Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03828g53052228010.0
Kwal_34.1606899952815040.0
Kwal_33.1561299952815040.0
Kwal_33.145178135145176e-57
Kwal_8.5996265164412e-47
Kwal_14.7167675164419e-47
Kwal_47.193063283002344e-21
Kwal_33.142893283002344e-21
Kwal_23.46093283002344e-21
Kwal_47.185515192752182e-18
Kwal_26.68933964001912e-15
Kwal_47.193043521321724e-13
Kwal_23.46103521321724e-13
Kwal_33.142874131691682e-12
Kwal_56.236192652211209e-07
AFR535C631204692.5
CAGL0L09471g41066682.6
AFR099C81975683.6
KLLA0C07623g58167665.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03828g
         (522 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03828g complement(341214..342806) weakly similar to sp|Q8S...  1083   0.0  
Kwal_34.16068                                                         583   0.0  
Kwal_33.15612                                                         583   0.0  
Kwal_33.14517                                                         203   6e-57
Kwal_8.599                                                            174   2e-47
Kwal_14.716                                                           174   9e-47
Kwal_47.19306                                                          95   4e-21
Kwal_33.14289                                                          95   4e-21
Kwal_23.4609                                                           95   4e-21
Kwal_47.18551                                                          89   2e-18
Kwal_26.6893                                                           78   2e-15
Kwal_47.19304                                                          71   4e-13
Kwal_23.4610                                                           71   4e-13
Kwal_33.14287                                                          69   2e-12
Kwal_56.23619                                                          51   9e-07
AFR535C [3727] [Homologous to NOHBY] (1393941..1395836) [1896 bp...    31   2.5  
CAGL0L09471g 1022210..1023442 highly similar to sp|P10363 Saccha...    31   2.6  
AFR099C [3291] [Homologous to ScYJL087C (TRL1) - SH] (612125..61...    31   3.6  
KLLA0C07623g 666694..668439 gi|11558095|emb|CAC17727.1 Kluyverom...    30   5.6  

>KLLA0A03828g complement(341214..342806) weakly similar to sp|Q8S2F8
           Oryza sativa P0003D09. 25 protein, hypothetical start
          Length = 530

 Score = 1083 bits (2801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/522 (100%), Positives = 522/522 (100%)

Query: 1   MASFCPNLNQMSRLKREDVTNGGKTSIHILDFIDLSCKRHTSENLKNALLSCLSEYSISH 60
           MASFCPNLNQMSRLKREDVTNGGKTSIHILDFIDLSCKRHTSENLKNALLSCLSEYSISH
Sbjct: 1   MASFCPNLNQMSRLKREDVTNGGKTSIHILDFIDLSCKRHTSENLKNALLSCLSEYSISH 60

Query: 61  KVSSITLDNGSNNISMLDGIDKALDLGFDLNGVRSISRIRCMNHVLNRVFLDLLNAFEKG 120
           KVSSITLDNGSNNISMLDGIDKALDLGFDLNGVRSISRIRCMNHVLNRVFLDLLNAFEKG
Sbjct: 61  KVSSITLDNGSNNISMLDGIDKALDLGFDLNGVRSISRIRCMNHVLNRVFLDLLNAFEKG 120

Query: 121 HESLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFLSRYRQLEVFLKVSKGAKE 180
           HESLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFLSRYRQLEVFLKVSKGAKE
Sbjct: 121 HESLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFLSRYRQLEVFLKVSKGAKE 180

Query: 181 FFFDNRFKPEFQLIPDDCSVFCYQEEELEYILFFVRIARIFQEVTMLLQDDTTNSLCNGI 240
           FFFDNRFKPEFQLIPDDCSVFCYQEEELEYILFFVRIARIFQEVTMLLQDDTTNSLCNGI
Sbjct: 181 FFFDNRFKPEFQLIPDDCSVFCYQEEELEYILFFVRIARIFQEVTMLLQDDTTNSLCNGI 240

Query: 241 KYYMTIRQYYKSCEELKNGSDDILHVANVGIKKTHLPSNTIKEQVFSAVMASYPKFEKYM 300
           KYYMTIRQYYKSCEELKNGSDDILHVANVGIKKTHLPSNTIKEQVFSAVMASYPKFEKYM
Sbjct: 241 KYYMTIRQYYKSCEELKNGSDDILHVANVGIKKTHLPSNTIKEQVFSAVMASYPKFEKYM 300

Query: 301 DFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFTETSDIRSH 360
           DFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFTETSDIRSH
Sbjct: 301 DFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFTETSDIRSH 360

Query: 361 NKPTEPLNINRVKKPKLLKNLSAYLDRNISEFHFAPKDEWQIYLGEPLEKEKDFLSYWLE 420
           NKPTEPLNINRVKKPKLLKNLSAYLDRNISEFHFAPKDEWQIYLGEPLEKEKDFLSYWLE
Sbjct: 361 NKPTEPLNINRVKKPKLLKNLSAYLDRNISEFHFAPKDEWQIYLGEPLEKEKDFLSYWLE 420

Query: 421 NQSRFPALCSLALAFYHTKLSTADVERSFSISKRVLDDRFSLASSNLKSTMIVRNRLMCF 480
           NQSRFPALCSLALAFYHTKLSTADVERSFSISKRVLDDRFSLASSNLKSTMIVRNRLMCF
Sbjct: 421 NQSRFPALCSLALAFYHTKLSTADVERSFSISKRVLDDRFSLASSNLKSTMIVRNRLMCF 480

