Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03157g93892446630.0
Kwal_14.149893992535150.0
AEL301W95794034270.0
YGL167C (PMR1)95093733780.0
CAGL0I04312g95194033150.0
CAGL0J01870g94690428300.0
Scas_707.48*74173826100.0
Kwal_23.316011009099061e-106
KLLA0F20658g10829359011e-105
KLLA0E14630g10828988931e-104
YDR040C (ENA1)10918938871e-103
YDR038C (ENA5)10918938821e-102
AGL097C10968988811e-102
YDR039C (ENA2)10918928401e-96
Kwal_47.1754712409677933e-89
CAGL0A00517g112210377866e-89
AFL011W124210487378e-82
KLLA0A08910g12809586723e-73
YGL008C (PMA1)9187335732e-61
AGL085C9097335662e-60
CAGL0K12034g10875295658e-60
Scas_688.19137385582e-59
Kwal_47.175228997355556e-59
Scas_710.419047335502e-58
KLLA0A09031g8997305493e-58
YPL036W (PMA2)9477335461e-57
YGL006W (PMC1)11734825463e-57
CAGL0A00495g9027025211e-54
Scas_297.18002744052e-40
Scas_569.0d4682183595e-36
KLLA0B08217g14398213182e-29
AFR567W14498492879e-26
Scas_665.3014398542861e-25
CAGL0M11308g14528222799e-25
Kwal_26.920714698582621e-22
KLLA0F07447g9755932592e-22
YOR291W14728342467e-21
CAGL0L01419g12146162191e-17
KLLA0E22352g12066162144e-17
YEL031W (SPF1)12156182046e-16
Scas_583.14*8754141973e-15
YIL048W (NEO1)11516971957e-15
AFR354C12104341931e-14
CAGL0L00715g11446791885e-14
Scas_704.3811617001841e-13
ADL079C11666811795e-13
YDR270W (CCC2)10041571723e-12
KLLA0D04092g11522421715e-12
KLLA0C08393g11486731715e-12
ACR086C8101671662e-11
Sklu_2193.111437101662e-11
Kwal_55.215759892951652e-11
Scas_615.99421481634e-11
AGL041C12332101591e-10
Kwal_23.578911337091545e-10
CAGL0M08602g10121431535e-10
YBR295W (PCA1)12162031393e-08
KLLA0A04015g13434601393e-08
ADR350W13114761223e-06
Kwal_26.707013153081189e-06
CAGL0G06270g13283051171e-05
CAGL0H04477g16263361162e-05
KLLA0E01650g15502591027e-04
YMR162C (DNF3)1656259990.002
Scas_89.1271231960.002
KLLA0C17644g1576199980.002
Scas_669.31638133960.003
YAL026C (DRS2)1355307960.003
Scas_636.161554439930.007
YDR093W (DNF2)1612217910.012
YER166W (DNF1)1571174890.024
Scas_576.81591203880.030
AFL191W1575237860.046
CAGL0G08085g1578173850.061
CAGL0L11814g1576174790.36
Kwal_23.35561597186780.45
AGR120C154746741.3
YDL150W (RPC53)42267712.2
YLR347C (KAP95)86128712.6
Scas_227.0d30742693.9
Scas_505.4102563695.6
Kwal_47.1932148696686.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03157g
         (924 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....  1800   0.0  
Kwal_14.1498                                                         1358   0.0  
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...  1324   0.0  
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...  1305   0.0  
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...  1281   0.0  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...  1094   0.0  
Scas_707.48*                                                         1009   0.0  
Kwal_23.3160                                                          353   e-106
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...   351   e-105
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   348   e-104
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...   346   e-103
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...   344   e-102
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....   343   e-102
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...   328   1e-96
Kwal_47.17547                                                         310   3e-89
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   307   6e-89
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   288   8e-82
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   263   3e-73
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   225   2e-61
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   222   2e-60
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...   222   8e-60
Scas_688.1                                                            219   2e-59
Kwal_47.17522                                                         218   6e-59
Scas_710.41                                                           216   2e-58
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   216   3e-58
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   214   1e-57
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   214   3e-57
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   205   1e-54
Scas_297.1                                                            160   2e-40
Scas_569.0d                                                           142   5e-36
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   127   2e-29
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...   115   9e-26
Scas_665.30                                                           114   1e-25
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...   112   9e-25
Kwal_26.9207                                                          105   1e-22
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...   104   2e-22
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    99   7e-21
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    89   1e-17
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    87   4e-17
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    83   6e-16
Scas_583.14*                                                           80   3e-15
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    80   7e-15
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    79   1e-14
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    77   5e-14
Scas_704.38                                                            75   1e-13
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    74   5e-13
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    71   3e-12
KLLA0D04092g complement(344666..348124) some similarities with s...    70   5e-12
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    70   5e-12
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    69   2e-11
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          69   2e-11
Kwal_55.21575                                                          68   2e-11
Scas_615.9                                                             67   4e-11
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    66   1e-10
Kwal_23.5789                                                           64   5e-10
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    64   5e-10
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    58   3e-08
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    58   3e-08
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    52   3e-06
Kwal_26.7070                                                           50   9e-06
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    50   1e-05
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    49   2e-05
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    44   7e-04
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    43   0.002
Scas_89.1                                                              42   0.002
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    42   0.002
Scas_669.3                                                             42   0.003
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    42   0.003
Scas_636.16                                                            40   0.007
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    40   0.012
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    39   0.024
Scas_576.8                                                             39   0.030
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    38   0.046
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    37   0.061
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    35   0.36 
Kwal_23.3556                                                           35   0.45 
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    33   1.3  
YDL150W (RPC53) [718] chr4 (183344..184612) RNA polymerase III, ...    32   2.2  
YLR347C (KAP95) [3730] chr12 complement(823827..826412) Karyophe...    32   2.6  
Scas_227.0d                                                            31   3.9  
Scas_505.4                                                             31   5.6  
Kwal_47.19321                                                          31   6.6  

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 1800 bits (4663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 882/924 (95%), Positives = 882/924 (95%)

Query: 1   MSDNPFESYLARDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIA 60
           MSDNPFESYLARDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIA
Sbjct: 1   MSDNPFESYLARDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIA 60

Query: 61  YRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNXXXXXXXXXXXX 120
           YRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGN            
Sbjct: 61  YRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNIDDSISIALAII 120

Query: 121 XXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPA 180
              TVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPA
Sbjct: 121 IVVTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPA 180

Query: 181 DLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVR 240
           DLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVR
Sbjct: 181 DLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVR 240

Query: 241 EGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXXXXXX 300
           EGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFV         
Sbjct: 241 EGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVLIGIICLIG 300

Query: 301 XXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSV 360
             QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSV
Sbjct: 301 IIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSV 360

Query: 361 NVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNIC 420
           NVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNIC
Sbjct: 361 NVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNIC 420

Query: 421 NNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSKRKFMAVKTIDAN 480
           NNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSKRKFMAVKTIDAN
Sbjct: 421 NNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSKRKFMAVKTIDAN 480

Query: 481 DKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELE 540
           DKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELE
Sbjct: 481 DKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELE 540

Query: 541 VSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAV 600
           VSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAV
Sbjct: 541 VSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAV 600

Query: 601 SIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRG 660
           SIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRG
Sbjct: 601 SIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRG 660

Query: 661 DIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIF 720
           DIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIF
Sbjct: 661 DIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIF 720

Query: 721 NNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDH 780
           NNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDH
Sbjct: 721 NNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDH 780

Query: 781 EVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAEDGQVTSRDTTMTFTCF 840
           EVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAEDGQVTSRDTTMTFTCF
Sbjct: 781 EVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAEDGQVTSRDTTMTFTCF 840

Query: 841 VFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCAIYIPFFQGIFKTEXXXX 900
           VFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCAIYIPFFQGIFKTE    
Sbjct: 841 VFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCAIYIPFFQGIFKTESLSL 900

Query: 901 XXXXXXXXXXXXVFIGDEIRKYYV 924
                       VFIGDEIRKYYV
Sbjct: 901 GDLLFLLTLSSSVFIGDEIRKYYV 924

>Kwal_14.1498
          Length = 939

 Score = 1358 bits (3515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/925 (71%), Positives = 756/925 (81%), Gaps = 3/925 (0%)

Query: 1   MSDNPFESYLARDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIA 60
           MSDNPF SYL R +       +VLS+P  SLE+C++SVE+T   LGTD  NGL   S + 
Sbjct: 1   MSDNPFNSYLDRSKDREASTAEVLSRPQPSLEFCSLSVEETAQSLGTDTQNGLPTMSVVE 60

Query: 61  YRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNXXXXXXXXXXXX 120
            R++ +G NE+  +E   LW KF++TF+ DPLILLLIGSAVISF+MGN            
Sbjct: 61  ERRAQYGKNEISSEEDEPLWWKFVTTFVGDPLILLLIGSAVISFIMGNIDDAVSITLAIV 120

Query: 121 XXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPA 180
              TVGFVQEY+SEKSLEALN+LVP +CHL R GQ S +LAS LVPGD+VRF+VGDRIPA
Sbjct: 121 IVVTVGFVQEYRSEKSLEALNRLVPDQCHLIRCGQESKLLASVLVPGDVVRFRVGDRIPA 180

Query: 181 DLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVR 240
           DLRI+E++DL ++ESNLTGENEPVHKS+  V+ + Y    GSI+PV +R+CI FMGTLVR
Sbjct: 181 DLRIIEAVDLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPVSERSCIAFMGTLVR 240

Query: 241 EGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXXXXXX 300
           EGHG+GIVI T K+T FG VFEMM+ I+KPKTPLQTAMDKLG+DLS+MSF+         
Sbjct: 241 EGHGRGIVIGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKDLSFMSFIVIGIICLIG 300

Query: 301 XXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSV 360
             QGRSWLEMFQI+VSLAVAAIPEGLPIIVTVTLALGVLRMAKR+AI+RRLPSVETLGSV
Sbjct: 301 VIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVETLGSV 360

Query: 361 NVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIK--MEQDVATTLRIGN 418
           NVICSDKTGTLTANHM+V+K+WCLGSM NK+N L L K      K  + +D+  TLR GN
Sbjct: 361 NVICSDKTGTLTANHMSVNKVWCLGSMSNKSNILKLDKATSGSFKKNLTEDLRATLRTGN 420

Query: 419 ICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSKRKFMAVKTID 478
           +CNN TYS EH KYLGNPTDIA+LE L  FG+ D R  V + +EI FNSKRKFMAVK  +
Sbjct: 421 LCNNSTYSHEHAKYLGNPTDIALLEVLHKFGLEDERPQVTRSDEISFNSKRKFMAVKVKE 480

Query: 479 ANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAE 538
           AN K VV+VKGA+EKI+EKS ++I  + KV KL  N +  I D+A ALAS+GLRTLAFA+
Sbjct: 481 ANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQAITDSADALASDGLRTLAFAQ 540

Query: 539 LEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENT 598
           LE+S     K+  ED + GLTF GL+ MNDPPRP+V++A+E L +GSVH+IMITGDAENT
Sbjct: 541 LELS-NGNSKKLTEDDINGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENT 599

