Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03839g33332817550.0
Kwal_34.160689993247064e-85
Kwal_33.156129993247064e-85
Kwal_33.145178132613113e-31
Kwal_14.7167671431136e-06
YNR060W (FRE4)719160770.13
Kwal_8.59962650710.84
KLLA0F08701g34653653.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03839g
         (328 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03839g complement(342782..343783) no similarity, hypotheti...   680   0.0  
Kwal_34.16068                                                         276   4e-85
Kwal_33.15612                                                         276   4e-85
Kwal_33.14517                                                         124   3e-31
Kwal_14.716                                                            48   6e-06
YNR060W (FRE4) [4643] chr14 (739948..742107) Protein involved in...    34   0.13 
Kwal_8.599                                                             32   0.84 
KLLA0F08701g 811112..812152 some similarities with sgd|S0005842 ...    30   3.4  

>KLLA0A03839g complement(342782..343783) no similarity, hypothetical
           start
          Length = 333

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/328 (100%), Positives = 328/328 (100%)

Query: 1   MQQSIRSSSVNEHGTAISQELNGSLQYTGTVNIIQTISIPSSNWDYSGSSKNKPHDTFLQ 60
           MQQSIRSSSVNEHGTAISQELNGSLQYTGTVNIIQTISIPSSNWDYSGSSKNKPHDTFLQ
Sbjct: 1   MQQSIRSSSVNEHGTAISQELNGSLQYTGTVNIIQTISIPSSNWDYSGSSKNKPHDTFLQ 60

Query: 61  PSDFHGYGSSSDSDRNIDSKSTAIQRSETHANEYLRSEAAFKRKFNFGFEDFSFNPFSKP 120
           PSDFHGYGSSSDSDRNIDSKSTAIQRSETHANEYLRSEAAFKRKFNFGFEDFSFNPFSKP
Sbjct: 61  PSDFHGYGSSSDSDRNIDSKSTAIQRSETHANEYLRSEAAFKRKFNFGFEDFSFNPFSKP 120

Query: 121 FLVMGPGEDNIRGQVEKRFNAWLSSSPYAIWVTKVKDESPFAVCKYEKCEHRFTLDGNPT 180
           FLVMGPGEDNIRGQVEKRFNAWLSSSPYAIWVTKVKDESPFAVCKYEKCEHRFTLDGNPT
Sbjct: 121 FLVMGPGEDNIRGQVEKRFNAWLSSSPYAIWVTKVKDESPFAVCKYEKCEHRFTLDGNPT 180

Query: 181 SSNIVRHLRRQHNRDYELFRKRLVNEQRVLDSFPTVHSSQSKPIAFTKKFLQFLSLNHSK 240
           SSNIVRHLRRQHNRDYELFRKRLVNEQRVLDSFPTVHSSQSKPIAFTKKFLQFLSLNHSK
Sbjct: 181 SSNIVRHLRRQHNRDYELFRKRLVNEQRVLDSFPTVHSSQSKPIAFTKKFLQFLSLNHSK 240

Query: 241 LRILNMFIEGFIPFSMIEAEGMKDVLSVFSTAGLPIISSRKGLVSLLSSCEKAFNEQLKH 300
           LRILNMFIEGFIPFSMIEAEGMKDVLSVFSTAGLPIISSRKGLVSLLSSCEKAFNEQLKH
Sbjct: 241 LRILNMFIEGFIPFSMIEAEGMKDVLSVFSTAGLPIISSRKGLVSLLSSCEKAFNEQLKH 300

Query: 301 SMRYSNHFNILIDMWTSSNQKDMWQLWR 328
           SMRYSNHFNILIDMWTSSNQKDMWQLWR
Sbjct: 301 SMRYSNHFNILIDMWTSSNQKDMWQLWR 328

>Kwal_34.16068
          Length = 999

 Score =  276 bits (706), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 200/324 (61%), Gaps = 3/324 (0%)

Query: 1   MQQSIRSSSVNEHGTAISQELNG-SLQYTGTVNIIQTISIPSSNWDYSGSSKNKPHDTFL 59
           + Q+++    N     + QE+ G  +Q   T  I Q IS P  N  Y+  ++   HD  +
Sbjct: 130 LSQTMQLPPSNNTEPIVCQEMTGLPIQRASTATINQVISFPVQNLRYTTKNRKGIHDPNI 189

Query: 60  QPSDFHGYGSSSDSDR--NIDSKSTAIQRSETHANEYLRSEAAFKRKFNFGFEDFSFNPF 117
           Q + F+ + SSSD+D     DS+       ++   + L +E +F+ K+ FGFE FS NPF
Sbjct: 190 QSNQFYHHSSSSDTDSHSKADSRELFAGTFKSQPRKALENEESFREKYGFGFETFSMNPF 249