Query: 481 NLGSKMPVTEHIATDSWTDDEDDMEHSNFSQQSFYDPAAVID 522
           NLGSKMPVTEHIATDSWTDDEDDMEHSNFSQQSFYDPAAVID
Sbjct: 481 NLGSKMPVTEHIATDSWTDDEDDMEHSNFSQQSFYDPAAVID 522

>Kwal_34.16068
          Length = 999

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/528 (55%), Positives = 374/528 (70%), Gaps = 7/528 (1%)

Query: 1   MASFCPNLNQMSRLKREDVTNGGKTSIHILDFIDLSCKRHTSENLKNALLSCLSEYSISH 60
           + SFCPNL++ S L   D+T GG  + HILDFIDLS +RHT+ N+K ALL CLS+YSI H
Sbjct: 459 IVSFCPNLDRKSSLMLNDITTGGNPNTHILDFIDLSNERHTAYNIKTALLRCLSKYSICH 518

Query: 61  KVSSITLDNGSNNISMLDGIDKALDLGFDLNGVRSISRIRCMNHVLNRVFLDLLNAFEKG 120
           K+ SITLDNGSNNI+ML+ +DK L  G   N    + +IRCMNHVLNRVFLDLL  FEK 
Sbjct: 519 KIGSITLDNGSNNIAMLETLDKDLQKGIGTNPEGGLVKIRCMNHVLNRVFLDLLKPFEKH 578

Query: 121 HESLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFLSRYRQLEVFLKVSKGAKE 180
           +  LLSRID+L  Y KSNVY+R KIRSYIP TIPKHN TRFLSR+RQLE FLKVSKG K 
Sbjct: 579 YRELLSRIDRLTYYLKSNVYVRRKIRSYIPHTIPKHNNTRFLSRHRQLEAFLKVSKGVKA 638

Query: 181 FFFDNRFKPEFQLIPDDCSVFCYQEEELEYILFFVRIARIFQEVTMLLQDDTTNSLCNGI 240
           FFFDNRF P++QL  +D S+FCY+++E+E ILFFVR+ RIFQE TM+LQDD+ N+L  GI
Sbjct: 639 FFFDNRFDPDYQLSQEDGSIFCYEQDEVETILFFVRLTRIFQEFTMMLQDDSMNNLPGGI 698

Query: 241 KYYMTIRQYYKSCEELKNGSDDILHVANVGIKKTHLP-SNTIKEQVFSAVMASYPKFEKY 299
           +YY+ I QY+++CE LKNGS     + ++G+K+++L       + V S+V+++ PKF KY
Sbjct: 699 EYYLHINQYFEACEMLKNGSTTTQQLQDIGLKESYLAIRKETHDVVLSSVLSARPKFTKY 758

Query: 300 MDFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFTETSDIRS 359
            D    EPG+WVAHI QP  KT +L  SF++SF+++V++S   YV  Y K F E  D  S
Sbjct: 759 RDLVNAEPGFWVAHILQPTVKTCVLTNSFDESFQKEVLQSVDKYVNLYIKDFREKHDSSS 818

Query: 360 HN----KPTEPLNINRVKKPKLLKNLSAYLDRNISEFHFAPKDEWQIYLGEPLEKEKDFL 415
                  PT   N     K K+L+ L     RN++  H + K EWQIYL EP+E   D+L
Sbjct: 819 DRPHLVSPTVDSNGTGGNKFKVLRILERSRVRNVAMHHASIKSEWQIYLDEPVEARSDYL 878

Query: 416 SYWLENQSRFPALCSLALAFYHTKLSTADVERSFSISKRVLDDRFSLASSNLKSTMIVRN 475
            YWL N+SRFPALCSLAL+ YHTKLSTADVER FSISKRVLD+RFSLAS NL+ TMI+RN
Sbjct: 879 GYWLGNRSRFPALCSLALSLYHTKLSTADVERCFSISKRVLDNRFSLASENLRRTMIIRN 938

Query: 476 RLMCFNLGSKMPVTEHIATDSWT--DDEDDMEHSNFSQQSFYDPAAVI 521
           R+ CF+L S+M   + +  +SW   DDE D   ++ + +S   P  +I
Sbjct: 939 RMKCFDLSSRMNKVKDLPLESWISDDDESDYNAADSATRSEAQPDQII 986

>Kwal_33.15612
          Length = 999

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/528 (55%), Positives = 374/528 (70%), Gaps = 7/528 (1%)

Query: 1   MASFCPNLNQMSRLKREDVTNGGKTSIHILDFIDLSCKRHTSENLKNALLSCLSEYSISH 60
           + SFCPNL++ S L   D+T GG  + HILDFIDLS +RHT+ N+K ALL CLS+YSI H
Sbjct: 459 IVSFCPNLDRKSSLMLNDITTGGNPNTHILDFIDLSNERHTAYNIKTALLRCLSKYSICH 518

Query: 61  KVSSITLDNGSNNISMLDGIDKALDLGFDLNGVRSISRIRCMNHVLNRVFLDLLNAFEKG 120
           K+ SITLDNGSNNI+ML+ +DK L  G   N    + +IRCMNHVLNRVFLDLL  FEK 
Sbjct: 519 KIGSITLDNGSNNIAMLETLDKDLQKGIGTNPEGGLVKIRCMNHVLNRVFLDLLKPFEKH 578

Query: 121 HESLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFLSRYRQLEVFLKVSKGAKE 180
           +  LLSRID+L  Y KSNVY+R KIRSYIP TIPKHN TRFLSR+RQLE FLKVSKG K 
Sbjct: 579 YRELLSRIDRLTYYLKSNVYVRRKIRSYIPHTIPKHNNTRFLSRHRQLEAFLKVSKGVKA 638

