Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03883g1101094929e-66
CAGL0G06358g1131124061e-52
YOR327C (SNC2)115944016e-52
ADR355C109894001e-51
Scas_663.25112923964e-51
CAGL0E05258g108893582e-45
YAL030W (SNC1)1171153583e-45
Kwal_26.705474512623e-31
Scas_564.4*237661376e-11
Kwal_56.23743162621329e-11
YLR093C (NYV1)253611281e-09
KLLA0F19448g231701243e-09
CAGL0C00429g234571234e-09
AGR054C248661227e-09
Kwal_47.1712120067901e-04
Sklu_2258.720067873e-04
YKL196C (YKT6)20067874e-04
Scas_571.120067874e-04
CAGL0D03498g20565857e-04
AER109W20049830.001
KLLA0D02684g20067790.005
Scas_659.11*21575700.090
AGR020C58655592.8
Scas_673.1247158583.3
Kwal_23.527350435583.5
YNL020C (ARK1)63842583.7
Scas_373.169454583.7
Kwal_56.2463142274583.9
KLLA0A04708g35141575.2
CAGL0L06908g43947558.7
Scas_623.544647559.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03883g
         (109 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03883g join(344642..344725,344850..345098) similar to sp|P...   194   9e-66
CAGL0G06358g complement(612827..613168) no similarity, hypotheti...   160   1e-52
YOR327C (SNC2) [5108] chr15 complement(930729..931076) Synaptobr...   159   6e-52
ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W (...   158   1e-51
Scas_663.25                                                           157   4e-51
CAGL0E05258g complement(511027..511353) highly similar to sp|P33...   142   2e-45
YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrev...   142   3e-45
Kwal_26.7054                                                          105   3e-31
Scas_564.4*                                                            57   6e-11
Kwal_56.23743                                                          55   9e-11
YLR093C (NYV1) [3508] chr12 complement(326514..327259,327401..32...    54   1e-09
KLLA0F19448g complement(1799571..1800266) similar to sgd|S000408...    52   3e-09
CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces cer...    52   4e-09
AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH] (815110..81...    52   7e-09
Kwal_47.17121                                                          39   1e-04
Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement       38   3e-04
YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrev...    38   4e-04
Scas_571.1                                                             38   4e-04
CAGL0D03498g complement(357058..357675) highly similar to sp|P36...    37   7e-04
AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH] complement(...    37   0.001
KLLA0D02684g complement(228564..229166) highly similar to sp|P36...    35   0.005
Scas_659.11*                                                           32   0.090
AGR020C [4330] [Homologous to ScYGR013W (SNU71) - SH] (751827..7...    27   2.8  
Scas_673.12                                                            27   3.3  
Kwal_23.5273                                                           27   3.5  
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    27   3.7  
Scas_373.1                                                             27   3.7  
Kwal_56.24631                                                          27   3.9  
KLLA0A04708g complement(420317..421372) similar to sp|P53290 Sac...    27   5.2  
CAGL0L06908g complement(777557..778876) highly similar to sp|Q07...    26   8.7  
Scas_623.5                                                             26   9.6  

>KLLA0A03883g join(344642..344725,344850..345098) similar to
           sp|P33328 Saccharomyces cerevisiae YOR327c SNC2
           synaptobrevin (v-SNARE) homolog present on post-Golgi
           vesicles or sp|P31109 Saccharomyces cerevisiae YAL030w
           SNC1 synaptic vesicle-associated membrane protein, start
           by similarity
          Length = 110

 Score =  194 bits (492), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 95/109 (87%)

Query: 1   MSSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADN 60
           MSSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADN
Sbjct: 1   MSSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADN 60

Query: 61  LAVSAQGFKRGANRVRKQMWWKDLKMRMCXXXXXXXXXXXXXXPIAVHF 109
           LAVSAQGFKRGANRVRKQMWWKDLKMRMC              PIAVHF
Sbjct: 61  LAVSAQGFKRGANRVRKQMWWKDLKMRMCLVLVVIILLIVIIVPIAVHF 109