Query: 599 AVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQK 658
           AVSIARQIGIPV+NPE +VL+GDKLD M++DQLAS+IDHVN+FARATPEHKLNIVRALQK
Sbjct: 600 AVSIARQIGIPVVNPETAVLTGDKLDHMSEDQLASIIDHVNIFARATPEHKLNIVRALQK 659

Query: 659 RGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 718
           RGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKG
Sbjct: 660 RGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 719

Query: 719 IFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPV 778
           IFNNIQNFLTFQLSTSVAALSLVAI+T+ KLPNPLNAMQILWINILMDGPPAQSLGVEPV
Sbjct: 720 IFNNIQNFLTFQLSTSVAALSLVAIATAFKLPNPLNAMQILWINILMDGPPAQSLGVEPV 779

Query: 779 DHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAEDGQVTSRDTTMTFT 838
           DHEVM+KPPRKR DKILT AV +R+L SA  II+GTIYVF+KEMAEDG+VT+RDTTMTFT
Sbjct: 780 DHEVMKKPPRKRADKILTKAVFQRLLQSAALIIIGTIYVFIKEMAEDGEVTARDTTMTFT 839

Query: 839 CFVFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCAIYIPFFQGIFKTEXX 898
           CFVFFDMFNAL+CRH+TKSIFE+G FANKMFNYAV  SLLGQ+CAIY+PFFQ IFKTE  
Sbjct: 840 CFVFFDMFNALACRHSTKSIFEVGIFANKMFNYAVGCSLLGQVCAIYVPFFQSIFKTERL 899

Query: 899 XXXXXXXXXXXXXXVFIGDEIRKYY 923
                         VFI DE+RK Y
Sbjct: 900 SLGDLAFLLLLSSTVFIADELRKLY 924

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 1324 bits (3427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/940 (70%), Positives = 754/940 (80%), Gaps = 21/940 (2%)

Query: 1   MSDNPFESYLARDQ-----QPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSN 55
           MSDNPF+SYL R +     +    A +   +PNASLEYCT++V++T+ QL TD   GL +
Sbjct: 7   MSDNPFDSYLNRSKDDSSMETKSLASEAFLKPNASLEYCTMTVDETLRQLNTDSAKGLCD 66

Query: 56  PSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNXXXXXXX 115
             ++   +  WG+NEV  D +  +WK+F+STF+EDPLILLLIGSAV+SFLMGN       
Sbjct: 67  QQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLMGNIDDAVSI 126

Query: 116 XXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVG 175
                   +VGFVQEY+SEKSLEAL+KLVPA CHL R G  +HVLAS LVPGDLV FKVG
Sbjct: 127 TLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVG 186

Query: 176 DRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFM 235
           DRIPAD+RI+ES DL +DES LTGE EPVHKS   V+   YS +PG IIP+G+R  I +M
Sbjct: 187 DRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYM 246

Query: 236 GTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXX 295
           GTLVREGHGKGIV+ATGKHT+FG+VFEMM+ I+KPKTPLQ AMD L +DLSY+ FV    
Sbjct: 247 GTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGI 306

Query: 296 XXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 355
                  QGRSWLEMFQI+VSLAVAAIPEGLPIIVTVTLALGVLRMA RKAIVRRLPSVE
Sbjct: 307 IFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVE 366

Query: 356 TLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALS---------KVKERPIKM 406
           TLGSVNVICSDKTGTLTANHMT SKIWCLGSM NK N L+L          K+      +
Sbjct: 367 TLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPGKLPNLKNYL 426

Query: 407 EQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFN 466
             DV  TLRIG+ICNN ++S EH KYLGNPTDIA+LE LQ F + D R +  +++E+ FN
Sbjct: 427 SDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTTTRVDELTFN 486

Query: 467 SKRKFMAVKTIDA---NDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAA 523
           SKRK+MAVK +D+   + K ++YVKGAFE+I+E+S ++IG  GKV KL  + K++IND A
Sbjct: 487 SKRKYMAVK-VDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCA 545

Query: 524 VALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQ 583
            +LASEGLRTLAFA+LE S    +K  N+  ++ LTF GLI M DPPR TVR AIEELLQ
Sbjct: 546 KSLASEGLRTLAFAQLECST---NKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQ 602

Query: 584 GSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFAR 643
           G VHVIMITGDAENTAV+IARQIGIPVINPE SVL+GD+LDQMTDDQLA VIDHVN+FAR
Sbjct: 603 GGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFAR 662

Query: 644 ATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTD 703
           ATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV+MG MGTDVAKEASDMVLTD
Sbjct: 663 ATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTD 722

Query: 704 DDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINI 763
           DDFSTILTAIEEGKGIFNNIQ+FLTFQLSTSVAALSLVAI+T+ KL NPLNAMQILWINI
Sbjct: 723 DDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINI 782

Query: 764 LMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMA 823
           LMDGPPAQSLGVEPVDHEVMRKPPRKR+DKILT  V++R+LI+A FII GTIYVF+KEM 
Sbjct: 783 LMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYVFIKEMT 842

Query: 824 EDGQVTSRDTTMTFTCFVFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCA 883
           EDGQVT+RDTTMTFTCFVFFDMF+AL+CRHATKSIFEIG F NKMFNYAV  SLLGQLCA
Sbjct: 843 EDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFSLLGQLCA 902

Query: 884 IYIPFFQGIFKTEXXXXXXXXXXXXXXXXVFIGDEIRKYY 923
           IYIPFFQ IFKTE                VFI DE+RKYY
Sbjct: 903 IYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRKYY 942

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 1305 bits (3378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/937 (68%), Positives = 755/937 (80%), Gaps = 16/937 (1%)

Query: 1   MSDNPFESYLA-----RDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSN 55
           MSDNPF + L      R+++      + LS+P+ SLEYCT+SV++ + +L TD + GL +
Sbjct: 1   MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS 60

Query: 56  PSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNXXXXXXX 115
            +E   R+S++G NE+  ++  SL+KKFLS FIED +ILLLIGSAV+S  MGN       
Sbjct: 61  SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120

Query: 116 XXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVG 175
                   TVGFVQEY+SEKSLEALNKLVPAECHL R GQ SHVLAS LVPGDLV F++G
Sbjct: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG 180

Query: 176 DRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFM 235
           DRIPAD+RI+E+IDL +DESNLTGENEPVHK+S  ++  +++  P SI+P+ +R+CI +M
Sbjct: 181 DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM 240

Query: 236 GTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXX 295
           GTLV+EGHGKGIV+ TG +T FG+VFEMM+ I+KPKTPLQ  MDKLG+DLS +SF+    
Sbjct: 241 GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM 300

Query: 296 XXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 355
                  QGRSWLEMFQI+VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
Sbjct: 301 ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360

Query: 356 TLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIK-------MEQ 408
           TLGSVNVICSDKTGTLT+NHMTVSK+WCL SM NK N L+L K K+           + +
Sbjct: 361 TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE 420

Query: 409 DVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSK 468
           DV  TL IGN+CNN ++SQEH  +LGNPTD+A+LE L +F + D RN+V K+ E+PFNSK
Sbjct: 421 DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK 480

Query: 469 RKFMAVKTID-ANDKVVVYVKGAFEKIVEKSINYIGRDGK-VHKLKPNDKAIINDAAVAL 526
           RK MA K ++  ++K  VYVKGAFE+I+E S +Y+   GK   KL    KA IN+ A ++
Sbjct: 481 RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM 540

Query: 527 ASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSV 586
           ASEGLR   FA+L +S +       ED+++ LTFTGLI MNDPPRP V+ AIE+LLQG V
Sbjct: 541 ASEGLRVFGFAKLTLSDSS--TPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGV 598

Query: 587 HVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATP 646
           H+IMITGD+ENTAV+IA+QIGIPVI+P+ SVLSGDKLD+M+DDQLA+VIDHVN+FARATP
Sbjct: 599 HIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATP 658

Query: 647 EHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDF 706
           EHKLNIVRAL+KRGD+VAMTGDGVNDAPALKL+DIGVSMG++GTDVAKEASDMVLTDDDF
Sbjct: 659 EHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDF 718

Query: 707 STILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMD 766
           STILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVA+ST+ KLPNPLNAMQILWINILMD
Sbjct: 719 STILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMD 778

Query: 767 GPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAEDG 826
           GPPAQSLGVEPVDHEVM+KPPRKRTDKILT  V+KR+L +A  IIVGT+Y+FVKEMAEDG
Sbjct: 779 GPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDG 838

Query: 827 QVTSRDTTMTFTCFVFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCAIYI 886
           +VT+RDTTMTFTCFVFFDMFNAL+CRH TKSIFEIGFF NKMFNYAV LSLLGQ+CAIYI
Sbjct: 839 KVTARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYI 898

Query: 887 PFFQGIFKTEXXXXXXXXXXXXXXXXVFIGDEIRKYY 923
           PFFQ IFKTE                VFI DE+RK +
Sbjct: 899 PFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLW 935

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 1281 bits (3315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/940 (67%), Positives = 737/940 (78%), Gaps = 19/940 (2%)

Query: 1   MSDNPFESYLARDQQPPQPAVDV--------------LSQPNASLEYCTVSVEDTIAQLG 46
           MSDNPF +Y  +D+     +  +              L++PN SLEYCT+SVE+T+ +L 
Sbjct: 1   MSDNPF-TYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLD 59

Query: 47  TDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLM 106
           TD   GLS+  E   R+  +G NE+  D+  SL KKFLS F+ED LILLL+GSA+IS  +
Sbjct: 60  TDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFL 119

Query: 107 GNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVP 166
           GN               TVGFVQEY+SEKSLEALNKLVP ECHL R G+ S+VLA+NLVP
Sbjct: 120 GNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVP 179

Query: 167 GDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPV 226
           GDLVRF++GDRIPAD+RI+E  DL +DESNLTGE +PVHKS  A+   +Y+  P SI+PV
Sbjct: 180 GDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPV 239

Query: 227 GDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLS 286
            +R  I +MGTLV+EG+G+GIV+ TG+ T FG+VFEMMS I+KPKTPLQ  MDKLG+DLS
Sbjct: 240 AERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLS 299

Query: 287 YMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 346
             SFV           QGRSWLEMFQI+VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA
Sbjct: 300 LASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 359

Query: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIK- 405
           IVRRLPSVETLGSVNVICSDKTGTLT+NHMTVSKIWCLGSM NK N L+L K K   +K 
Sbjct: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKN 419

Query: 406 -MEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIP 464
            +  DV TTL  GN+CNN +YSQEH KYLGNPTD+A+LE LQ F + D R+   K+ E+ 
Sbjct: 420 YLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELS 479

Query: 465 FNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAV 524
           FNSKRK MA K  D   K  +++KGAFE+I++KS +Y+   GK+ KL    +  I D A 
Sbjct: 480 FNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCAN 539

Query: 525 ALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQG 584
            LASEGLR LAFA+   + T    +  ED +  L FTGLI MNDPPR +V+ AI++ LQG
Sbjct: 540 TLASEGLRVLAFAKR--AMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQG 597

Query: 585 SVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARA 644
            +H+IMITGD+ENTAV+IARQIGIPVI+P+ SVLSGDKL++MTDDQLA+VIDHVN+FARA
Sbjct: 598 GIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARA 657

