VDASLLVKCLVER-IMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRV 390

Query: 428 NTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 487
           N  L   +        IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQE 
Sbjct: 391 NVSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQET 447

Query: 488 YVKEQIEWSFIEFNDNQPCIDLIE--NKVGILSLLDEESRLPAGTDEGWTHKLYETLNKP 545
           Y +E+I+W+ I++ DN+   DLIE  N  GIL+ +++                 + LN  
Sbjct: 448 YEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRLNLF 507

Query: 546 PTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNETLLSIL 605
            +N  F        +F++ HYA DVTYD++G  +KN+D +    +E++  + N  L +I 
Sbjct: 508 NSNPYF---ELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIF 564

Query: 606 -ETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETINSTNVHY 664
            + VD                            R PT G    +S  +L+ET++     Y
Sbjct: 565 PDDVDKDSKR-----------------------RPPTAGDKIIKSANELVETLSKAEPSY 601

Query: 665 IRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHILVPSE 724
           IR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+ +F  R+++L P  
Sbjct: 602 IRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDC 661

Query: 725 LWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAG-MLAHLEKLRTDKLF 783
            ++     D    D     K IL+  M    ++Q G T +F K    L  LE +R    +
Sbjct: 662 SYAGDYTWD---GDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWY 718

Query: 784 SSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANV-----SGKIIRLR 824
           + +  IQ+      +R+   R +DA  ++Q  +       K ++LR
Sbjct: 719 NMAARIQRA-----WRRFLQRRIDAAIKIQRTIREKKGGNKYVKLR 759

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  414 bits (1063), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 269/757 (35%), Positives = 411/757 (54%), Gaps = 69/757 (9%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEMIQAYAGKLR 133
           DLT LS +++  +   +K R+   +IYTY G VLI+ NPF R   +Y+ ++++ Y G+ R
Sbjct: 39  DLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPF-RDLGIYTDQVLETYKGRNR 97

Query: 134 GELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASVXXXXXXXXX 193
            E+ PH+FAIAE  Y  +K  ++NQ +I+SGESGAGKT +AK IM+Y A+          
Sbjct: 98  LEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEASIG 157

Query: 194 XXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLL 253
              +M      +LATNP++E+FG AKT+RN+NSSR GKYLEI F+        ++  YLL
Sbjct: 158 RIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITNYLL 211

Query: 254 ERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASE 313
           E+ R+V Q K ERN+HIFYQ   G SD  +    +   + Y Y +  G + ++ +DD ++
Sbjct: 212 EKQRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDDLND 271

Query: 314 YGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSSDEPNLQIA----- 368
           Y  T+EA++++G+S+  Q ++F++L+A+L IGN+          +  DE N +IA     
Sbjct: 272 YEATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTF--------MEDDEGNAKIADTSIT 323

Query: 369 ---ADLLGIDAFDFAKWVTKKQIVTR---SEKIVSSLPYH--QAIVSRDSVAKFIYSALF 420
              A LL +DA    K + ++ I T        + ++P +  QA   RD++AK IY+ LF
Sbjct: 324 DFVAYLLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYNNLF 383

Query: 421 DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480
           +W+VD +N  L   + +      IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q  
Sbjct: 384 EWIVDRVNVSL---QALPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLT 440

Query: 481 FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENK--VGILSLLDEESRLPAGTDEGWTHKL 538
            K EQEEY KEQI+W+ I++ DN+   +LIE K   GI + L++                
Sbjct: 441 LKSEQEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAADQAF 500

Query: 539 YETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNN 598
            + LN   +N  F       ++F++ HYA DVTYD+ G  +KN+D +    +E+L +++N
Sbjct: 501 AQRLNLFTSNPHF---ELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELLNSTSN 557

Query: 599 ETLLSIL-ETVDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETI 657
             L +I  +T D                   P  A  KI+R          S  +L++T+
Sbjct: 558 TFLATIFPDTGD-------------KDSKRIPSTAGDKIIR----------SANELVDTL 594

Query: 658 NSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRY 717
           +     YIR IKPN+ K    +D+  VL Q++  G+ E +RI  A +  R  + +F  R+
Sbjct: 595 SKAQPSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDKFVERF 654

Query: 718 HILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAG-MLAHLEK 776
           ++L P   ++       +  D  NL   IL+ T     +YQ G TK+F K    L  LE 
Sbjct: 655 YLLSPQCSYAGDYTWQGNTLDAVNL---ILRDTSIPVTEYQLGVTKVFIKTPETLFALEN 711

Query: 777 LRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQ 813
           +R     + +  IQ+      +R+   R +D+  R+Q
Sbjct: 712 MRDKYWHNMASRIQRA-----WRRFLQRRIDSAIRIQ 743

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  404 bits (1038), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 259/766 (33%), Positives = 401/766 (52%), Gaps = 81/766 (10%)