>CAGL0G06358g complement(612827..613168) no similarity, hypothetical
           start
          Length = 113

 Score =  160 bits (406), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 87/112 (77%), Gaps = 3/112 (2%)

Query: 1   MSSSVPYDPYV-PATEET--AGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDK 57
           MSSSVPYDPYV P  +ET     SK AALK+EIDDTV IMRDNINKVAERGERLTSI+DK
Sbjct: 1   MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK 60

Query: 58  ADNLAVSAQGFKRGANRVRKQMWWKDLKMRMCXXXXXXXXXXXXXXPIAVHF 109
           ADNLA+SAQGFKRGANRVRKQMW+KDLKM+ C              PIAVHF
Sbjct: 61  ADNLAISAQGFKRGANRVRKQMWYKDLKMKFCLFVVIICLLVAIVVPIAVHF 112

>YOR327C (SNC2) [5108] chr15 complement(930729..931076)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [348 bp, 115 aa]
          Length = 115

 Score =  159 bits (401), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 77/94 (81%), Positives = 82/94 (87%), Gaps = 5/94 (5%)

Query: 1  MSSSVPYDPYVPATEETAG-----DSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQ 55
          MSSSVPYDPYVP  E  +G      +KTAAL+ EIDDTV IMRDNINKVAERGERLTSI+
Sbjct: 1  MSSSVPYDPYVPPEESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIE 60

Query: 56 DKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMC 89
          DKADNLA+SAQGFKRGANRVRKQMWWKDLKMRMC
Sbjct: 61 DKADNLAISAQGFKRGANRVRKQMWWKDLKMRMC 94

>ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W
          (SNC1) - SH] (1333349..1333597,1333672..1333752) [330
          bp, 109 aa]
          Length = 109

 Score =  158 bits (400), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 78/89 (87%), Positives = 80/89 (89%), Gaps = 1/89 (1%)

Query: 1  MSSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADN 60
          MSSSVPYDPYVP  E     SK AALK+EIDDTV IMRDNINKVAERGERLTSIQDKADN
Sbjct: 1  MSSSVPYDPYVP-PEGAQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIQDKADN 59

Query: 61 LAVSAQGFKRGANRVRKQMWWKDLKMRMC 89
          LAVSAQGFKRGANRVRKQMWWKDLKMR+C
Sbjct: 60 LAVSAQGFKRGANRVRKQMWWKDLKMRLC 88

>Scas_663.25
          Length = 112

 Score =  157 bits (396), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 80/92 (86%), Positives = 82/92 (89%), Gaps = 4/92 (4%)

Query: 1  MSSSVPYDPYVPATEETAG---DSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDK 57
          MSSSVPYDPYVP  EET G    SK AALK+EIDDTV IMRDNINKVAERGERLTSI+DK
Sbjct: 1  MSSSVPYDPYVPP-EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDK 59

Query: 58 ADNLAVSAQGFKRGANRVRKQMWWKDLKMRMC 89
          ADNLAVSAQGFKRGANRVRKQMWWKDLKMR C
Sbjct: 60 ADNLAVSAQGFKRGANRVRKQMWWKDLKMRAC 91

>CAGL0E05258g complement(511027..511353) highly similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2, start
          by similarity
          Length = 108

 Score =  142 bits (358), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 78/89 (87%), Gaps = 2/89 (2%)

Query: 1  MSSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADN 60
          M+S+  YDPY+ +  E  G SK AALKSEIDDTVDIMR+NINKVAERGE LTSI DKADN
Sbjct: 1  MASNDNYDPYLLS--EDGGQSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADN 58

Query: 61 LAVSAQGFKRGANRVRKQMWWKDLKMRMC 89
          LA+SAQGFKRGANRVR+QMW+KDLKMRMC
Sbjct: 59 LAMSAQGFKRGANRVRRQMWYKDLKMRMC 87

>YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrevin
           (v-SNARE) homolog present on post-Golgi vesicles [354
           bp, 117 aa]
          Length = 117

 Score =  142 bits (358), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 83/115 (72%), Gaps = 6/115 (5%)

Query: 1   MSSSVPYDPYVPAT------EETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSI 54
           MSSS P+DPY  +       +     S+TA L++EIDDTV IMRDNINKVAERGERLTSI
Sbjct: 1   MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI 60

Query: 55  QDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMCXXXXXXXXXXXXXXPIAVHF 109
           +DKADNLAVSAQGFKRGANRVRK MW+KDLKM+MC              PIAVHF
Sbjct: 61  EDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHF 115

>Kwal_26.7054
          Length = 74

 Score =  105 bits (262), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%)

Query: 37 MRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 87
          MRDNINKVAERGERLTSI+DKADNLAVSAQGFKRGANRVRKQMWWKDLKMR
Sbjct: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 51

>Scas_564.4*
          Length = 237

 Score = 57.4 bits (137), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 46/66 (69%)

Query: 20  DSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQM 79
           +S+ A+ ++++ D V+IM +NI+K  ER ER++ + DK   L  ++  FK+ A R++++M
Sbjct: 149 NSEGASTENDLQDVVNIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAVRIKERM 208

Query: 80  WWKDLK 85
           WW+ +K
Sbjct: 209 WWQRMK 214

>Kwal_56.23743
          Length = 162

 Score = 55.5 bits (132), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 25  ALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDL 84
           A + ++ D + +M DNI+K  +R ER++ + D+   L  S+  FKR A R++ +MWW+++
Sbjct: 79  ATEQDLQDIIHLMNDNIDKFLQRQERVSLLVDRTSKLNQSSYNFKRKAVRIKTKMWWQNV 138

Query: 85  KM 86
           K+
Sbjct: 139 KL 140

>YLR093C (NYV1) [3508] chr12
           complement(326514..327259,327401..327416) Synaptobrevin
           (v-SNARE) homolog involved in vacuolar vesicle fusion
           [762 bp, 253 aa]
          Length = 253

 Score = 53.9 bits (128), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 25  ALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDL 84
           A + +I D + IM DNI+K  ER ER++ + DK   L  S+  F+R A  +++ MWW+ +
Sbjct: 170 ATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKV 229

Query: 85  K 85
           K
Sbjct: 230 K 230

>KLLA0F19448g complement(1799571..1800266) similar to sgd|S0004083
           Saccharomyces cerevisiae YLR093c NYV1 v-SNARE, vacuolar,
           start by similarity
          Length = 231

 Score = 52.4 bits (124), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 43/70 (61%)

Query: 17  TAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVR 76
           T G    A+ + E+ + + IM DNI+K  +R ER++ + D  + L  ++  F+R ++++ 
Sbjct: 141 TEGQQTAASTEEELQNIIAIMNDNIDKFLQRQERISLLVDNTNQLNENSFKFQRKSSKIM 200

Query: 77  KQMWWKDLKM 86
           ++MWW ++K 
Sbjct: 201 RKMWWNNVKF 210

>CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces
           cerevisiae YLR093c, hypothetical start
          Length = 234

 Score = 52.0 bits (123), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 40/57 (70%)

Query: 29  EIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLK 85
           ++ + + IM DNI+K  ER ER++ + DK  +L  +++ FKR A +++++MWW+ +K
Sbjct: 155 DMQEVIQIMNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRMK 211

>AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH]
           (815110..815795,815928..815988) [747 bp, 248 aa]
          Length = 248

 Score = 51.6 bits (122), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 40/66 (60%)

Query: 21  SKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMW 80
           + + A   ++   V +M DNI+K  +R ER++ + D+   L  S+  F+R A R++++MW
Sbjct: 162 TSSNATDQDLQTIVSVMNDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRKAVRIKRKMW 221

Query: 81  WKDLKM 86
           W ++K 
Sbjct: 222 WNNIKF 227

>Kwal_47.17121
          Length = 200

 Score = 39.3 bits (90), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 39/67 (58%)