Query: 645 TPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDD 704
           TPEHKLNIVRAL++RGD+VAMTGDGVNDAPALKLADIGVSMG+MGTDVAKEASDM+LTDD
Sbjct: 658 TPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDD 717

Query: 705 DFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINIL 764
           DFSTILTAIEEGKGIFNNIQNFL+FQLSTS+AALSLVA+ST+  LPNPLNAMQILWINIL
Sbjct: 718 DFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINIL 777

Query: 765 MDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAE 824
           MDGPPAQSLGVEPVDHEVM+KPPRKRTDKILT  +LKR++ +A  II+GT+YVFVKEMAE
Sbjct: 778 MDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVKEMAE 837

Query: 825 DGQVTSRDTTMTFTCFVFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCAI 884
           DGQVT+RDTTMTFTCFVFFDMFNAL+CRH TKSIFEIGFF NKMFN AV  SLLGQ+CAI
Sbjct: 838 DGQVTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQMCAI 897

Query: 885 YIPFFQGIFKTEXXXXXXXXXXXXXXXXVFIGDEIRKYYV 924
           YIPFFQ IFKTE                VFI DEIRKY+V
Sbjct: 898 YIPFFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRKYWV 937

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/904 (59%), Positives = 686/904 (75%), Gaps = 7/904 (0%)

Query: 18  QPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKV 77
           + A ++L++PN SL++CT+SV +T+  L TD DNGLS+  E+  R+ I G N+   D+  
Sbjct: 33  EEAYELLNRPNPSLKFCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDE 92

Query: 78  SLWKKFLSTFIEDPLILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSL 137
           S+ KKFL +F+ED LILLLIGSAV+SF +G                TVGF+QEY+SEKSL
Sbjct: 93  SMIKKFLMSFVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSL 152

Query: 138 EALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNL 197
           EALNKLVP +CHL R G+ S+ LAS LVPGDLVRFK+GDRIPAD+RI+E++DL +DESNL
Sbjct: 153 EALNKLVPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNL 212

Query: 198 TGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVF 257
           TGE EP+HK +  +DP+ Y +     +PV +R+CI +MGTLV+EGHGKGIVI TG +T +
Sbjct: 213 TGETEPLHKDAQTIDPEEYDN---RNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSY 269

Query: 258 GSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSL 317
           G++FEM++ I+KPKTPLQ  MD+LG +LSY+SF            +G S L MFQ++VSL
Sbjct: 270 GAIFEMVNSIEKPKTPLQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSL 329

Query: 318 AVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMT 377
           AVAAIPEGLPIIVTVTLALGVLRM K+ AIVRRLPSVETLGSVNVIC+DKTGTLT NHMT
Sbjct: 330 AVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMT 389

Query: 378 VSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPT 437
           VSK++CL S     N ++  +  E  +  + DV  TL I NICNN  YS+EH  Y+GNPT
Sbjct: 390 VSKLFCLDSSGTYENAISPEEDSEFDVH-DNDVKETLTIANICNNAKYSEEHNLYIGNPT 448

Query: 438 DIAILESLQHFGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEK 497
           D+A++E L  FGI D R+S  K+ E+ FNSKRK+MA+K+   + + V+Y+KGAFE+I++K
Sbjct: 449 DVALIEVLTKFGIPDQRDSHEKMEELSFNSKRKYMAIKSSKESGEHVLYIKGAFERILDK 508

Query: 498 SINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEG 557
           S  Y+ + G+V +   + K ++ +AA + AS+GLRT+A A      T  D   +ED + G
Sbjct: 509 SSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACA---FKPTDSDNVISEDDING 565

Query: 558 LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSV 617
           LTFTGL  + DPPRP V+++IE+L +G VH+IMITGD+ NTAVSIA +IG+ V + E SV
Sbjct: 566 LTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESSV 625

Query: 618 LSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALK 677
           ++GDK+ ++T+D+L+ VID VN+FARATPE+KLNIV+AL+KRGDIVAMTGDGVNDAPALK
Sbjct: 626 MTGDKVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALK 685

Query: 678 LADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAA 737
           LADIG++MG  GTDVAKE SDM+LTDDDFS+ILTAIEEGKGIFNNI+NFLTFQLS SVA 
Sbjct: 686 LADIGIAMGISGTDVAKEVSDMILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVAT 745

Query: 738 LSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTD 797
           LSL+AI+T  KLP PLN MQILWINI+MDGPPAQSLGVEPVD +VM KPPR R ++IL  
Sbjct: 746 LSLIAITTIAKLPAPLNPMQILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNM 805

Query: 798 AVLKRVLISACFIIVGTIYVFVKEMAEDGQVTSRDTTMTFTCFVFFDMFNALSCRHATKS 857
            +L R+L  A  I+VGT Y+F+K M E+ Q TS+D TMTFT FVFF +FNA++CRH TKS
Sbjct: 806 NILLRLLYLAICILVGTFYIFLKGMDENQQTTSKDITMTFTGFVFFAIFNAVACRHTTKS 865

Query: 858 IFEIGFFANKMFNYAVSLSLLGQLCAIYIPFFQGIFKTEXXXXXXXXXXXXXXXXVFIGD 917
           IF+IG F+N++FN A+ LS+ GQ+CA+YIPFFQ IFKTE                V I D
Sbjct: 866 IFQIGLFSNRIFNIAILLSVCGQMCAVYIPFFQHIFKTENLGFYDLLTLVLVSSSVLIVD 925

Query: 918 EIRK 921
           EIRK
Sbjct: 926 EIRK 929

>Scas_707.48*
          Length = 741

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/738 (67%), Positives = 595/738 (80%), Gaps = 9/738 (1%)

Query: 1   MSDNPFESYLA-----RDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGTDFDNGLSN 55
           MS NPF++ +A      +++  + A + LS+PNASLEYCT+SV++T+ +L TD  +GL +
Sbjct: 1   MSANPFDAPIADERSIEERELLEVAKEALSRPNASLEYCTMSVDETLRKLETDPKSGLGS 60

Query: 56  PSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMGNXXXXXXX 115
            +E + RK ++G+NE++ +E  SLWKKFLS+F+ED LILLLIGSAV+SF+MGN       
Sbjct: 61  IAEASRRKLVYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMGNIDDAVSI 120

Query: 116 XXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVG 175
                   +VGFVQEY+SEKSLEALNKLVPAECHL R GQ SHVLAS LVPGDLV FK+G
Sbjct: 121 TLAIVIVVSVGFVQEYRSEKSLEALNKLVPAECHLIRCGQESHVLASGLVPGDLVHFKIG 180

Query: 176 DRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFM 235
           DRIPADLRI+E++DL +DESNLTGENEPVHKS+  V+  +++  P SIIP+ DR C+ +M
Sbjct: 181 DRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYM 240

Query: 236 GTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXX 295
           GTLV+EGHGKGIV+  GK+T FG++FEM+S I+KPKTPLQ AMDKLG+DLS  SF+    
Sbjct: 241 GTLVKEGHGKGIVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSLFSFIVIGL 300

Query: 296 XXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 355
                  QGRSWLEMFQI+VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
Sbjct: 301 ICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE 360

Query: 356 TLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIK--MEQDVATT 413
           TLGSVNVICSDKTGTLT+NHMT SKIWCL SM NK N L+L K K   +K  + +DV +T
Sbjct: 361 TLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSKSGSLKNYLTEDVKST 420

Query: 414 LRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSKRKFMA 473
           L IGNICNN ++SQEH KYLGNPTDIA+LE L  F ++D R +  K+ EIPFNSKRKFMA
Sbjct: 421 LTIGNICNNASFSQEHGKYLGNPTDIALLEQLSKFDLSDIRPTFKKVQEIPFNSKRKFMA 480

Query: 474 VKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRT 533
           VK +++  K  + VKGAFEK++ +  +Y+ + GK  KL    + +I + A +LASEGLR 
Sbjct: 481 VKIVNSEGKYSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETANSLASEGLRM 540

Query: 534 LAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITG 593
           LAFA  + +         E+ V  L FTGLI MNDPPRPTV+ AIE+LLQG VH+IMITG
Sbjct: 541 LAFA--KTTLPDSPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITG 598

Query: 594 DAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIV 653
           D+ENTAV+IARQIGIPV++P+ SVLSGDKL++M+DDQLA+VIDHVN+FARATPEHKLNIV
Sbjct: 599 DSENTAVNIARQIGIPVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFARATPEHKLNIV 658

Query: 654 RALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAI 713
           RAL+KRGD+VAMTGDGVNDAPALKLADIGVSMG+MGTDVAKEASDMVLTDDDFSTILTAI
Sbjct: 659 RALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFSTILTAI 718

Query: 714 EEGKGIFNNIQNFLTFQL 731
           EEGKGIFNNIQNFLTFQL
Sbjct: 719 EEGKGIFNNIQNFLTFQL 736

>Kwal_23.3160
          Length = 1100

 Score =  353 bits (906), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 273/909 (30%), Positives = 428/909 (47%), Gaps = 139/909 (15%)

Query: 33  YCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPL 92
           + TVS  DT   L TD   GL + +E   R S +G N +  D K+   K  L   I + +
Sbjct: 23  FHTVSARDTAHVLETDLQAGLRS-AEATARVSQYGENSLGDDSKIDF-KSILLHQICNAM 80

Query: 93  ILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTR 152
           IL+L  S VI+  + +                +G  QEYK+ K++ +L  L     H+ R
Sbjct: 81  ILVLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIR 140

Query: 153 SGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVD 212
            G    + +  LVPGDL   K GD +PADLR++E ++   DE+ LTGE+ P+ K +  V 
Sbjct: 141 DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200

Query: 213 PKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSG----ID 268
           P           PVGDR  + F  + V +G   GIV+ TG +T  G + + + G    I 
Sbjct: 201 PATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254

Query: 269 KPK-------------------------TPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQ 303
           K +                         TPL   + KL   L +++ V            
Sbjct: 255 KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFV 314

Query: 304 GRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 363
               + ++ I V  AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN +
Sbjct: 315 VNKEVAIYAICV--AVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDV 372

Query: 364 CSDKTGTLTANHMTVSKIW--CLGSM--ENKTNCLALSK------VKERPIKMEQDVATT 413
           CSDKTGTLT   M V + W    G++   N +N    +        +  P + + D    
Sbjct: 373 CSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTED 432

Query: 414 LRIGNICNNGTYSQ--------------------------------EHLKYLGNPTDIAI 441
           + I     N  Y+                                 E  K  G+PT+IAI
Sbjct: 433 VGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAI 492

Query: 442 L---------------------ESLQHFGINDCRNSV----NKINEIPFNSKRKFMAVK- 475
                                 ES +   + +  +SV      I E PF+S  K M+   
Sbjct: 493 QVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVY 552

Query: 476 -TIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP---NDKAIINDAAVALASEGL 531
            ++D ++   V+ KGAFE++++    ++         KP    DK  +      L+SEGL
Sbjct: 553 VSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGL 612

Query: 532 RTLAFAELEVSATHG-----DKEFNEDMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGS 585
           R LAFA    + +       D   N D VE  L F GL+ + DPPR     A+++  +  
Sbjct: 613 RVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAG 672