Query: 181 FFFDNRFKPEFQLIPDDCSVFCYQEEELEYILFFVRIARIFQEVTMLLQDDTTNSLCNGI 240
           FFFDNRF P++QL  +D S+FCY+++E+E ILFFVR+ RIFQE TM+LQDD+ N+L  GI
Sbjct: 639 FFFDNRFDPDYQLSQEDGSIFCYEQDEVETILFFVRLTRIFQEFTMMLQDDSMNNLPGGI 698

Query: 241 KYYMTIRQYYKSCEELKNGSDDILHVANVGIKKTHLP-SNTIKEQVFSAVMASYPKFEKY 299
           +YY+ I QY+++CE LKNGS     + ++G+K+++L       + V S+V+++ PKF KY
Sbjct: 699 EYYLHINQYFEACEMLKNGSTTTQQLQDIGLKESYLAIRKETHDVVLSSVLSARPKFTKY 758

Query: 300 MDFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFTETSDIRS 359
            D    EPG+WVAHI QP  KT +L  SF++SF+++V++S   YV  Y K F E  D  S
Sbjct: 759 RDLVNAEPGFWVAHILQPTVKTCVLTNSFDESFQKEVLQSVDKYVNLYIKDFREKHDSSS 818

Query: 360 HN----KPTEPLNINRVKKPKLLKNLSAYLDRNISEFHFAPKDEWQIYLGEPLEKEKDFL 415
                  PT   N     K K+L+ L     RN++  H + K EWQIYL EP+E   D+L
Sbjct: 819 DRPHLVSPTVDSNGTGGNKFKVLRILERSRVRNVAMHHASIKSEWQIYLDEPVEARSDYL 878

Query: 416 SYWLENQSRFPALCSLALAFYHTKLSTADVERSFSISKRVLDDRFSLASSNLKSTMIVRN 475
            YWL N+SRFPALCSLAL+ YHTKLSTADVER FSISKRVLD+RFSLAS NL+ TMI+RN
Sbjct: 879 GYWLGNRSRFPALCSLALSLYHTKLSTADVERCFSISKRVLDNRFSLASENLRRTMIIRN 938

Query: 476 RLMCFNLGSKMPVTEHIATDSWT--DDEDDMEHSNFSQQSFYDPAAVI 521
           R+ CF+L S+M   + +  +SW   DDE D   ++ + +S   P  +I
Sbjct: 939 RMKCFDLSSRMNKVKDLPLESWISDDDESDYNAADSATRSEAQPDQII 986

>Kwal_33.14517
          Length = 813

 Score =  203 bits (517), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 140/514 (27%), Positives = 247/514 (48%), Gaps = 22/514 (4%)

Query: 1   MASFCPN--LNQMSRLKREDVTNGGKTSIHILDFIDLSCKRHTSE-NLKNALLSCLSEYS 57
           MASFCPN  L     L+++ +T      IH+LD I+     HT++ ++   ++  L EY 
Sbjct: 262 MASFCPNVALQDQPVLRKQMITVKNGPGIHVLDLIN----THTTDRSITGLIIDVLEEYG 317

Query: 58  ISHKVSSITLDNGSNNI--SMLDGIDKALDLGFDLNGVRSISRIRCMNHVLNRVFLDLLN 115
           I+ K+ ++T++     +  S L+   K+  L   ++   S+S +R ++H++  +   L  
Sbjct: 318 ITSKIGALTVNPNETALGKSKLEADLKSKGL---VSHQGSLSDVRSLSHLIQDIISSLTL 374

Query: 116 AFEKGHESLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFLSRYRQLEVFLKVS 175
            F      LL R+D+L +   +N+++R      +      H I  +L+ YRQ+   LK  
Sbjct: 375 NFRTQFTPLLERVDRLTTKLTTNLHLRKSFPRLLNELDTAH-IGPYLATYRQICALLKWD 433

Query: 176 KGAKEFFFDN-RFKPEFQLIPDDCSVFCYQEEELEYILFFVRIARIFQEVTMLLQDDTTN 234
                FF +N +   +  L   D   F Y   EL  +  F   A         +Q+ + N
Sbjct: 434 DELDRFFLENVQNNDQCSLSASDEIDFRYTAPELATLRLFANAASPLYGFLSSIQNKSGN 493

Query: 235 SLCNGIKYYMTIRQYYKSCEELKNGSDDILHVANVGIKKTHLP--SNTIKEQVFSAVMAS 292
            L + + YY+ +  Y+++C+ + +G  +    A VG+ +  L   S   K  VFS +   
Sbjct: 494 VLSSALDYYLQLGHYFQACDRVLSGIFEEQDAATVGLTEQDLVAVSEGTKNIVFSILSQC 553

Query: 293 YPKFEKYMDFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFT 352
              F   +++A+ +P YW AH+ +P  KT +L  +F++ F+ + + S T +V  + +R +
Sbjct: 554 GTSFNAQLEWAYAQPVYWAAHMLRPQCKTRIL-ETFDEVFRAETLRSTTEFVNDFLQRNS 612

Query: 353 E--TSDIRSHNKPTEPLNINRVKKPK---LLKNLSAYLDRNISEFHFAPKDEWQIYLGEP 407
              T  I   +   +P  +++   PK   +L+N +    + I+E     + EW +YL EP
Sbjct: 613 AKGTLGIPLKDFQAKPKRVSKPVPPKKHTVLENAAETSIQEIAETELNYRSEWAVYLEEP 672