Query: 8   DPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQG 67
           D Y+   ++ +       ++ E+D+T  ++   I  V +RGERL ++ DK+++L+ S++ 
Sbjct: 126 DIYIAKYQDPSQADSIMRVQQELDETKIVLHKTIESVLQRGERLDNLVDKSESLSASSRM 185

Query: 68  FKRGANR 74
           F + A +
Sbjct: 186 FYKQAKK 192

>Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement
          Length = 200

 Score = 38.1 bits (87), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 39/67 (58%)

Query: 8   DPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQG 67
           D Y+   ++ +       ++ E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ 
Sbjct: 126 DIYISKYQDPSQADSIMKVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRM 185

Query: 68  FKRGANR 74
           F + A +
Sbjct: 186 FYKQAKK 192

>YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrevin
           (v-SNARE) homolog with similarity to Sec22p, Snc1p, and
           Snc2p, essential for endoplasmic reticulum-Golgi
           transport [603 bp, 200 aa]
          Length = 200

 Score = 38.1 bits (87), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 38/67 (56%)

Query: 8   DPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQG 67
           D Y+   ++ +       ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ 
Sbjct: 126 DTYISKYQDPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKM 185

Query: 68  FKRGANR 74
           F + A +
Sbjct: 186 FYKQAKK 192

>Scas_571.1
          Length = 200

 Score = 38.1 bits (87), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 38/67 (56%)

Query: 8   DPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQG 67
           D Y+   ++ +       ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ 
Sbjct: 126 DTYISKYQDPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKM 185

Query: 68  FKRGANR 74
           F + A +
Sbjct: 186 FYKQAKK 192

>CAGL0D03498g complement(357058..357675) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6, start by
           similarity
          Length = 205

 Score = 37.4 bits (85), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%)

Query: 10  YVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFK 69
           Y+   ++ A       ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F 
Sbjct: 133 YISKYQDPAQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFY 192

Query: 70  RGANR 74
           + A +
Sbjct: 193 KQAKK 197

>AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH]
           complement(841793..842395) [603 bp, 200 aa]
          Length = 200

 Score = 36.6 bits (83), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 33/49 (67%)

Query: 26  LKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANR 74
           ++ E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A +
Sbjct: 144 VQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKK 192

>KLLA0D02684g complement(228564..229166) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6 SNARE protein for
           Endoplasmic Reticulum-Golgi transport singleton, start
           by similarity
          Length = 200

 Score = 35.0 bits (79), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 38/67 (56%)

Query: 8   DPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQG 67
           D Y+   ++ +       ++ E+D+T   +   I  V +RGE+L ++ DK+++L+ +++ 
Sbjct: 126 DIYIAKYQDPSQADAIMRVQQELDETKITLHKTIENVLQRGEKLDNLVDKSESLSAASRM 185

Query: 68  FKRGANR 74
           F + A +
Sbjct: 186 FYKQAKK 192

>Scas_659.11*
          Length = 215

 Score = 31.6 bits (70), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 5   VPYDPYVPATEETAGDSKTA----ALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADN 60
           V +D ++  T+    D K       L  E+    +IM  NI  +  RG+ L  + D + +
Sbjct: 111 VNFDSFLQKTKRIYSDKKVQDNLDQLNQELVGVQEIMSKNIEDLLYRGDSLEKMSDLSAS 170

Query: 61  LAVSAQGFKRGANRV 75
           L  S++ +++ A ++
Sbjct: 171 LKESSKRYRKSAQKI 185

>AGR020C [4330] [Homologous to ScYGR013W (SNU71) - SH]
           (751827..753587) [1761 bp, 586 aa]
          Length = 586

 Score = 27.3 bits (59), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 10/55 (18%)

Query: 31  DDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLK 85
           D+ VD + DNI + A RG+ L  +Q+  D+ +V          R+   +W K LK
Sbjct: 541 DELVDYILDNIVENASRGQLLLELQETFDDDSV----------RIVDAIWAKLLK 585