Query: 586 VHVIMITGDAENTAVSIARQIGI--------PVINPEYSVLSGDKLDQMTDDQLASVIDH 637
           ++V M+TGD   TA +IA+++GI        P    +  V++  + DQ+TD+++ +++  
Sbjct: 673 INVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLL 732

Query: 638 VNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEAS 697
             V AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK A++G++MG  G+DVAK+AS
Sbjct: 733 PLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 792

Query: 698 DMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPN-----P 752
           D+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I       +     P
Sbjct: 793 DIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFP 852

Query: 753 LNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLIS------ 806
           L+ +++LWI ++    PA  LG+E    ++M K P+     I T  ++  +LI       
Sbjct: 853 LSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAA 912

Query: 807 ---ACFIIV 812
              ACFI V
Sbjct: 913 CCLACFITV 921

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score =  351 bits (901), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 289/935 (30%), Positives = 456/935 (48%), Gaps = 136/935 (14%)

Query: 27  PNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLST 86
           P A  ++  ++       L T  + GL+N ++IA R S+ G N +  D K+++ K  L +
Sbjct: 13  PYARNDFHVLTAPQVEKLLSTHINQGLNN-TQIAERLSLVGENTLGDDTKINI-KGILIS 70

Query: 87  FIEDPLILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPA 146
            I + +I++LI S VI+  + +                +G  QEY + K++ +L  L   
Sbjct: 71  QICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTP 130

Query: 147 ECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHK 206
             H+ R G    + +  LVPGD+   KVGD +PADLR++ESI+L  DE+ LTGE+ PV K
Sbjct: 131 SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190

Query: 207 SSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMM-- 264
           S   V  K+         PVGDR  + F  + V +G   GIVI T  +T  G + + +  
Sbjct: 191 SHSEVYEKD--------TPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS 242

Query: 265 --SGIDKPK-------------------------TPLQTAMDKLGQDLSYMSFVXXXXXX 297
             S I K +                         TPL   + +L   L  ++ +      
Sbjct: 243 ETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVM 302

Query: 298 XXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETL 357
                +    + ++ I V  A++ IP  L +++T+T++ G   MA R  IVR+L S+E L
Sbjct: 303 GTQKYRVNKQVAIYAICV--AISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEAL 360

Query: 358 GSVNVICSDKTGTLTANHMTVSKIWC--LGSM----ENKTNCLALSKV----KERPIKM- 406
           G+VN ICSDKTGTLT   M   ++W    G++     N+     + ++    K  P +  
Sbjct: 361 GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYK 420

Query: 407 ---EQDVATT-----------------------LRIGNICNNGTYSQ----EHLKYLGNP 436
              E+DV                          L    + N  T  Q    +  K  G+P
Sbjct: 421 HDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDP 480

Query: 437 TDIAI------LESLQHFGI-------NDCR--NSVNKINEIPFNSKRKFMAVKTIDAND 481
           T+IAI      ++  +H           D R  +S   + E PF+S  K M+    +  D
Sbjct: 481 TEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTED 540

Query: 482 KVV----VYVKGAFEKIVEKSIN-YIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAF 536
                  V+ KGAFE++++   + Y   DGK   L   D   I      L+SEGLR LAF
Sbjct: 541 PATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAF 600

Query: 537 A-----ELEVSATHGDKEFNE-DMVE-GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVI 589
           A     E E +A + DK   E D VE  LTF GLI + DPPR    +A+++  Q  ++V 
Sbjct: 601 AKKSFNESEFNA-NKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVH 659

Query: 590 MITGDAENTAVSIARQIGI----------PVINPEYSVLSGDKLDQMTDDQLASVIDHVN 639
           M+TGD   TA SIA+++GI           V+N  + V++    D ++D ++  +     
Sbjct: 660 MLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVN--FMVMAATDFDALSDQEIDDLRVLPL 717

Query: 640 VFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDM 699
           V AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G+DVAK+ASD+
Sbjct: 718 VIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDI 777

Query: 700 VLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPN-----PLN 754
           VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +             PL+
Sbjct: 778 VLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLS 837

Query: 755 AMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR-----TDKILTDAVLKRVLISACF 809
            +++LWI ++    PA  LG+E    +VM KPP+       T +++ D ++  V+++AC 
Sbjct: 838 PVEVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACC 897

Query: 810 IIVGTIYVFVKEMAEDGQVTSR-DTTMTFTCFVFF 843
           +     +V V     DG + S  +  +  TC + F
Sbjct: 898 M---ACFVTVLYGTGDGNLGSDCNDALGETCHLVF 929

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score =  348 bits (893), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 274/898 (30%), Positives = 440/898 (48%), Gaps = 130/898 (14%)

Query: 27  PNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLST 86
           P A  ++ ++SV      L T  + GL N ++IA R  + G N +  D K+++   F+S 
Sbjct: 13  PYARDDFHSLSVSRVETLLSTHINQGL-NTTQIAERLGLIGENTLGDDSKINIKGIFISQ 71

Query: 87  FIEDPLILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPA 146
            I + +I++LI S VISF + +                +G  QEY + K++ +L  L   
Sbjct: 72  -ICNAMIMVLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTP 130

Query: 147 ECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHK 206
             H+ R+G    + +  LVPGD+   +VGD +PADLR+ E+I+L  DE+ LTGE+ PV K
Sbjct: 131 SAHVIRAGNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVAK 190

Query: 207 SSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSG 266
           S G V  ++         PVGDR  + F  + V +G   GIVI T  +T  G + + +  
Sbjct: 191 SHGEVYEQD--------TPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS 242

Query: 267 ------IDKPK-----------------------TPLQTAMDKLGQDLSYMSFVXXXXXX 297
                  DK K                       TPL   + +L   L  ++ +      
Sbjct: 243 EASLISRDKSKSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVM 302

Query: 298 XXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETL 357
                +    + ++ I V+L++  IP  L +++T+T++ G   MA R  I+R+L S+E L
Sbjct: 303 GTQKFKVNKQVAIYAICVALSM--IPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEAL 360

Query: 358 GSVNVICSDKTGTLTANHMTVSKIWC--LGSMENKTNCLALSKV--------KERPIKME 407
           G+VN ICSDKTGTLT   M   ++W    G++  + +    +          K  P + +
Sbjct: 361 GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYK 420

Query: 408 QD---------------------------VATTLRIGNICNNGTYSQ----EHLKYLGNP 436
            D                               L    + N  T  +    +  K  G+P
Sbjct: 421 HDDEEDVGMITDFKSKYYADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDP 480

Query: 437 TDIAILESLQHFGI----------NDCRNSVNKIN-----EIPFNSKRKFMAV--KTIDA 479
           T+IAI        +          +D +N  N I      E PF+S  K M+   K ++ 
Sbjct: 481 TEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRMSAIYKNVEE 540

Query: 480 NDKVV--VYVKGAFEKIVEKSIN-YIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAF 536
               +  V+ KGAFE++++   + Y   DG    L   D   +      L+SEGLR LAF
Sbjct: 541 PKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAF 600

Query: 537 AELEVSATH----GDKEFNE-DMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIM 590
           A+   + +      DK   E D VE  LTF GL+ + DPPR    +A+++     ++V M
Sbjct: 601 AKKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHM 660

Query: 591 ITGDAENTAVSIARQIGI----------PVINPEYSVLSGDKLDQMTDDQLASVIDHVNV 640
           +TGD   TA SIA+++GI           V+N  + V++    D ++D ++  +     V
Sbjct: 661 LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVN--FMVMTATDFDALSDKEIDELPVLPLV 718

Query: 641 FARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 700
            AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G+DVAK+ASD+V
Sbjct: 719 IARCAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIV 778

Query: 701 LTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVA-ALSLVAISTSLKLPN----PLNA 755
           L+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA AL L+     L        PL+ 
Sbjct: 779 LSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSP 838

Query: 756 MQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR-----TDKILTDAVLKRVLISAC 808
           +++LW+ ++    PA  LG+E  + +VM KPP+       T +++ D ++  V+I+AC
Sbjct: 839 VEVLWVIVVTSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVIVDMLVYGVIIAAC 896

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score =  346 bits (887), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 266/893 (29%), Positives = 433/893 (48%), Gaps = 140/893 (15%)

Query: 33  YCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPL 92
           Y T++ E+    +GT    GL+   E  +R    G N +  D K+  +K  +   + + +
Sbjct: 17  YHTLTAEEAAEFIGTSLTEGLTQ-DEFVHRLKTVGENTLGDDTKID-YKAMVLHQVCNAM 74

Query: 93  ILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTR 152
           I++L+ S +ISF M +                +G VQEYK+ K++ +L  L     H+ R
Sbjct: 75  IMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134

Query: 153 SGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVD 212
           +G+   + + ++VPGD+   KVGD IPADLR++E+ +   DES LTGE+ PV K +  V 
Sbjct: 135 NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194

Query: 213 PKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSG------ 266
            K           VGDR  + F  + V +G  KGIVI T  ++  G + + + G      
Sbjct: 195 GKEEE------TSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS 248

Query: 267 ------------IDKPK-----------TPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQ 303
                       I   K           TPL   + KL   L +++ +            
Sbjct: 249 RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFD 308

Query: 304 GRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 363
               + ++ I V+L++  IP  L +++T+T+++G   M  R  IVR+L S+E LG+VN I
Sbjct: 309 VDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDI 366

Query: 364 CSDKTGTLTANHMTVSKIWC--LGSME----------NKTNCLALSKV------------ 399
           CSDKTGTLT   M   +IW    G++           N+ N   + +             
Sbjct: 367 CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426

Query: 400 -------------KERPIKMEQDV-ATTLRIGNICNNGTYSQEH----LKYLGNPTDIAI 441
                        K+ P  ++ D+    L    + N  T  ++      K  G+PT+IAI
Sbjct: 427 VGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAI 486

Query: 442 L----------------ESLQHFGINDCRNSVNKINE------------IPFNSKRKFM- 472
                            +S      ND ++S+++ NE             PF+S  K M 
Sbjct: 487 QVFATKMDLPHNALTGEKSTNQSNEND-QSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMS 545

Query: 473 AVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDG-KVHKLKPNDKAIINDAAVALASEGL 531
           +V   + N+   +Y KGAFE I+    ++ G+DG K+  L   D   I     +L++EGL
Sbjct: 546 SVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGL 605

Query: 532 RTLAFAELEVSATHGDKEFNEDMVEGLT-----------FTGLIAMNDPPRPTVRSAIEE 580
           R L FA    S +    + N+D ++ +T           F GLI + DPPR     A+++
Sbjct: 606 RVLGFA----SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKK 661

Query: 581 LLQGSVHVIMITGDAENTAVSIARQIGI-PVINPEYS-------VLSGDKLDQMTDDQLA 632
             Q  ++V M+TGD   TA +IA+++GI P     YS       V++G + D ++++++ 
Sbjct: 662 FHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVD 721

Query: 633 SVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDV 692
            +     V AR +P+ K+ ++ AL +R     MTGDGVND+P+LK+A++G++MG  G+DV
Sbjct: 722 DLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDV 781