Query: 408 LEKEKDFLSYWLENQSRFPALCSLALAFYHTKLSTADVERSFSISKRVLDDRFSLASSNL 467
            E   D++ YWL NQ+RFP L  LAL+ + +K+S       F +S   L+   +    NL
Sbjct: 673 TEDSNDYVRYWLRNQTRFPQLTKLALSLHASKISCVPAHELFHMSSSALNSTITQPGLNL 732

Query: 468 KSTMIVRNRLMCFNLGSKMPVTEHIATDSWTDDE 501
           K   ++RNRL+ F  G  +     +  D W  DE
Sbjct: 733 KQATMLRNRLLSFETGHNLNYVRSVDADQWEADE 766

>Kwal_8.599
          Length = 626

 Score =  174 bits (441), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 145/516 (28%), Positives = 246/516 (47%), Gaps = 52/516 (10%)

Query: 2   ASFCPNLNQMSRLKREDVTNGGKTSI-----------HILDFIDLSCKRHTSENLKNALL 50
            SF PN      L+   + N G   I           H+LDF D S KRHT  NL   +L
Sbjct: 96  VSFAPN-----TLEARALGNAGDGRILMNNMAEPKNCHLLDFTDFSQKRHTGTNLCAKVL 150

Query: 51  SCLSEYSISHKVSSITLDNGSNNISMLDGI--DKALDLGFD----LNGVRSISRIRCMNH 104
             L+ ++I++KV+SIT+DN +NNI+    +  D    +G D    L+GVR    IRC +H
Sbjct: 151 EILNRFAITNKVASITVDNAANNIAFHSILIHDHLKVIGADCYTQLDGVR---LIRCASH 207

Query: 105 VLNRVFLDLLNAFEKGHE--SLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFL 162
           ++N  F  ++    +  +      RI K+A   K +  +R  I+ Y    IP     R++
Sbjct: 208 IINLQFQRVVEKLMEDEDINDAFQRISKVAERLKWSSQLRASIQEYDLPLIPLEPEVRWI 267

Query: 163 SRYRQLEVFLKVSKGAKEFFFDNRFKPEFQLIPDDCSVFCYQEEELEYILFFVRIARIFQ 222
            ++RQ++ FL+      E+F       E         +  +  E ++ + FF+   +IF+
Sbjct: 268 YKWRQVDCFLRNRASYLEWFAKVGCDNESTATRKLKELLYFTPETIQTLQFFIDACQIFK 327

Query: 223 EVTMLLQDDTTNSLCNGIKYYMTIRQYYKSCEELKNG------SDDILHVANVGIKKTHL 276
             T +LQDD T++L +G+  Y T+  +Y  C     G      SDD L ++ +  ++  L
Sbjct: 328 SFTDMLQDDETSNLPDGLSVYYTLNHFYDMCHLASKGHKIPEPSDDSLDLSFLNGREGLL 387

Query: 277 PSNTIKEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDV 336
           P    +  V  A++++   F +Y + A     Y+VA +  P  K D      ++      
Sbjct: 388 PER--RNLVLDAILSARATFNQYFETAKSNILYYVAAVLDPSSKFDNFIFLMQEDESRMR 445

Query: 337 IESATSYVVSYCKRFTETSDIRSHNKPTEPLNINRVKKPKLLK------NLSAYLDRNIS 390
           ++   +++ SY K+   T   +S  K    L+    +  K +K      NL+A +  N++
Sbjct: 446 LKEVDTFISSYLKK-CPTKIGKSWQKAEAKLSSRPGRVSKSMKVNVRNLNLAAGVASNLN 504

Query: 391 EFHFAPKDEWQIYLGEPL---EKEKDFLSYWLENQSRFPALCSLALAFYHTKLSTADVER 447
                  +EW++Y  + +       + + +W +++  +P L  LA++  +TK+ST+ VER
Sbjct: 505 ------INEWELYKHDKMVIGGSRNEVIEWWYDHRLHYPNLFVLAMSLIYTKISTSGVER 558

Query: 448 SFSISKRVLD-DRFSLASSNLKSTMIVRNRLMCFNL 482
            FSIS +VL  DR SL S N +  M++RNR   F L
Sbjct: 559 LFSISGKVLSKDRRSLHSDNTRRIMLMRNRFKSFGL 594

>Kwal_14.716
          Length = 767

 Score =  174 bits (441), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 145/516 (28%), Positives = 246/516 (47%), Gaps = 52/516 (10%)

Query: 2   ASFCPNLNQMSRLKREDVTNGGKTSI-----------HILDFIDLSCKRHTSENLKNALL 50
            SF PN      L+   + N G   I           H+LDF D S KRHT  NL   +L
Sbjct: 237 VSFAPNT-----LEARALGNAGDGRILMNNMAEPKNCHLLDFTDFSQKRHTGTNLCAKVL 291

Query: 51  SCLSEYSISHKVSSITLDNGSNNISMLDGI--DKALDLGFD----LNGVRSISRIRCMNH 104
             L+ ++I++KV+SIT+DN +NNI+    +  D    +G D    L+GVR    IRC +H
Sbjct: 292 EILNRFAITNKVASITVDNAANNIAFHSILIHDHLKVIGADCYTQLDGVR---LIRCASH 348

Query: 105 VLNRVFLDLLNAFEKGHE--SLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFL 162
           ++N  F  ++    +  +      RI K+A   K +  +R  I+ Y    IP     R++
Sbjct: 349 IINLQFQRVVEKLMEDEDINDAFQRISKVAERLKWSSQLRASIQEYDLPLIPLEPEVRWI 408