Query: 118 SKPFLVMGPGEDNIRGQVEKRFNAWLSSSPYAIWVTKVKDESPFAVCKYEKCEHRFTLDG 177
            KPF               ++FN WL +SPY IWVTKV    PFAVCK+EKC H+F L G
Sbjct: 250 DKPFTDPTSRYHGTSEIQNRKFNTWLVTSPYGIWVTKVNGPEPFAVCKFEKCGHKFYLQG 309

Query: 178 NPTSSNIVRHLRRQHNRDYELFRKRLVNEQRVLDSFPTVHSSQSKPIAFTKKFLQFLSLN 237
           NPTSSNI+RH RRQH  DY+LFR RL  ++R LD F TV S   KP   TK+F+ FL+LN
Sbjct: 310 NPTSSNIIRHFRRQHRSDYDLFRGRLKRKERPLDHFSTVRSVNKKPFPLTKRFMSFLTLN 369

Query: 238 HSKLRILNMFIEGFIPFSMIEAEGMKDVLSVFSTAGLPIISSRKGLVSLLSSCEKAFNEQ 297
             K+ +LN+FIEGFIPFS +E   +K  L+     G   ISSRKGLVSLLS  ++ FN+Q
Sbjct: 370 MKKIHLLNVFIEGFIPFSFVETPVLKTFLTSHDVKGSMAISSRKGLVSLLSQFQEEFNQQ 429

Query: 298 LKHSMRYSNHFNILIDMWTSSNQK 321
           L H++RYS++ N+L+DMWTS++Q+
Sbjct: 430 LMHTLRYSHNMNLLLDMWTSTSQR 453

>Kwal_33.15612
          Length = 999

 Score =  276 bits (706), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 200/324 (61%), Gaps = 3/324 (0%)

Query: 1   MQQSIRSSSVNEHGTAISQELNG-SLQYTGTVNIIQTISIPSSNWDYSGSSKNKPHDTFL 59
           + Q+++    N     + QE+ G  +Q   T  I Q IS P  N  Y+  ++   HD  +
Sbjct: 130 LSQTMQLPPSNNTEPIVCQEMTGLPIQRASTATINQVISFPVQNLRYTTKNRKGIHDPNI 189

Query: 60  QPSDFHGYGSSSDSDR--NIDSKSTAIQRSETHANEYLRSEAAFKRKFNFGFEDFSFNPF 117
           Q + F+ + SSSD+D     DS+       ++   + L +E +F+ K+ FGFE FS NPF
Sbjct: 190 QSNQFYHHSSSSDTDSHSKADSRELFAGTFKSQPRKALENEESFREKYGFGFETFSMNPF 249

Query: 118 SKPFLVMGPGEDNIRGQVEKRFNAWLSSSPYAIWVTKVKDESPFAVCKYEKCEHRFTLDG 177
            KPF               ++FN WL +SPY IWVTKV    PFAVCK+EKC H+F L G
Sbjct: 250 DKPFTDPTSRYHGTSEIQNRKFNTWLVTSPYGIWVTKVNGPEPFAVCKFEKCGHKFYLQG 309

Query: 178 NPTSSNIVRHLRRQHNRDYELFRKRLVNEQRVLDSFPTVHSSQSKPIAFTKKFLQFLSLN 237
           NPTSSNI+RH RRQH  DY+LFR RL  ++R LD F TV S   KP   TK+F+ FL+LN
Sbjct: 310 NPTSSNIIRHFRRQHRSDYDLFRGRLKRKERPLDHFSTVRSVNKKPFPLTKRFMSFLTLN 369

Query: 238 HSKLRILNMFIEGFIPFSMIEAEGMKDVLSVFSTAGLPIISSRKGLVSLLSSCEKAFNEQ 297
             K+ +LN+FIEGFIPFS +E   +K  L+     G   ISSRKGLVSLLS  ++ FN+Q
Sbjct: 370 MKKIHLLNVFIEGFIPFSFVETPVLKTFLTSHDVKGSMAISSRKGLVSLLSQFQEEFNQQ 429

Query: 298 LKHSMRYSNHFNILIDMWTSSNQK 321
           L H++RYS++ N+L+DMWTS++Q+
Sbjct: 430 LMHTLRYSHNMNLLLDMWTSTSQR 453

>Kwal_33.14517
          Length = 813

 Score =  124 bits (311), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 125/261 (47%), Gaps = 16/261 (6%)

Query: 69  SSSDSDRNIDSKSTAIQRSETHANEYLRSEAAFKRKFNFGFEDFSFNPFSKPFLVMGPGE 128
           SS+  +  I +    + + +   ++  + E  FK  + F F +FS NP + P L     E
Sbjct: 4   SSASREDTIAAAIGQLHQQQDQESDPQQLERGFKDTYGFDFANFSINPCAIPNLDPSANE 63

Query: 129 DNIRGQVEKRFNAWLSSSPYAIWVTKVKDESPFAVCKYEKCEHRFTLDGNPTSSNIVRHL 188
                +V  +F+ WL  SP+ IWVTK+    P+A CKY  C+ +F  D +  +SNI++HL
Sbjct: 64  LQNEPKVYAKFHNWLRLSPFGIWVTKIARAKPYAQCKYAHCQLQFKFDDHANTSNIIKHL 123