Query: 693 AKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPN- 751
           +KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I    +  N 
Sbjct: 782 SKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENG 841

Query: 752 ----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVL 800
               PL+ +++LWI ++    PA  LG+E    ++M +PP      I T  V+
Sbjct: 842 KSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVI 894

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  344 bits (882), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 265/893 (29%), Positives = 434/893 (48%), Gaps = 140/893 (15%)

Query: 33  YCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPL 92
           Y T++ E+    +GT    GL+    +   K++ G N +  D K+  +K  +   + + +
Sbjct: 17  YHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAV-GENTLGDDTKID-YKAMVLHQVCNAM 74

Query: 93  ILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTR 152
           I++L+ S  ISF + +                +G VQEYK+ K++ +L  L     H+ R
Sbjct: 75  IMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134

Query: 153 SGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVD 212
           +G+   + + ++VPGD+   KVGD IPADLR++E+ +   DES LTGE+ PV K +  V 
Sbjct: 135 NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194

Query: 213 PKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSG------ 266
            K           VGDR  + F  + V +G  KGIVI T  ++  G + + + G      
Sbjct: 195 GKEEE------TSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS 248

Query: 267 ------------IDKPK-----------TPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQ 303
                       I   K           TPL   + KL   L +++ +            
Sbjct: 249 RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFD 308

Query: 304 GRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 363
               + ++ I V+L++  IP  L +++T+T+++G   M  R  IVR+L S+E LG+VN I
Sbjct: 309 VDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDI 366

Query: 364 CSDKTGTLTANHMTVSKIWC--LGSME----------NKTNCLALSKV------------ 399
           CSDKTGTLT   M   +IW    G++           N+ N   + +             
Sbjct: 367 CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426

Query: 400 -------------KERPIKMEQDV-ATTLRIGNICNNGTYSQEH----LKYLGNPTDIAI 441
                        K+ P  ++ D+    L    + N  T  ++      K  G+PT+IAI
Sbjct: 427 VGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAI 486

Query: 442 L----------------ESLQHFGINDCRNSVNKINE------------IPFNSKRKFM- 472
                            +S      ND ++S+++ NE             PF+S  K M 
Sbjct: 487 QVFATKMDLPHNALTGEKSTNQSNEND-QSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMS 545

Query: 473 AVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDG-KVHKLKPNDKAIINDAAVALASEGL 531
           +V   + N+   +Y KGAFE I+    ++ G+DG K+  L   D   I     +L++EGL
Sbjct: 546 SVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGL 605

Query: 532 RTLAFAELEVSATHGDKEFNEDMVEGLT-----------FTGLIAMNDPPRPTVRSAIEE 580
           R L FA    S +    + N+D ++ +T           F GLI + DPPR     A+++
Sbjct: 606 RVLGFA----SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKK 661

Query: 581 LLQGSVHVIMITGDAENTAVSIARQIGI-PVINPEYS-------VLSGDKLDQMTDDQLA 632
             Q  ++V M+TGD   TA +IA+++GI P     YS       V++G + D ++++++ 
Sbjct: 662 FHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVD 721

Query: 633 SVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDV 692
            +     V AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G+DV
Sbjct: 722 DLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDV 781

Query: 693 AKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPN- 751
           +KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I    +  N 
Sbjct: 782 SKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENG 841

Query: 752 ----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVL 800
               PL+ +++LWI ++    PA  LG+E    ++M +PP      I T  V+
Sbjct: 842 KSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVI 894

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score =  343 bits (881), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 270/898 (30%), Positives = 429/898 (47%), Gaps = 129/898 (14%)

Query: 45  LGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISF 104
           LGTD   GL+   E   R  + G N +  +E +++ +  L   + + +IL+LI S VI+ 
Sbjct: 33  LGTDLRRGLT-AEEARARLEVVGDNTLGEEEGINV-RAILLKQMCNAMILVLIISMVIAL 90

Query: 105 LMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNL 164
            + +               ++G  QEY + K++ +L  L      + R+G+   + ++ +
Sbjct: 91  AIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARVIRNGEDVVMASAQV 150

Query: 165 VPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSII 224
           VPGD+V+ +VGD +PADLR+VE+++L  DE+ LTGE  PV K   AV  ++         
Sbjct: 151 VPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQD--------T 202

Query: 225 PVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGI------DKPKTPLQTAM 278
           PVGDR  + F  + V +G   GIV+ TG  +  G + E + G       D+ K+ LQ  +
Sbjct: 203 PVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTV 262

Query: 279 DKLGQDLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAV----------------------- 315
             L    S  SF+             +  L +F IAV                       
Sbjct: 263 --LTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQKFIVNREVAIYAI 320

Query: 316 SLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANH 375
            +A++ IP  L +++T+T++ G   M+ R  IVRRL S+E LG+VN ICSDKTGTLT   
Sbjct: 321 CVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGK 380

Query: 376 MTVSKIWC--LGSME-NKTNCL----------------------------ALSKVKER-- 402
           M + ++W    G++  N++N                               ++  K+R  
Sbjct: 381 MILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANFKQRWQ 440

Query: 403 ---------PIKMEQ--DVATTLRIGNICNNGTYSQEHLKYLGNPTDIAIL--------- 442
                    P K E     AT   I  +  +     +  +  G+PT+IAI          
Sbjct: 441 SNSLPKGLNPRKFESWLHTATLANIATVFKDS--DSKEWRAHGDPTEIAIQVFATRMDHP 498

Query: 443 ----------ESLQHFGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVV--VYVKGA 490
                     E       ND         E PF+S  K M+   I+  DK    V+ KGA
Sbjct: 499 HHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNTRHVFTKGA 558

Query: 491 FEKIVEKSINYIGRDGK--VHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDK 548
           FE++++    +    G    H L  +D  II      L++EGLR LAFA   + A   + 
Sbjct: 559 FERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPAEEAES 618

Query: 549 -----EFNEDMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI 602
                  + D VE  L F GL+ + DPPR     A+++  +  ++V M+TGD   TA +I
Sbjct: 619 LGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAI 678

Query: 603 ARQIGI--------PVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVR 654
           A+++GI        P    +  V++  + D +TD++L  +     V AR  P+ K+ ++ 
Sbjct: 679 AQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMID 738

Query: 655 ALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIE 714
           AL +R    AMTGDGVND+P+LK A++G++MG  G+DVAK+ASD+VL+DD+F++IL A+E
Sbjct: 739 ALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVE 798

Query: 715 EGKGIFNNIQNFLTFQLSTSVAA-----LSLVAISTSLKLPNPLNAMQILWINILMDGPP 769
           EG+ + +NIQ F+   L+ +VA      L L  +        PL+ +++LWI ++    P
Sbjct: 799 EGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVVTSCLP 858

Query: 770 AQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAEDGQ 827
           A  LG+E    ++M KPP      I T  V+  +++    + V  +  FV  + +DG 
Sbjct: 859 AMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYKDGH 916

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  328 bits (840), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 262/892 (29%), Positives = 421/892 (47%), Gaps = 138/892 (15%)

Query: 33  YCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPL 92
           Y T++ E+    +GT    GL+    +   K++ G N +  D K+  +K  +   + + +
Sbjct: 17  YHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAV-GENTLGDDTKID-YKAMVLHQVCNAM 74

Query: 93  ILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTR 152
           I++L+ S  ISF + +                +G VQEYK+ K++ +L  L     H+ R
Sbjct: 75  IMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134

Query: 153 SGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVD 212
           +G+   + + ++VPGD+   KVGD IPADLR++E+ +   DES LTGE+ PV K +  V 
Sbjct: 135 NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194

Query: 213 PKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSG------ 266
            K           VGDR  + F  + V +G  KGIVI T  ++  G + + + G      
Sbjct: 195 GKEEE------TSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS 248

Query: 267 ------------IDKPK-----------TPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQ 303
                       I   K           TPL   + KL   L +++ +            
Sbjct: 249 RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFD 308

Query: 304 GRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 363
               + ++ I V+L++  IP  L +++T+T+++G   M  R  IVR+L S+E LG+VN I
Sbjct: 309 VDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDI 366

Query: 364 CSD------------------KTGTLT---------ANHMTVSKIWCLGSMENKTN---- 392
           CSD                  + GT+T          N   VS I      E   N    
Sbjct: 367 CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426

Query: 393 CLALSKVKER------PIKMEQDV-ATTLRIGNICNNGTYSQEH----LKYLGNPTDIAI 441
              L   K+R      P  ++ D+    L    + N  T  ++      K  G+PT+IAI
Sbjct: 427 VGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAI 486

Query: 442 L---------------------------ESLQHFGINDCRNSVNKINEIPFNSKRKFMA- 473
                                        SL              I E PF+S  K M+ 
Sbjct: 487 QVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSS 546

Query: 474 VKTIDANDKVVVYVKGAFEKIVEKSINYIGRDG-KVHKLKPNDKAIINDAAVALASEGLR 532
           V   + N+   +Y KGAFE I+    ++ G+DG K+  L   D   I     +L++EGLR
Sbjct: 547 VYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLR 606

Query: 533 TLAFAELEVSATHGDKEFNEDMVEGLT-----------FTGLIAMNDPPRPTVRSAIEEL 581
            L FA    S +    + N+D ++ +T           F GLI + DPPR     A+++ 
Sbjct: 607 VLGFA----SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKF 662

Query: 582 LQGSVHVIMITGDAENTAVSIARQIGI-PVINPEYS-------VLSGDKLDQMTDDQLAS 633
            Q  ++V M+TGD   TA +IA+++GI P     YS       V++G + D ++++++  
Sbjct: 663 HQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDD 722

Query: 634 VIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693
           +     V AR +P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G+DV+
Sbjct: 723 LPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVS 782

Query: 694 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPN-- 751
           KEASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + I    +  N  
Sbjct: 783 KEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGK 842

Query: 752 ---PLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVL 800
              PL+ +++LWI ++    PA  LG+E    ++M +PP      I T  V+
Sbjct: 843 SVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVI 894

>Kwal_47.17547
          Length = 1240

 Score =  310 bits (793), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 259/967 (26%), Positives = 435/967 (44%), Gaps = 164/967 (16%)

Query: 45   LGTDFDNGLSNPSE---IAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAV 101
            L TD + GL+   E      R  ++G N + P  K   + +      +D +++LL  +AV
Sbjct: 61   LKTDRNAGLTIADEDITQTERYQLYGDNRI-PQRKPKSFLQLAWIAFQDRIMILLTVAAV 119

Query: 102  ISFLMG---------------------NXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEAL 140
            +SF +G                     +                VG   +Y+ E     L
Sbjct: 120  VSFALGLYEVLGQPPEHDAEGKKITKVDWVEGVAIMIAVLVVILVGSANDYQKELQFSKL 179

Query: 141  N-KLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTG 199
            N K    E  + R+G    +   +++ GD++  + GD +PAD  +V+    C DES LTG
Sbjct: 180  NDKKNDREVIVLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVKGSCEC-DESALTG 238

Query: 200  ENEPVHKSSGAVDPKNYSHIPGS--IIPVGDRNC------IGFMGTLVREGHGKGIVIAT 251
            E+  + K++  V  + Y  +  +   I +G          +   G+ +  G G+ +V + 
Sbjct: 239  ESATIKKAAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSV 298