Query: 163 SRYRQLEVFLKVSKGAKEFFFDNRFKPEFQLIPDDCSVFCYQEEELEYILFFVRIARIFQ 222
            ++RQ++ FL+      E+F       E         +  +  E ++ + FF+   +IF+
Sbjct: 409 YKWRQVDCFLRNRASYLEWFAKVGCDNESTATRKLKELLYFTPETIQTLQFFIDACQIFK 468

Query: 223 EVTMLLQDDTTNSLCNGIKYYMTIRQYYKSCEELKNG------SDDILHVANVGIKKTHL 276
             T +LQDD T++L +G+  Y T+  +Y  C     G      SDD L ++ +  ++  L
Sbjct: 469 SFTDMLQDDETSNLPDGLSVYYTLNHFYDMCHLASKGHKIPEPSDDSLDLSFLNGREGLL 528

Query: 277 PSNTIKEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDV 336
           P    +  V  A++++   F +Y + A     Y+VA +  P  K D      ++      
Sbjct: 529 PER--RNLVLDAILSARATFNQYFETAKSNILYYVAAVLDPSSKFDNFIFLMQEDESRMR 586

Query: 337 IESATSYVVSYCKRFTETSDIRSHNKPTEPLNINRVKKPKLLK------NLSAYLDRNIS 390
           ++   +++ SY K+   T   +S  K    L+    +  K +K      NL+A +  N++
Sbjct: 587 LKEVDTFISSYLKK-CPTKIGKSWQKAEAKLSSRPGRVSKSMKVNVRNLNLAAGVASNLN 645

Query: 391 EFHFAPKDEWQIYLGEPL---EKEKDFLSYWLENQSRFPALCSLALAFYHTKLSTADVER 447
                  +EW++Y  + +       + + +W +++  +P L  LA++  +TK+ST+ VER
Sbjct: 646 ------INEWELYKHDKMVIGGSRNEVIEWWYDHRLHYPNLFVLAMSLIYTKISTSGVER 699

Query: 448 SFSISKRVLD-DRFSLASSNLKSTMIVRNRLMCFNL 482
            FSIS +VL  DR SL S N +  M++RNR   F L
Sbjct: 700 LFSISGKVLSKDRRSLHSDNTRRIMLMRNRFKSFGL 735

>Kwal_47.19306
          Length = 328

 Score = 94.7 bits (234), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 139/300 (46%), Gaps = 32/300 (10%)

Query: 207 ELEYIL-FFVRIARIFQEVTMLLQDDTTNSLCNGIKYYMTIRQYYKSCEELKNGSDDILH 265
           E +Y+L +FV    IF  +   LQ+D+ N L N + +Y T++ +Y+ C    +G  + + 
Sbjct: 9   ETKYLLEYFVGCCSIFNYLNDKLQNDSFNQLPNAVSFYFTLKDFYELCH---HGQTENIT 65

Query: 266 VANVGI-------KKTHLPSNTIKEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPH 318
           + + G         K  LP+  +K  V  AV+A+  KFE+Y D       Y+VA    P 
Sbjct: 66  LPSEGSFDYTFINGKPELPAE-LKFIVLEAVLATRLKFEEYFDLFRNNDIYFVAAFLDPT 124

Query: 319 RKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFTETSDIRSHNKPTEPLN--------IN 370
            K D  N    +   E        Y+  Y  R       +S  KP  P           N
Sbjct: 125 SKFDCFNELATEEEGEYHYHQVEFYIKGYLAR------CQSKKKPVPPCTELRSGNAKSN 178

Query: 371 RV-KKPKLLKNLSAYLDRNISEFHFAPKDEWQIYLGEP---LEKEKDFLSYWLENQSRFP 426
           +V K P+  K  +  +  ++++     ++EW+ Y  +     E   D + +W   +  +P
Sbjct: 179 KVCKIPRRDKRQTLAVHPSLTK-GIKVQEEWERYKADSQLNAETATDTIKWWYSRRLVYP 237

Query: 427 ALCSLALAFYHTKLSTADVERSFSISKRVL-DDRFSLASSNLKSTMIVRNRLMCFNLGSK 485
            L  LA++  +T+ S+  +ER+FSIS +++  DR SL S+N +  M++RNR   F L  K
Sbjct: 238 NLFPLAISMIYTRFSSCGMERTFSISGKLMRKDRRSLGSANTRRIMLLRNRFSNFGLFDK 297

>Kwal_33.14289
          Length = 328

 Score = 94.7 bits (234), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 139/300 (46%), Gaps = 32/300 (10%)

Query: 207 ELEYIL-FFVRIARIFQEVTMLLQDDTTNSLCNGIKYYMTIRQYYKSCEELKNGSDDILH 265
           E +Y+L +FV    IF  +   LQ+D+ N L N + +Y T++ +Y+ C    +G  + + 
Sbjct: 9   ETKYLLEYFVGCCSIFNYLNDKLQNDSFNQLPNAVSFYFTLKDFYELCH---HGQTENIT 65

Query: 266 VANVGI-------KKTHLPSNTIKEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPH 318
           + + G         K  LP+  +K  V  AV+A+  KFE+Y D       Y+VA    P 
Sbjct: 66  LPSEGSFDYTFINGKPELPAE-LKFIVLEAVLATRLKFEEYFDLFRNNDIYFVAAFLDPT 124

Query: 319 RKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFTETSDIRSHNKPTEPLN--------IN 370
            K D  N    +   E        Y+  Y  R       +S  KP  P           N
Sbjct: 125 SKFDCFNELATEEEGEYHYHQVEFYIKGYLAR------CQSKKKPVPPCTELRSGNAKSN 178