Query: 189 RRQHNRDYELFRKRL--------VNEQRVLDSFPTVHSSQSKPIAFTKKFLQFLSLNHSK 240
           +R+H  D+ELF   L         + +R   S+P       KP +  K+ +  L      
Sbjct: 124 KRRHKDDFELFSALLGRNSNTKSGSSERSTTSYP------RKPFSARKELVPLLQNKLLP 177

Query: 241 LRILNMFIEGFIPFSMIEAEGMKDVLSVFSTAGLPIISSRKGLVSLLSSCEKAFNEQLKH 300
            R LN FI+  +P S+  A      L+  +   +  + S + LV  L      FN QLK 
Sbjct: 178 QRQLNFFIDTLLPLSVTSA--FAQFLTACNYTHIEFLLSTEELVVKLDEYYHEFNTQLKQ 235

Query: 301 SMRYSNHFNILIDMWTSSNQK 321
           ++R +   N+L++ W S + K
Sbjct: 236 ALRDTTAVNVLLETWYSPDGK 256

>Kwal_14.716
          Length = 767

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 69/143 (48%), Gaps = 9/143 (6%)

Query: 180 TSSNIVRHLRRQHNRDY-ELFRKRLVNEQRVLDSFPTVHSSQSKPIAFTKKFLQFLSLNH 238
           ++ N+ +H+   H   Y E+ RK   N +R LDS     + ++K +  ++  +  +  N 
Sbjct: 96  STGNLHKHIANNHYSQYREVERKE--NRRRTLDSL----AKKTKSLPLSQTLVAEIKHNS 149

Query: 239 SKLRILNMFIEGFIPFSMIEAEGMKDVLSVFSTAGLPIISSRKGLVSLLSSCEKAFNEQL 298
                ++M  E  +PFS +E+     +  + +   L  + SRK LV  L    ++F+E L
Sbjct: 150 GAFAAVSMITELILPFSTVESFSWNYLNGLIADTSL--LKSRKTLVDKLDQYTRSFDEAL 207

Query: 299 KHSMRYSNHFNILIDMWTSSNQK 321
              ++ +   N+ +D+W+  N +
Sbjct: 208 FECLQKTTFVNVQLDIWSGGNGR 230

>YNR060W (FRE4) [4643] chr14 (739948..742107) Protein involved in
           the uptake of iron from siderophore rhodotorulic acid,
           subject to regulation by iron [2160 bp, 719 aa]
          Length = 719

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 64/160 (40%), Gaps = 33/160 (20%)

Query: 198 LFRKRLVNEQRVLDSFPTVHSSQSKPIAFTKKFLQFLSLNHSKLRILNMFIEGFI----- 252
           +F+++LVN  R   + PT++   ++P ++ K    +L      L IL   I   I     
Sbjct: 189 MFQQKLVNYVRGYTTLPTLYEKHAEPFSYLKVITGYLPTRFETLVILGYLILHTIFMAYK 248

Query: 253 ----PFSMIEAEGMKDVL-------SVFSTAGLPII---SSRKGLVSLLSSCEKA----- 293
               P+ +I A    +V         + S A LP+I   + R   + L+S  +       
Sbjct: 249 YQYDPYHIIFAAHRAEVAHFVAYRSGILSFAHLPLIVLFAGRNNFLQLISGLKHTSFIVF 308

Query: 294 --------FNEQLKHSMRYSNHFNILIDMWTSSNQKDMWQ 325
                   F + + H+  ++N++ +    W +   +  W+
Sbjct: 309 HKWLGRMMFLDAIIHAAGFTNYY-LYYKKWNTVRLRVYWK 347

>Kwal_8.599
          Length = 626

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%)

Query: 272 AGLPIISSRKGLVSLLSSCEKAFNEQLKHSMRYSNHFNILIDMWTSSNQK 321
           A   ++ SRK LV  L    ++F+E L   ++ +   N+ +D+W+  N +
Sbjct: 40  ADTSLLKSRKTLVDKLDQYTRSFDEALFECLQKTTFVNVQLDIWSGGNGR 89

>KLLA0F08701g 811112..812152 some similarities with sgd|S0005842
           Saccharomyces cerevisiae YOR315w hypothetical protein,
           hypothetical start
          Length = 346

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 11/53 (20%)

Query: 66  GYGSSSDSD-------RNIDSKSTAIQRSETHANEYLRSEAAFKRKFNFGFED 111
           GY +SSD D       RN D+     +++   AN+   S+AA  R ++F FED
Sbjct: 255 GYYNSSDEDQDNLVYERNDDTN----EQNSKQANDKASSDAAVIRAYDFNFED 303

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,322,046
Number of extensions: 495429
Number of successful extensions: 1655
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1677
Number of HSP's successfully gapped: 31
Length of query: 328
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 226
Effective length of database: 13,065,073
Effective search space: 2952706498
Effective search space used: 2952706498
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)