Query: 252  GKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLS--------------YMSFVXXXXX- 296
            G +++ G    M   ++   TPLQ  +D L   +S              +M F+      
Sbjct: 299  GVNSMHGRTL-MALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKG 357

Query: 297  ----XXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 352
                      +G  ++ +F + +++ V A+PEGLP+ VT+ LA    RMAK   +VR L 
Sbjct: 358  GELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLR 417

Query: 353  SVETLGSVNVICSDKTGTLTANHMTVSKIW----------CLGSMENKTNCLALSKVKER 402
            + ET+GS   +CSDKTGTLT N MTV K +           +G  +++T+ + L+   E 
Sbjct: 418  ACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETD-VDLAIANEC 476

Query: 403  PIKMEQDVATTLRIGN-------------------------------------------I 419
              ++++DV T + + +                                           +
Sbjct: 477  SEELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNNKSKKPATAKEL 536

Query: 420  CNNGTYSQEHLKYLGNPTDIAIL---------ESLQHFGIN-DCRNSVNKINEIPFNSKR 469
              N    Q    +LG+ T+ A+L         ++L H+    DC      +  IPF S R
Sbjct: 537  VENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEKIVQIIPFESSR 596

Query: 470  KFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASE 529
            K+  +     N     Y+KGA E ++ + +     D K+  +   D    +     LA+E
Sbjct: 597  KWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLAAE 656

Query: 530  GLRTLAFA-------------EL-----------------EVSATHGDKEFNEDMVEGLT 559
             LR ++ A             EL                 EVS +    E  +++V  + 
Sbjct: 657  ALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMV 716

Query: 560  FTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI----PVINPEY 615
              G++ + DP R  VR ++E+  +  V V M+TGD   TA +IA++  I       NPE 
Sbjct: 717  LDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENPES 776

Query: 616  SVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPA 675
            S + G +  ++++ +   ++ ++ V AR++PE K  +V  L+K GD+VA+TGDG NDAPA
Sbjct: 777  S-MEGPRFRKLSNKERVRILPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAPA 835

Query: 676  LKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSV 735
            LKLAD+G SMG  GT+VA+EASD++L  DDFS I+ AI+ G+ +  +I+ F+ FQL+ +V
Sbjct: 836  LKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQFQLTVNV 895

Query: 736  AA--LSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDK 793
             A  L+ V+   S +  + L A+Q+LW+N++MD   A +L  +  D  ++ + P+ R   
Sbjct: 896  TAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALATDKPDENILERKPKGREAV 955

Query: 794  ILTDAVLKRVL------ISACFII--VGTIYVFVKEMAEDGQVTSRDTTMTFTCFVFFDM 845
            ++T +  K +L      +   FI+   G    F  +    G    +   MTF  FV+   
Sbjct: 956  LITVSTWKMILGQSTLQLIVTFILHFAGKQIFFPGKATITGHEQQQLNAMTFNAFVWLQF 1015

Query: 846  FNALSCR 852
            F  +  R
Sbjct: 1016 FKLIVTR 1022

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  307 bits (786), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 284/1037 (27%), Positives = 463/1037 (44%), Gaps = 183/1037 (17%)

Query: 29   ASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIAY----RKSIWGSNEVLPDEKVSLWKKFL 84
            A +E    S E    +L TD  NG++   +       R+  +GSN +      S W    
Sbjct: 15   AFVEQVGGSAEALARRLSTDLANGIATDKDAELPPLKRRDAYGSNRLPERAPKSFWALVR 74

Query: 85   STFIEDPLILLLIGSAVISFLMG---------------------NXXXXXXXXXXXXXXX 123
              F +D  +LLL G+AV+SF +G                     +               
Sbjct: 75   EAF-QDRTMLLLTGAAVVSFTLGIYEVLTQPPELDPEGNPITQVDWIEGLAIMMAVLVVV 133

Query: 124  TVGFVQEYKSEKSLEALN-KLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADL 182
             V    +Y+ E   + LN K    +  + R    S +   NL+ GDL++ + GD +PAD 
Sbjct: 134  LVSAANDYQKELQFQQLNRKREDRQVVVVRDAAESLISIHNLLVGDLLKLQTGDVVPADC 193

Query: 183  RIVESIDLCVDESNLTGENEPV-----------HKSSGAVDPKNYSHIPGSIIPVGDR-- 229
             +V   +   DES LTGE+  +           H + G  D  + S    S      R  
Sbjct: 194  VLVRG-ECETDESALTGESNTIKKLPLADALEYHSAHGGRDIGDTSASGASGAADDSRCP 252

Query: 230  NCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLS--- 286
            +C+   G+ V  G    IV   G ++V G     +   D   TPLQ  + +L  ++S   
Sbjct: 253  DCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKE-DSEDTPLQMRLSQLTDNISVYG 311

Query: 287  --------------YMSFVXXXXXXXXX---XXQGRSWLEMFQIAVSLAVAAIPEGLPII 329
                          Y+S++              +G  ++++F  A+++ V A+PEGLP+ 
Sbjct: 312  CVAAITLFVVLFARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLA 371

Query: 330  VTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWC------ 383
            VT+ LA    RM K   +VR L S ET+GS   +CSDKTGTLT N MTV +         
Sbjct: 372  VTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFD 431

Query: 384  -LGSMENKTNCLALSKVKE----------------------------------RPIKMEQ 408
             +G+  +K+N +   K  +                                  +P ++ +
Sbjct: 432  DIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIR 491

Query: 409  DVATTLRIG------NICNNGTYSQEHLKYLGNPTDIAILE-----------SLQHF-GI 450
             +  TL+        N+  +    ++   Y+G+ T+ A+L            +LQ F G 
Sbjct: 492  RITQTLQKKKPDDEENLLAHAAEGRQE-PYIGSKTETALLSLARKSFGLKFGALQSFRGH 550

Query: 451  NDCRNSVNKINEI-PFNSKRKFMA-VKTIDAND-----KVVVYVKGAFEKIVEK-SINYI 502
             +   +V  I +I PF S RK+ A V  +++N      K  +YVKGA E + +  ++  +
Sbjct: 551  PEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNV 610

Query: 503  GRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATH------GDKEFNEDMV- 555
              +G + ++    K  I +   +LA + LR ++ A ++            D E + + + 
Sbjct: 611  CNEG-ISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALA 669

Query: 556  -----------EGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIAR 604
                       EGLT   ++ + DP R  V++++ +  +  V V M+TGD   TA +IAR
Sbjct: 670  VKLIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIAR 729

Query: 605  QIGI---PVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGD 661
              GI     +N     + G    +++D +   ++  + V AR++PE K  +VRAL++ G+
Sbjct: 730  NCGILSSKSLNDSACAMEGPAFRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGE 789

Query: 662  IVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFN 721
            +VA+TGDG NDAPALKLAD+G SMG  GT+VA+EASD++L  DDFS I+ AI+ G+ +  
Sbjct: 790  VVAVTGDGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAA 849

Query: 722  NIQNFLTFQLSTSVAALSLVAIST--SLKLPNPLNAMQILWINILMDGPPAQSLGVEPVD 779
            +I+ F+ FQL  +V A+ L  +++  S  + + L A+Q+LW+N++MD   A +L  +  D
Sbjct: 850  SIKKFIQFQLIVNVTAVLLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPD 909

Query: 780  HEVMRKPPRKRTDKILTDAVLKRVL------ISACFIIV--GTIYVFVKEMAED--GQVT 829
              +M + P+ R+  ++T +  K ++      +S  F +   G  Y F K   ED  G   
Sbjct: 910  PNIMDRKPKGRSTPLITPSTWKMIIGQAILQLSVTFTLYSHGAQYFFGKP-KEDLPGHEH 968

Query: 830  SRDTTMTFTCFVFFDMFNALSCRH---------------ATKSIFEIGFFANKMFNYAVS 874
             +   M F  FV+   F  L  R                A+   F    F N  F + +S
Sbjct: 969  QQINAMIFNTFVWLQWFTLLVSRKLDEADGIKDWRKRLTASNLNFFQDLFRNYYFIFIMS 1028

Query: 875  LSLLGQLCAIYIPFFQG 891
            L  + Q   + I FF G
Sbjct: 1029 LIAVLQ---VLIMFFGG 1042

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  288 bits (737), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 288/1048 (27%), Positives = 466/1048 (44%), Gaps = 199/1048 (18%)

Query: 24   LSQPNASLEYCTV---SVEDTIAQLGTDFDNGLSNPSEIAY---RKSIWGSNEVLPDEKV 77
            L  P +   YC +   S       L TD  NGL+   E      R   +G+N V P+   
Sbjct: 34   LHNPKSLAAYCALFGHSENGLCDALKTDKKNGLALADEEVRETARCRRFGANRV-PERTA 92

Query: 78   SLWKKFLSTFIEDPLILLLIGSAVISFLMG---NXXXXXXXXXXXXXXXTVGFVQ----- 129
              + + +    +D  +++L+ +AVISF +G                    V +V+     
Sbjct: 93   RGFLRLMWEAFKDKTMIVLMVAAVISFSLGLYEAIGQPPELDDDGTPMAQVDYVEGLAIM 152

Query: 130  -------------EYKSEKSLEALN-KLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVG 175
                         +Y+ E+    LN K    E  + R+G    +   +L+ GDL+  + G
Sbjct: 153  AAVAVVVLVTAANDYQKERQFARLNRKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQTG 212

Query: 176  DRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHI----PGSIIPVGDR-- 229
            D +P D  +VE    C DES +TGE++ + K S A+  + Y  +    P + I   D   
Sbjct: 213  DVVPVDCILVEGKCEC-DESGITGESDTIKKVSLAMSLQVYRTVAADNPSADIGSSDNGH 271

Query: 230  ----NCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKT-PLQTAMDKLGQD 284
                + +   G+ +  G G  +V A G H+V G +  M++   +P+T PLQ  ++ L  D
Sbjct: 272  SLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGKM--MLALKSEPETTPLQERLNTLADD 329

Query: 285  LS-------YMSFVXXXXXXXXXXXQGR------------SWLEMFQIAVSLAVAAIPEG 325
            +S       ++ FV           +GR             ++++F  AV++ V A+PEG
Sbjct: 330  ISIYGSVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEG 389

Query: 326  LPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLG 385
            LP+ VT+ LA    RM K   +VR L + ET+GS   +CSDKTGTLT N M V K + LG
Sbjct: 390  LPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGF-LG 448

Query: 386  S-----MENKTNCLALSKVKERPIKMEQDVATTLRIGNICNNGT---------------- 424
            S     +   +NC     +++    M Q     + + NI  N T                
Sbjct: 449  SSHFDDISEDSNCAQSDALRQ---DMSQHTLNDI-LANIALNSTAFENKQVADPVITENP 504

Query: 425  ----------YSQEHLK---------------YLGNPTDIAIL---------ESLQ---- 446
                      +S+ +                 ++G+ T+ A+L         ESLQ    
Sbjct: 505  YHKPRRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRD 564