Query: 371 RV-KKPKLLKNLSAYLDRNISEFHFAPKDEWQIYLGEP---LEKEKDFLSYWLENQSRFP 426
           +V K P+  K  +  +  ++++     ++EW+ Y  +     E   D + +W   +  +P
Sbjct: 179 KVCKIPRRDKRQTLAVHPSLTK-GIKVQEEWERYKADSQLNAETATDTIKWWYSRRLVYP 237

Query: 427 ALCSLALAFYHTKLSTADVERSFSISKRVL-DDRFSLASSNLKSTMIVRNRLMCFNLGSK 485
            L  LA++  +T+ S+  +ER+FSIS +++  DR SL S+N +  M++RNR   F L  K
Sbjct: 238 NLFPLAISMIYTRFSSCGMERTFSISGKLMRKDRRSLGSANTRRIMLLRNRFSNFGLFDK 297

>Kwal_23.4609
          Length = 328

 Score = 94.7 bits (234), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 139/300 (46%), Gaps = 32/300 (10%)

Query: 207 ELEYIL-FFVRIARIFQEVTMLLQDDTTNSLCNGIKYYMTIRQYYKSCEELKNGSDDILH 265
           E +Y+L +FV    IF  +   LQ+D+ N L N + +Y T++ +Y+ C    +G  + + 
Sbjct: 9   ETKYLLEYFVGCCSIFNYLNDKLQNDSFNQLPNAVSFYFTLKDFYELCH---HGQTENIT 65

Query: 266 VANVGI-------KKTHLPSNTIKEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPH 318
           + + G         K  LP+  +K  V  AV+A+  KFE+Y D       Y+VA    P 
Sbjct: 66  LPSEGSFDYTFINGKPELPAE-LKFIVLEAVLATRLKFEEYFDLFRNNDIYFVAAFLDPT 124

Query: 319 RKTDLLNRSFEQSFKEDVIESATSYVVSYCKRFTETSDIRSHNKPTEPLN--------IN 370
            K D  N    +   E        Y+  Y  R       +S  KP  P           N
Sbjct: 125 SKFDCFNELATEEEGEYHYHQVEFYIKGYLAR------CQSKKKPVPPCTELRSGNAKSN 178

Query: 371 RV-KKPKLLKNLSAYLDRNISEFHFAPKDEWQIYLGEP---LEKEKDFLSYWLENQSRFP 426
           +V K P+  K  +  +  ++++     ++EW+ Y  +     E   D + +W   +  +P
Sbjct: 179 KVCKIPRRDKRQTLAVHPSLTK-GIKVQEEWERYKADSQLNAETATDTIKWWYSRRLVYP 237

Query: 427 ALCSLALAFYHTKLSTADVERSFSISKRVL-DDRFSLASSNLKSTMIVRNRLMCFNLGSK 485
            L  LA++  +T+ S+  +ER+FSIS +++  DR SL S+N +  M++RNR   F L  K
Sbjct: 238 NLFPLAISMIYTRFSSCGMERTFSISGKLMRKDRRSLGSANTRRIMLLRNRFSNFGLFDK 297

>Kwal_47.18551
          Length = 519

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 125/275 (45%), Gaps = 23/275 (8%)

Query: 2   ASFCPNLNQMSRLKREDVTNG-GKTSI----------HILDFIDLSCKRHTSENLKNALL 50
           ASF PNL        E V NG G  ++          H+LDFID+S  RHT E+L N++ 
Sbjct: 226 ASFAPNLTN------EKVLNGVGAQALLNNDQQPFNSHLLDFIDISDVRHTGEHLFNSIT 279

Query: 51  SCLSEYSISHKVSSITLDNGSNNISMLDGIDKAL---DLGFDLNGVRSISRIRCMNHVLN 107
             L+ + I+ KV SIT DN +NNISM   I   L   D             IRC +H+LN
Sbjct: 280 EVLTRFEITGKVGSITSDNATNNISMHSYILYNLMRSDKPETFQKTEHFHHIRCASHILN 339

Query: 108 RVFLDLLNAF--EKGHESLLSRIDKLASYTKSNVYIRNKIRSYIPCTIPKHNITRFLSRY 165
            +F  ++     +K  +  L +I +LA   K +  +R+ +       IP    TR++  +
Sbjct: 340 ILFQGIVKHLRKDKRFKRGLKQISELARTIKKSSLLRSSLADAGLPLIPSAPETRWVFIW 399

Query: 166 RQLEVFLKVSKGAKEFFFDNRFKPEFQLIPDDCSVFCYQEEELEYIL-FFVRIARIFQEV 224
           +Q+E +LK       +  + +   E + +            E +Y+L +FV    IF  +
Sbjct: 400 KQVETYLKYYDSYSNWATNLQASSEHKYVISKIMSHIDLSSETKYLLEYFVGCCSIFNYL 459

Query: 225 TMLLQDDTTNSLCNGIKYYMTIRQYYKSCEELKNG 259
              LQ+D+ N L     + +   ++ ++     NG
Sbjct: 460 NDKLQNDSFNQLPKCGVFLLYFERFLRAMSPWTNG 494

>Kwal_26.6893
          Length = 396

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 91/400 (22%), Positives = 169/400 (42%), Gaps = 44/400 (11%)

Query: 100 RCMNHVLNRVFL----DLLNAFEKGHESLLSRIDKLASYTKSNVYIRNKIRSYI--PCTI 153
           RC+N  L   F     DL+   +  HE    +I+KLA       +++N     +  P   
Sbjct: 11  RCINSGLELQFECVANDLIQDGDFQHE--YKKIEKLAQSWDRIPFLKNFADELVRPPFMS 68