>Scas_673.12
          Length = 471

 Score = 26.9 bits (58), Expect = 3.3,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 3/58 (5%)

Query: 2  SSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMR---DNINKVAERGERLTSIQD 56
          +S  P  P    T     DSK ++   E DD     R    N+N V   GERL  +QD
Sbjct: 34 TSKKPVFPLKVETLPIDHDSKPSSRPEETDDGFQFKRHSNKNLNGVPSLGERLDYLQD 91

>Kwal_23.5273
          Length = 504

 Score = 26.9 bits (58), Expect = 3.5,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 15  EETAGDSKTAALKSEIDDTVDIMRDNINKVAERGE 49
           EET+ DS TA  +S+I+ T +  +  + K A+R +
Sbjct: 376 EETSRDSDTAGNRSKIEATSETSQARLEKNAQRNK 410

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score = 26.9 bits (58), Expect = 3.7,   Method: Composition-based stats.
 Identities = 12/42 (28%), Positives = 23/42 (54%)

Query: 2   SSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINK 43
           SSS+P   + P + +     + +  KS   +T+D  +D++NK
Sbjct: 500 SSSLPGTSFTPTSTKVNLKHENSPFKSTFVNTIDNSKDDLNK 541

>Scas_373.1
          Length = 694

 Score = 26.9 bits (58), Expect = 3.7,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 8   DPYVPATEETAGDSKTAALKSEIDDTVDIMRDNIN-KVAERGERLTSIQDKADN 60
           D Y    E+    S+T +L S + +T ++   +++  V E G R +S+ +  DN
Sbjct: 87  DSYYNDEEDGGELSRTISLPSRVSETPELSPSDVDWIVQEHGRRYSSVYNSDDN 140

>Kwal_56.24631
          Length = 422

 Score = 26.9 bits (58), Expect = 3.9,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 19/74 (25%)

Query: 6   PYDPYV------------PATEET-AGDSKTAALKSEID------DTVDIMRDNINKVAE 46
           PYDPY             P + E   G +  A L+++        + VD+ RD    VAE
Sbjct: 312 PYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAE 371

Query: 47  RGERLTSIQDKADN 60
            G+ L  I D A N
Sbjct: 372 YGKELDIIMDPAKN 385

>KLLA0A04708g complement(420317..421372) similar to sp|P53290
           Saccharomyces cerevisiae YGR163w GTR2 singleton, start
           by similarity
          Length = 351

 Score = 26.6 bits (57), Expect = 5.2,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 20  DSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADN 60
           D+   A  + +D  VDI +  + K+ E+ + +++ QD  DN
Sbjct: 292 DTDIEARLTVMDYNVDIFKRGLEKIWEKSKLISNSQDNDDN 332

>CAGL0L06908g complement(777557..778876) highly similar to sp|Q07478
           Saccharomyces cerevisiae YDL084w SUB2, start by
           similarity
          Length = 439

 Score = 25.8 bits (55), Expect = 8.7,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 23/47 (48%)

Query: 43  KVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMC 89
           K   R   LT + + ++  A++  G  +   R+ +   +KD + R+C
Sbjct: 307 KSTSRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRIC 353

>Scas_623.5
          Length = 446

 Score = 25.8 bits (55), Expect = 9.6,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 23/47 (48%)

Query: 43  KVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMC 89
           K   R   LT + + ++  A++  G  +   R+ +   +KD + R+C
Sbjct: 314 KSTNRANELTKLLNDSNFPAITVHGHMKQEERIARYKAFKDFEKRIC 360

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.128    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,789,231
Number of extensions: 90583
Number of successful extensions: 468
Number of sequences better than 10.0: 48
Number of HSP's gapped: 463
Number of HSP's successfully gapped: 48
Length of query: 109
Length of database: 16,596,109
Length adjustment: 79
Effective length of query: 30
Effective length of database: 13,861,287
Effective search space: 415838610
Effective search space used: 415838610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)