Query: 447  ---HFGINDCRNSVNKINEIPFNSKRKF--MAVKTIDANDKVVVYVKGAFEKIVEKSINY 501
               H GI       + +  IPF S RK+  + V+ +D N +   ++KGA E I  KS +Y
Sbjct: 565  DPHHIGI------ASIVQMIPFESSRKWAGLVVRLVDGNYRF--FIKGASETIF-KSCHY 615

Query: 502  I-GRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEV-----------------SA 543
            +   +  V KL P     I      LAS+ LRT++ A  +                  S 
Sbjct: 616  MRSSNDDVIKLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPST 675

Query: 544  THGDKEFNEDMV--------------EGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVI 589
               D    ++ V               GL   G++ ++DP RP V+ +++   Q  V V 
Sbjct: 676  ASPDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVR 735

Query: 590  MITGDAENTAVSIARQIGIPVINPEYS----VLSGDKLDQMTDDQLASVIDHVNVFARAT 645
            MITGD   T  +IAR  GI +   EY+     + G    +++  Q+      + V AR++
Sbjct: 736  MITGDNITTGRAIARACGI-LSESEYADHECAMEGPVFRKLSRRQMMDAAPKLKVLARSS 794

Query: 646  PEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDD 705
            PE K   V  L+K  ++VA+TGDG NDAPAL LAD+G SMG  GT VA+EASD++L  DD
Sbjct: 795  PEDKRIFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDD 854

Query: 706  FSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIS--TSLKLPNPLNAMQILWINI 763
            F++I+ AI+ G+ +  +I+ F+ FQL+ ++ A++L  ++  TS +    L A+Q+LW+N+
Sbjct: 855  FTSIVNAIKWGRCVSLSIKKFIQFQLTVNITAVTLTCVTAVTSTEENPVLTAVQLLWVNL 914

Query: 764  LMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIV--------GTI 815
            +MD   A +L  +  D  ++ + P  R   ++  +  K +L  A   ++        G  
Sbjct: 915  IMDTLAALALATDKPDPHILERIPTGRDSPLIAVSTWKMILGQAVLQLIIAFVLHYGGRK 974

Query: 816  YVFVKEMAEDGQVTSRDTTMTFTCFVFFDMFNALSCRHATK-----------SIFEIGFF 864
              +  ++   G+   R  T+TF  FV+   F  +  R   +           +   + FF
Sbjct: 975  LFYPHQVPFTGRDQKRLDTLTFNTFVWLQFFKLIVTRKLDEADGISDWRKRITARNLNFF 1034

Query: 865  ANKMFNYA-VSLSLLGQLCAIYIPFFQG 891
             +   NY  +++ LL  +C + I  F G
Sbjct: 1035 QDLGRNYYFLTILLLIGICQVLIMCFGG 1062

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  263 bits (672), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 259/958 (27%), Positives = 424/958 (44%), Gaps = 162/958 (16%)

Query: 45   LGTDFDNGLS---NPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAV 101
            L TD  NGL+      E   R  ++G N + P+ K   + + +     D  ++LL  +AV
Sbjct: 114  LQTDRTNGLTIQDEDIESLERTQVYGLNRI-PERKGKSFLRLVWEAFNDKTMILLTVAAV 172

Query: 102  ISFLMG---NXXXXXXXXXXXXXXXTVGFVQ------------------EYKSEKSLEAL 140
            ISF +G                    V +V+                  +Y+ E     L
Sbjct: 173  ISFALGLYETLGQPPEYDPEGNEIVKVEWVEGVAIMIAVVVVVLVGAINDYQKELQFAKL 232

Query: 141  NKLVP-AECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTG 199
            NK     +  + R+G    +   +L+ GD++  + GD +PAD  ++     C DES LTG
Sbjct: 233  NKKKDDRDVVVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLISGSCEC-DESALTG 291

Query: 200  ENEPVHKSSGAVDPKNY-------------SHIPGSIIPVGDRNCIGFMGTLVREGHGKG 246
            E++ + K +     + Y             SH  G  +P    + +   G+ +  G G  
Sbjct: 292  ESDTIKKVALKPALEKYKQIFEKDPTIDIGSHGVGEKVP----DPLLISGSKLLSGIGNA 347

Query: 247  IVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLS--------------YMSFVX 292
            ++ + G+++V G +  M    +   TPLQ  +  L  ++S              ++ F+ 
Sbjct: 348  VITSVGENSVNGRIM-MALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLT 406

Query: 293  XXXXXXXX-----XXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 347
                           +G  ++ +F  AV++ V A+PEGLP+ VT+ LA    RM K   +
Sbjct: 407  YLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL 466

Query: 348  VRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWC--LG-----SMENK---------T 391
            VR L + ET+GS   ICSDKTGTLT N MTV K +   LG       ENK         +
Sbjct: 467  VRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRS 526

Query: 392  NCLA------LSKVKERPIKME--------QDV---------------ATTLRIGNICNN 422
            NC A      LS +       E        +DV               +   R   +  +
Sbjct: 527  NCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIAD 586

Query: 423  GTYSQEHLKYLGNPTDIAILESLQH-FGINDCRNSVNK---------INEIPFNSKRKFM 472
                 +  ++LG+ T+ A+L   Q   G+ D      K         +  IPF S RK+ 
Sbjct: 587  AMKENDE-QFLGSKTETALLAFAQKSLGMKDVHKLRTKPSDLGIDKVVQVIPFESSRKWG 645

Query: 473  AVKTIDANDK-VVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVA---LAS 528
            A+    A++K    Y KGA E +++   N    D  +    P ++ + +++      +AS
Sbjct: 646  AIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSI---VPMNQDLYDESFKKIQDMAS 702

Query: 529  EGLRTLAFAELEVSATHGDKEFNE---------DMV------------EGLTFTGLIAMN 567
              LRT++    +       KEF +         D+V            EG+T   ++ + 
Sbjct: 703  HALRTISLVHRDFKE-WPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQ 761

Query: 568  DPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI---PVINPEYSVLSGDKLD 624
            DP R  V+ ++E+  +  V V M+TGD   TA +I+R   I      N     + G    
Sbjct: 762  DPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPECAMEGPTFR 821

Query: 625  QMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVS 684
            ++   ++  VI  + V AR++PE K  +V  L+K G++VA+TGDG NDAPALKLAD+G S
Sbjct: 822  KLPYKKMLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFS 881

Query: 685  MGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAA--LSLVA 742
            MG  GT+VA+EASD++L  DDF+ I+ AI+ G+ +  +I+ F+ FQL+ ++ A  L+ V+
Sbjct: 882  MGISGTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTFVS 941

Query: 743  ISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKR 802
               S +  + L A+Q+LW+N++MD   A +L  +  D  ++ + P+ R   ++  +  K 
Sbjct: 942  AVASAEETSVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKGRDAPLIAVSTWKM 1001

Query: 803  VLISACFIIVGTIYV--------FVKEMAEDGQVTSRDTTMTFTCFVFFDMFNALSCR 852
            +L  A   +  T  +        F  +         +   MTF  FV+   F  +  R
Sbjct: 1002 ILGQAALQLTVTFVLHFRGKEIFFPNKRTITAHEQEQLNAMTFNTFVWLQFFKLIVTR 1059

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  225 bits (573), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 203/733 (27%), Positives = 342/733 (46%), Gaps = 93/733 (12%)

Query: 45  LGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISF 104
           L TD   GL++  E+  R+  +G N+ + DEK SL  KF+  F+  P+  ++  +A+++ 
Sbjct: 80  LQTDPSYGLTS-DEVLKRRKKYGLNQ-MADEKESLVVKFVMFFV-GPIQFVMEAAAILAA 136

Query: 105 LMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNL 164
            + +                VGFVQE+++   ++ L K +     + R GQL  + A+ +
Sbjct: 137 GLSDWVDFGVICGLLMLNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEV 196

Query: 165 VPGDLVRFKVGDRIPADLRIV-ESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSI 223
           VPGD+++ + G  IP D RIV E   L +D+S +TGE       S AVD K+Y       
Sbjct: 197 VPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGE-------SLAVD-KHY------- 241

Query: 224 IPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ 283
              GD+    F  + V+ G G  +V ATG +T  G    +++     +      ++ +G 
Sbjct: 242 ---GDQT---FSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGI 295

Query: 284 DLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAK 343
            L  +              +    + + +  + + +  +P GLP +VT T+A+G   +AK
Sbjct: 296 ILLVLVIATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 355

Query: 344 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK----TNCLALSKV 399
           ++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + +  +       T CLA S+ 
Sbjct: 356 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRK 415

Query: 400 KERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHF-GINDCRNSVN 458
           K+                                 +  D A L+SL+ +    D      
Sbjct: 416 KKGL-------------------------------DAIDKAFLKSLKQYPKAKDALTKYK 444

Query: 459 KINEIPFNSKRKFMAVKTIDANDKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPND 515
            +   PF+   K +         + +V VKGA     K VE+  + I  D  VH+   N 
Sbjct: 445 VLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEED-HPIPED--VHENYENK 501

Query: 516 KAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVR 575
            A        LAS G R L      V+   G+  +           G++   DPPR    
Sbjct: 502 VA-------ELASRGFRALG-----VARKRGEGHWE--------ILGVMPCMDPPRDDTA 541

Query: 576 SAIEELLQGSVHVIMITGDAENTAVSIARQIGIP--VINPEYSVLSGDKLDQMTDDQLAS 633
             + E     + V M+TGDA   A    RQ+G+   + N E   L       M   +LA 
Sbjct: 542 QTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLG--GGGDMPGSELAD 599

Query: 634 VIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693
            +++ + FA   P+HK  +V  LQ RG +VAMTGDGVNDAP+LK AD G+++ +  TD A
Sbjct: 600 FVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAA 658

Query: 694 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPL 753
           + A+D+V      S I+ A++  + IF+ + +++ ++++ S+     + +  ++ L N L
Sbjct: 659 RSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LDNSL 717

Query: 754 NAMQILWINILMD 766
           +   I++I I  D
Sbjct: 718 DIDLIVFIAIFAD 730

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  222 bits (566), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 194/733 (26%), Positives = 336/733 (45%), Gaps = 93/733 (12%)

Query: 45  LGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISF 104
           L TD   GL++  E++ R+  +G N+ + +   S+  KF+  F+  P+  ++  +A+++ 
Sbjct: 61  LQTDPSYGLTS-DEVSRRRKKYGLNQ-MSEANESMILKFVMFFV-GPIQFVMEAAAILAA 117

Query: 105 LMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNL 164
            +                  VGF+QE+++   +E L K +     + R G L  + A+ +
Sbjct: 118 GLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRDGSLVEIPANEV 177

Query: 165 VPGDLVRFKVGDRIPADLRIV-ESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSI 223
           VPGD+++ + G  IPAD RIV E   + +D+S +TGE+  V K  G              
Sbjct: 178 VPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKRYGDAT----------- 226

Query: 224 IPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ 283
                     F  + V+ G G  IV ATG  T  G    +++            ++ +G 
Sbjct: 227 ----------FSSSTVKRGEGFMIVTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGT 276

Query: 284 DLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAK 343
            L  +  +           +    + + +  +++ V  +P GLP +VT T+A+G   +AK
Sbjct: 277 ILLILVILTLLVVYVACFYRSIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAK 336