Query: 154 PKHNITRFLSRYRQLEVFLKVSKGAKEFFFDNRFKPEFQLIPDDCSVFCYQEEELEYILF 213
            +HN  R +  +RQ+  FL+V +  KE+  +   + E   +        +    LE   F
Sbjct: 69  SQHNQARVV--WRQITRFLQVQQRLKEWLENANHQEEASTVQFLGENIYHTSRALEMFRF 126

Query: 214 FVRIARIFQEVTMLLQDDTTNSLCNGIKYYMTIRQYYKSCEELKNGSD-DILHVANVGIK 272
           FV    +F ++   +  D    L  GI  Y  + +++  CE    G   D    A +   
Sbjct: 127 FVDCCAVFDKLRGTMLTDGICYLPEGIYIYYRLNRFFIQCERASRGEHVDDEDFAYLNGS 186

Query: 273 KTHLPSNTIKEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPHRKTDLLNRSFEQSF 332
           K  LP +  K++V  AVM+S   F+ + +       ++VA    P  +   L  S+  + 
Sbjct: 187 KRLLPEH--KQRVLKAVMSSRQMFDGFFEGVKNNSLFYVAAALDPSCR---LEGSYNLTT 241

Query: 333 KED------VIESATSYVVSYCKRFTETSDIRSHNKPTEPLNINRVKKPKLLKNLSAYLD 386
            E+       IE      ++ C     +++    N   +    +  K+ KL +       
Sbjct: 242 PEEHNMLLCQIEVTVQDYLARCN----STEYEHENDAVQ----STTKRRKLAEEAQG--- 290

Query: 387 RNISEFHFAPKDEWQIYLGE---PLEKEKDFLSYWLENQSRFPALCSLALAFYHTKLSTA 443
                    P++EW  +  E   P    +D + +W ++++++P L  LA+A Y+T++S+ 
Sbjct: 291 -------MRPQNEWARFKTEAKLPSRLRRDVIQWWYDHRNKYPHLFRLAMALYYTQISSN 343

Query: 444 DVERSFSISKRVLDD-RFSLASSNLKSTMIVRNRLMCFNL 482
           + E  F +++  L   + S+  +N +  M++RNR   F L
Sbjct: 344 ETENIFYVTEHTLKVYQRSVGRANTQKVMLLRNRFKNFGL 383

>Kwal_47.19304
          Length = 352

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 66/132 (50%), Gaps = 20/132 (15%)

Query: 2   ASFCPNLNQMSRLKREDVTNG-GKTSI----------HILDFIDLSCKRHTSENLKNALL 50
           ASF PNL        E V NG G  ++          H+LDFID+S  RHT E+L N++ 
Sbjct: 226 ASFAPNLTN------EKVLNGVGAQALLNNDQQPFNSHLLDFIDISDVRHTGEHLFNSIT 279

Query: 51  SCLSEYSISHKVSSITLDNGSNNISMLDGIDKAL---DLGFDLNGVRSISRIRCMNHVLN 107
             L+ + I+ KV SIT DN +NNISM   I   L   D             IRC +H+LN
Sbjct: 280 EVLTRFEITGKVGSITSDNATNNISMHSYILYNLMRSDKPETFQKTEHFHHIRCASHILN 339

Query: 108 RVFLDLLNAFEK 119
            +F     AFEK
Sbjct: 340 ILFPGYSEAFEK 351

>Kwal_23.4610
          Length = 352

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 66/132 (50%), Gaps = 20/132 (15%)

Query: 2   ASFCPNLNQMSRLKREDVTNG-GKTSI----------HILDFIDLSCKRHTSENLKNALL 50
           ASF PNL        E V NG G  ++          H+LDFID+S  RHT E+L N++ 
Sbjct: 226 ASFAPNLTN------EKVLNGVGAQALLNNDQQPFNSHLLDFIDISDVRHTGEHLFNSIT 279

Query: 51  SCLSEYSISHKVSSITLDNGSNNISMLDGIDKAL---DLGFDLNGVRSISRIRCMNHVLN 107
             L+ + I+ KV SIT DN +NNISM   I   L   D             IRC +H+LN
Sbjct: 280 EVLTRFEITGKVGSITSDNATNNISMHSYILYNLMRSDKPETFQKTEHFHHIRCASHILN 339

Query: 108 RVFLDLLNAFEK 119
            +F     AFEK
Sbjct: 340 ILFPGYSEAFEK 351

>Kwal_33.14287
          Length = 413

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 80/169 (47%), Gaps = 22/169 (13%)

Query: 2   ASFCPNLNQMSRLKREDVTNG-GKTSI----------HILDFIDLSCKRHTSENLKNALL 50
           ASF PNL        E V NG G  ++          H+LDFID+S  RHT E+L N++ 
Sbjct: 226 ASFAPNLTN------EKVLNGVGAQALLNNDQQPFNSHLLDFIDISDVRHTGEHLFNSIT 279

Query: 51  SCLSEYSISHKVSSITLDNGSNNISMLDGIDKAL---DLGFDLNGVRSISRIRCMNHVLN 107
             L+ + I+ KV SIT DN +NNISM   I   L   D             IRC +H+LN
Sbjct: 280 EVLTRFEITGKVGSITSDNATNNISMHSYILYNLMRSDKPETFQKTEHFHHIRCASHILN 339

Query: 108 RVFLDLLNAFEKGH--ESLLSRIDKLASYTKSNVYIRNKIRSYIPCTIP 154
            +F  ++    K    +  L +I +LA   K +  +R+ +       IP
Sbjct: 340 ILFQGIVKHLRKDKRFKRGLKQISELARTIKKSSLLRSSLADAGLPLIP 388