Query: 74  DLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLYSQEMIQAYAGKLR 133
           DLT L+ +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y GK R
Sbjct: 41  DLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPF-RDLGIYTDAIMKSYQGKNR 99

Query: 134 GELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRYFASVXXXXXXXXX 193
            E+ PH++AI+E  Y  +K  ++NQ +I+SGESGAGKT +AK IM Y A+          
Sbjct: 100 LEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATSSTHSESIG 159

Query: 194 XXLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLL 253
              +M      +LATNP++E+FG AKT+RN+NSSR GKYLEI F+         +  YLL
Sbjct: 160 KIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLL 213

Query: 254 ERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASE 313
           E+ R+V Q   ERN+HIFYQ   G SD+ +    +   + Y Y +    + ++ +DD  +
Sbjct: 214 EKQRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDDVKD 273

Query: 314 YGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSSDEPNLQIAADLLG 373
           +  T++A+ ++G++++ Q Q+F++LAA+L IGNI   +     +   D       A LL 
Sbjct: 274 FEATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAYLLQ 333

Query: 374 IDAFDFAKWVTKKQIVTRSEKIVSSLPYH------QAIVSRDSVAKFIYSALFDWLVDNI 427
           +D+    K + ++ + T       S+ YH      QA   RD++AK IY+ LF+W+VD +
Sbjct: 334 VDSQSLIKALVERIVETNHGSRRGSV-YHVPLNIVQATAVRDALAKAIYNNLFEWIVDRV 392

Query: 428 NTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 487
           N  L            IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K EQ+ 
Sbjct: 393 NKSL---HAYPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDT 449

Query: 488 YVKEQIEWSFIEFNDNQPCIDLIENK--VGILSLLDEESRLP----AGTDEGWTHKLYET 541
           Y +E+I+W+ I++ DN+   DLIE K   GI + +++         +  D+ +  +L   
Sbjct: 450 YAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQRL--- 506

Query: 542 LNKPPTNEVFSK-PRFGQTQ--FIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNN 598
                   +FS  P F Q Q  F++ HYA DVTYDV G  +KN+D +    +E++  + N
Sbjct: 507 -------SLFSSNPHFEQRQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTN 559

Query: 599 ETLLSILET-VDXXXXXXXXXXXXXXXXXXXPGPASRKIVRKPTLGSMFKQSLIDLMETI 657
             L ++    VD                            R PT G    +S  +L+ET+
Sbjct: 560 AFLTTLFPNQVDKDNKR-----------------------RPPTAGDKIIKSANELVETL 596

Query: 658 NSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRY 717
           +     YIR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R  + +F  R+
Sbjct: 597 SKAQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERF 656

Query: 718 HILVP------SELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAG-M 770
           ++L P         W+          D+    + IL+  +    +YQ G T++F K    
Sbjct: 657 YLLSPRCSYAGDYTWTG---------DILEAVRLILQDALIPEKEYQLGVTQVFIKTPET 707

Query: 771 LAHLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANV 816
           L  LE +R     + +  IQ+      +R+   R +DA  ++Q  +
Sbjct: 708 LFALENMRDKFWHNMAARIQRA-----WRRYLQRRIDAAVKIQRTI 748

>KLLA0E15598g 1388626..1391343 weakly similar to sp|P38853
            Saccharomyces cerevisiae YHR158c KEL1 involved in cell
            fusion and morphology, start by similarity
          Length = 905

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 73/156 (46%), Gaps = 16/156 (10%)

Query: 941  LENKVIELTE---SLASKVKENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQ 997
            LE+K I L+E   SL  ++   K+ ++  EN++K     + +   + ++++ H   +   
Sbjct: 701  LESKYIVLSEKYESLTKELDSKKQFIN--ENIKKCSESLDTLLDGMRQKQKAHETVV--- 755

Query: 998  KSIHEEEYGKVNDQLXXXXXXXXXXXXXVDELLNKQKNLKDEIASTLEELT-------SA 1050
             + H+E    ++ +L              D+L  +   LKDE AS  EELT       S 
Sbjct: 756  -TRHKETMTGLDRKLSEVILQNKELTTSRDQLFTEYSKLKDEHASKHEELTKMEREYRSV 814

Query: 1051 RDELLTSQSENADLKKEVFSLKEEVARLQSSMRSGV 1086
             D +  S +    L+ E+  L++E +RL+S + + +
Sbjct: 815  IDSVHNSGNAMEKLQNEIIKLRQENSRLKSDLENTI 850

>ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH]
            (591654..594023) [2370 bp, 789 aa]
          Length = 789

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/73 (19%), Positives = 39/73 (53%)

Query: 1340 VLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDALCFNDLILRKNFLSWKRGLQLNYNV 1399
            ++  F  + + ++S+ +   +    ++  ++      FN ++  K +LS  + +Q+  N+
Sbjct: 452  IVQIFGALAYVLESHQVHPLLSMQCLSTSIEWFSTSIFNIMVSSKKYLSRAQAMQIRLNL 511