>Kwal_56.23619
          Length = 265

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 99/221 (44%), Gaps = 21/221 (9%)

Query: 273 KTHLPSNTIKEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPHRKTDLLNR-SFEQS 331
           K  LP   +K  V  AV+A+   FE+Y D       Y+VA    P  K+D  +  + EQ 
Sbjct: 24  KLGLPVE-LKSAVLDAVLATRLTFEEYFDRFRSSQVYFVAAFLDPTSKSDCFDELATEQ- 81

Query: 332 FKEDVIESATSYVVSYC---KRFTETSDIRSHNKPTEPLNINRVKKPKLLKNLSAYLDRN 388
                 E    Y++  C   K     ++++S    TE   I ++  PK  K     +  +
Sbjct: 82  ------EREFHYLMRCCCMIKAAPACTELKSEK--TESHKICKI--PKRDKCRRQVVHPS 131

Query: 389 ISEFHFAPKDEWQIYLGEPLEKEKDFLSYWLENQSRFPALCSLALAFYHTKLSTADVERS 448
           ++++    K EW  Y GE        +  W   +  +P L  LA++  +TK+ T  + RS
Sbjct: 132 VTKWASVEK-EWGSYKGESQLSTGASIELWYSWRLVYPNLFPLAVSIIYTKIKTCGMGRS 190

Query: 449 FSISKRVLDDRFSLASSNLKSTMIVRNRLMCFN-LGSKMPV 488
             +   +L++  SL S+ L+  M+VR+R   F  LG +  V
Sbjct: 191 RRL---ILNNYESLRSAELRRIMLVRDRFSNFGHLGKEEEV 228

>AFR535C [3727] [Homologous to NOHBY] (1393941..1395836) [1896 bp,
           631 aa]
          Length = 631

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 76/204 (37%), Gaps = 32/204 (15%)

Query: 282 KEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDVIESAT 341
           K+ V   +M++   F  Y D  F  P  W A    P +K   + R F      D  +   
Sbjct: 452 KDAVLRCIMSTENIFHHYSDAFFTNPLPWTAITLNPTKKFSYIERMF-----PDHADIYK 506

Query: 342 SYVVSYCKRFTETSDIRSHNKPTEPLNINRVKKPKLLKNLSAYLDRNISEFHFAPKDEWQ 401
             V SY   +    D++           N V   + +    AYL R             Q
Sbjct: 507 DLVFSYLTFYVNHEDVKGE--------ANYVADTEFV----AYLTRPPMA---------Q 545

Query: 402 IYLGEPLEKEKDFLSYWLENQSRFPALCSLALAFYHTKLS--TADVERSFSISKRVLDDR 459
           + +G     +++ + YW + +  +P L  LA++  + + S  +A  E    IS     + 
Sbjct: 546 VKVG----AKENIVKYWFDRKELWPELSVLAVSMVYLRWSCTSALAELGDIISALRKTNG 601

Query: 460 FSLASSNLKSTMIVRNRLMCFNLG 483
             L   N +  + +R+ L+ F + 
Sbjct: 602 SRLRYPNFERLVKIRHHLIKFGMA 625

>CAGL0L09471g 1022210..1023442 highly similar to sp|P10363
           Saccharomyces cerevisiae YIR008c PRI1, start by
           similarity
          Length = 410

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 278 SNTIKEQVFSAVMASYPKFEKYMDFAFKEPGYWVAHISQPHRKTDLLNRSFEQSFKEDVI 337
           + TIK    S++   Y  + +Y+ + FK+   WV H  +P R  D++NR F  +F+    
Sbjct: 2   TETIKPNGPSSMDMQY--YYQYL-YPFKQIFQWVNHSQKPSR--DIINREFAMAFRSGAY 56

Query: 338 ESATSY 343
           +   SY
Sbjct: 57  KRYNSY 62

>AFR099C [3291] [Homologous to ScYJL087C (TRL1) - SH]
           (612125..614584) [2460 bp, 819 aa]
          Length = 819

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 276 LPSNTIKEQVFSAVMASYPKFEKYMDFAFK----EPGYWVAHISQP----HRKTDLLNRS 327
           LPS+++ E+ F   ++  P F K +  + +    +P YW A +S P    ++ +DL+ R 
Sbjct: 588 LPSDSVIEESFKNTLSYKPTFTKIIKSSPRNTKYKPTYWGAELSDPKLFINQVSDLIVRK 647

Query: 328 FEQSFKE--DVIESA 340
             +  +   D++E A
Sbjct: 648 RPEYLRGVLDIVEEA 662

>KLLA0C07623g 666694..668439 gi|11558095|emb|CAC17727.1
           Kluyveromyces lactis HOP1 protein, start by similarity
          Length = 581

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 266 VANVGIKKTHLPSNTIKEQVFSAVMASYPKFEKYMD-FAFKEPGYWVAHISQPHRKTDLL 324
           V  VGIK   L  NTI+EQ+ S +      F+   D     +   + + +++P + T +L
Sbjct: 231 VHKVGIKVLSLADNTIQEQLASGITTQLDPFDLLNDNIELPQDTPFNSQVNEPSQTTTML 290

Query: 325 NRSFEQS 331
            +    S
Sbjct: 291 QKYLRSS 297

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,922,480
Number of extensions: 806699
Number of successful extensions: 2519
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2566
Number of HSP's successfully gapped: 31
Length of query: 522
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 416
Effective length of database: 12,926,601
Effective search space: 5377466016
Effective search space used: 5377466016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)