Query: 1400 TRIEEWCKSHHIS 1412
            + IE+W K+H ++
Sbjct: 512  STIEDWVKNHDMT 524

>YJR134C (SGM1) [3025] chr10 complement(673644..675767) Protein with
            weak similarity to Afr1p, a protein nvolved in
            morphogenesis of the mating projection [2124 bp, 707 aa]
          Length = 707

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 4/93 (4%)

Query: 909  QSFIRKHYAQRKLKQLKSEAKSVN-HLQEVSYKLENKVIELTESLASKVKENKELVSRLE 967
            QS+  K +A  +  +LK + +S   +   + Y L  K++ L     S +KE  ++    E
Sbjct: 335  QSYEEKQHASFQYNRLKEQLESSKANWDSIEYALNTKIVNLENRFESTMKEKNDIE---E 391

Query: 968  NLQKSLNESENIKSSLEEEKEGHTKALADQKSI 1000
              Q +L  SE +   LE+EKE H+KA+ + K +
Sbjct: 392  KYQTALRSSETLGKQLEKEKENHSKAVLEVKDL 424

>Kwal_55.22106
          Length = 495

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%)

Query: 1465 YEEPIAPEILQYVAEKVKNDTSKAEVGNNDVFLPVDNGPFED 1506
            Y   I P IL  + ++V + +    +  N VF  VDN PF D
Sbjct: 245  YASTILPGILSNITQRVGDVSRNVAMAGNMVFAQVDNRPFND 286

>CAGL0K06369g 624706..625698 highly similar to tr|Q03290 Saccharomyces
            cerevisiae YDR460w TFB3, hypothetical start
          Length = 330

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 924  LKSEAKSVNHLQEVSYKLENK--VIELTESLASKVKENKELVSRLENLQKSLNESENIKS 981
            L++  K +  ++++ YKL+NK  V+E  E L +  + NK+L+  + N+++S  + EN + 
Sbjct: 113  LEAYNKYLEEVEDIVYKLDNKIDVVETEEKLRTYEELNKQLI--MNNMERSKKDLENFEQ 170

Query: 982  SLEEEKEGHTKALADQKSIHEEE 1004
              + EKE   K    ++ I  E+
Sbjct: 171  RQQFEKEMRMKKRMLERQIESED 193

>KLLA0C15851g complement(1378324..1380579) some similarities with
            sgd|S0006294 Saccharomyces cerevisiae YPR089w/YPR090w,
            hypothetical start
          Length = 751

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 36/73 (49%)

Query: 1340 VLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDALCFNDLILRKNFLSWKRGLQLNYNV 1399
            ++  F  + +    +DI   + +  ++   K L    FN++I  K   S    +Q+  N+
Sbjct: 447  IVQIFGALTYVFDLHDIHPVLLQQCLSISSKWLANTIFNEIIQSKQLSSRAHAMQIRLNL 506

Query: 1400 TRIEEWCKSHHIS 1412
            + +++W K+H+ S
Sbjct: 507  SILQDWVKNHNFS 519

>Scas_683.38
          Length = 1928

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 69/140 (49%), Gaps = 21/140 (15%)

Query: 941  LENKVIELTESLASKVKENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSI 1000
            L+N + ++TE+  +   ENK L+S++ NL+ +++   N+K S     +  +   +D K+ 
Sbjct: 969  LKNNIKQMTENNVTLTTENKGLISKISNLELTID---NLKKS----NDAKSAQFSDDKNE 1021

Query: 1001 HEEEYGKVNDQLXXXXXXXXXXXXXVDELLNKQKNLKDEIASTL--------------EE 1046
             EE    +N+QL             V++L  +  ++K E+   +              E+
Sbjct: 1022 LEESIMHLNEQLNEIEAEKEINERKVNDLEGQLNSVKSELTKNMDEITLLKTKLDTVNED 1081

Query: 1047 LTSARDELLTSQSENADLKK 1066
            LT+++ +L+ S++E  +L K
Sbjct: 1082 LTTSKQKLIESENEKRELSK 1101

>Scas_704.44
          Length = 443

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1456 LITQYSVADYEEPIAPEILQYVAEKVKNDTSKAEVGNNDVFLPVDNGPFEDPYQKVEVR 1514
            +IT  +  + E P  P IL+YV  ++  ++ KA +  NDV  P++   FE    ++ VR
Sbjct: 267  MITYITGEEIEFPCIPVILEYVLTEILKNSMKAHI-ENDVTKPIEISIFETDSDELTVR 324

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 48,245,397
Number of extensions: 2156192
Number of successful extensions: 10684
Number of sequences better than 10.0: 288
Number of HSP's gapped: 10572
Number of HSP's successfully gapped: 506
Length of query: 1526
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1411
Effective length of database: 12,615,039
Effective search space: 17799820029
Effective search space used: 17799820029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)