Query: 344 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK----TNCLALSKV 399
           +KAIV++L ++E+L  V ++CSDKTGTLT N +++ + + +  +E      T CLA S+ 
Sbjct: 337 KKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRK 396

Query: 400 KERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNK 459
           K+                                 +  D A L+SL ++       +  K
Sbjct: 397 KKGL-------------------------------DAIDKAFLKSLINYPRAKAALTKYK 425

Query: 460 INEI-PFNSKRKFMAVKTIDANDKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPND 515
           + E  PF+   K +         + +V VKGA     K VE++          H +  + 
Sbjct: 426 VLEFHPFDPVSKKVTAIVESPEGERIVCVKGAPLFVLKTVEEN----------HLIPEDV 475

Query: 516 KAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVR 575
           K    +    LAS G R L      V+   G+  +           G++   DPPR    
Sbjct: 476 KENYENKVAELASRGYRALG-----VARKRGEGHWE--------ILGVMPCMDPPRDDTA 522

Query: 576 SAIEELLQGSVHVIMITGDAENTAVSIARQIGIP--VINPEYSVLSGDKLDQMTDDQLAS 633
             + E     + V M+TGDA   A    RQ+G+   + N E   L       M   +LA 
Sbjct: 523 QTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLG--GGGDMPGSELAD 580

Query: 634 VIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693
            +++ + FA   P+HK N+V  LQ+RG +VAMTGDGVNDAP+LK AD G+++ +  TD A
Sbjct: 581 FVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAA 639

Query: 694 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPL 753
           + A+D+V      S I+ A++  + IF+ + +++ ++++ S+     + +  ++ L   L
Sbjct: 640 RSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LNQSL 698

Query: 754 NAMQILWINILMD 766
           N   +++I I  D
Sbjct: 699 NVHLVVFIAIFAD 711

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score =  222 bits (565), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 157/529 (29%), Positives = 258/529 (48%), Gaps = 83/529 (15%)

Query: 462  EIPFNSKRKFMAVKTIDANDKVV-VYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIIN 520
            E PF+S  K M+      + K   +Y KGAFE ++    ++ GRD       PN   ++ 
Sbjct: 529  EFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRD-------PNTATVMT 581

Query: 521  DAAV--------ALASEGLRTLAFAELEVSATHGDKEFNEDMVE-----------GLTFT 561
            DA V        +++SEGLR LAFA    + ++   + NE+ ++           GLTF 
Sbjct: 582  DADVDTIKENIDSMSSEGLRVLAFA----NKSYPKSDVNEEKLQKILKERDYAETGLTFL 637

Query: 562  GLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI-PVINPEYS---- 616
            GLI + DPPR     A+++  Q  ++V M+TGD   TA +IA+++GI P     YS    
Sbjct: 638  GLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVV 697

Query: 617  ---VLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDA 673
               V++G + D +++D++ ++     V AR +P+ K+ ++ AL +R    AMTGDGVND+
Sbjct: 698  DIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDS 757

Query: 674  PALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLST 733
            P+LK+A++G++MG  G+DVAK+ASD+VL+DD+F++IL A+EEG+ + +NIQ F+   L+ 
Sbjct: 758  PSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAE 817

Query: 734  SVAALSLVAISTSL-----KLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPR 788
            +VA    + +  +      K   PL  +++LWI ++    PA  LG+E   H++M +PP 
Sbjct: 818  NVAQALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPN 877

Query: 789  KRTDKILTDAVLKRVLISACFIIVGTIYVFV-----KEMAEDGQVTSRDTTMTFTCFVFF 843
                 I T  ++  + +   ++    +  FV     ++    GQ  +RD +   +C    
Sbjct: 878  DSKAGIFTWEIIVDMFVYGVWMAASCMATFVTIIYGRDHGNLGQNCNRDYSE--SC---H 932

Query: 844  DMFNALSCRHAT----------------KSIFEI-------------GFFANKMFNYAVS 874
            D+F A S   AT                +S F +               + NK   Y+V 
Sbjct: 933  DVFRARSAAFATMTWCALILAWEVIDLRRSFFRMHPDTDAPVKQFFKDIYGNKFLFYSVV 992

Query: 875  LSLLGQLCAIYIPFFQGIFKTEXXXXXXXXXXXXXXXXVFIGDEIRKYY 923
                     +YIP                          +IG E+ KY+
Sbjct: 993  FGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIAFSVCFWIGCELHKYF 1041

 Score =  184 bits (466), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 127/380 (33%), Positives = 190/380 (50%), Gaps = 41/380 (10%)

Query: 32  EYCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDP 91
           +Y  +SVEDT A+L TD   G+S P E   R +  G N +  D K+  +K  L   I + 
Sbjct: 12  DYHALSVEDTCARLVTDSSKGIS-PEEFQARLAQCGENSLGDDAKID-YKAMLIHQICNA 69

Query: 92  LILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLT 151
           +IL+LI S +ISF + +                +G +QEYK+ K++ AL  L     H+ 
Sbjct: 70  MILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVI 129

Query: 152 RSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAV 211
           R+G    V ++++VPGDLV  KVGD IPADLR+V   +   DE+ LTGE+ PV K +   
Sbjct: 130 RNGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDA--- 186

Query: 212 DPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDK-- 269
                + I     PVGDR  + F  + V +G  +GI I TG +T  G + + + G ++  
Sbjct: 187 -----NEIFDDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELI 241

Query: 270 ---------------------------PKTPLQTAMDKLGQDLSYMSFVXXXXXXXXXXX 302
                                        TPL   + KL   L +++ V           
Sbjct: 242 SRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKF 301

Query: 303 QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNV 362
                + ++  AV +A++ IP  L +++T+T+++G   MA R  I+R+L S+E LG+VN 
Sbjct: 302 DVDRGVAIY--AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVND 359

Query: 363 ICSDKTGTLTANHMTVSKIW 382
           ICSDKTGTLT   M   +IW
Sbjct: 360 ICSDKTGTLTQGKMIAKQIW 379

>Scas_688.1
          Length = 913

 Score =  219 bits (558), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 201/738 (27%), Positives = 346/738 (46%), Gaps = 99/738 (13%)

Query: 43  AQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVI 102
           + L TD   GLS+  E+A R+  +G N+ + +E  SL  KF+  F+  P+  ++  +A++
Sbjct: 73  SMLQTDPAYGLSS-DEVARRRKKYGLNQ-MSEENESLVVKFIMFFV-GPIQFVMEAAAIL 129

Query: 103 SFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLAS 162
           +  + +                VGFVQE+++   +E L K +     + R GQL  V A+
Sbjct: 130 AAGLSDWVDFGVICGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPAN 189

Query: 163 NLVPGDLVRFKVGDRIPADLRIV-ESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPG 221
            +VPGD+++ + G  IPAD RIV E   + +D+S +TGE       S A D K+Y     
Sbjct: 190 EVVPGDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGE-------SLAAD-KHY----- 236

Query: 222 SIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKL 281
                GD+    F  + V+ G    ++ ATG +T  G    +++     +      ++ +
Sbjct: 237 -----GDQT---FSSSTVKRGEAFMVITATGDNTFVGRAAALVNKASGGQGHFTEVLNGI 288

Query: 282 GQDLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRM 341
           G  L  +  V           +    + + +  + + +  +P GLP +VT T+A+G   +
Sbjct: 289 GIILLVLVIVTLLLVWTASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYL 348

Query: 342 AKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK----TNCLALS 397
           AK++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + +  +       T CLA S
Sbjct: 349 AKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAAS 408

Query: 398 KVKERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSV 457
           + K+                                 +  D A L+SL  +     +N++
Sbjct: 409 RKKKGL-------------------------------DAIDKAFLKSLAQY--PAAKNAL 435

Query: 458 NKINEIPFNS----KRKFMAVKTIDANDKVVVYVKGA---FEKIVEKSINYIGRDGKVHK 510
            K   + F+      +K  AV      ++++  VKGA     K VE+           H 
Sbjct: 436 TKYKVLEFHPFDPVSKKVTAVVESPEGERIIC-VKGAPLFVLKTVEED----------HP 484

Query: 511 LKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPP 570
           +  +      +    LAS G R L      V+   G+  +           G++   DPP
Sbjct: 485 IPEDIHENYENKVAELASRGFRALG-----VARKRGEGHWE--------ILGVMPCMDPP 531

Query: 571 RPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIP--VINPEYSVLSGDKLDQMTD 628
           R      + E  +  + V M+TGDA   A    RQ+G+   V N E   LSG     M  
Sbjct: 532 RDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYNAERLGLSGG--GDMPG 589

Query: 629 DQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKM 688
            +LA  +++ + FA   P+ K  +V  LQ RG +VAMTGDGVNDAP+LK AD G+++ + 
Sbjct: 590 SELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLKKADTGIAV-EG 648

Query: 689 GTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLK 748
            TD A+ A+D+V      S I+ A++  + IF+ + +++ ++++ S+     + +  ++ 
Sbjct: 649 ATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSIHLEIFLGLWIAI- 707

Query: 749 LPNPLNAMQILWINILMD 766
           L N L+   I++I I  D
Sbjct: 708 LNNSLDINLIVFIAIFAD 725

>Kwal_47.17522
          Length = 899

 Score =  218 bits (555), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 204/735 (27%), Positives = 346/735 (47%), Gaps = 97/735 (13%)

Query: 45  LGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISF 104
           L TD   GL++  E+  R+  +G N+ + +E  SL  KFL  FI  P+  ++  +A+++ 
Sbjct: 61  LQTDPSYGLTS-DEVTKRRKKYGLNQ-MAEESESLVVKFLMFFI-GPIQFVMEAAAILAA 117

Query: 105 LMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNL 164
            + +                VGF+QEY++   ++ L K +     + R G L  + A+ +
Sbjct: 118 GLEDWVDFGVILGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEV 177

Query: 165 VPGDLVRFKVGDRIPADLRIV-ESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSI 223
           VPGD+++ + G  I AD R+V E   L +D+S +TGE       S AVD K+Y       
Sbjct: 178 VPGDIMQLEDGVVICADGRLVTEECFLQIDQSAITGE-------SLAVD-KHY------- 222

Query: 224 IPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ 283
              GD     F  + V+ G G  IV ATG +T  G    +++     +      ++ +G 
Sbjct: 223 ---GDTT---FSSSTVKRGEGFMIVTATGDNTFVGRAAALVNQAAGDQGHFTEVLNGIGT 276

Query: 284 DLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAK 343
            L  +  V           +    + + +  + + +  +P GLP +VT T+A+G   +AK
Sbjct: 277 ILLVLVIVTLLLVWTACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 336

Query: 344 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK----TNCLALSKV 399
           ++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + +  +E      T CLA S+ 
Sbjct: 337 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRK 396

Query: 400 KERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNK 459
           K+                                 +  D A L+SL  +     +N++ K
Sbjct: 397 KKGL-------------------------------DAIDKAFLKSLIQY--PRAKNALTK 423

Query: 460 INEI---PFNSKRKFMAVKTIDANDKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKP 513
              +   PF+   K +         + ++ VKGA     K VE+  + I  D  VH+   
Sbjct: 424 YKVLDFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEED-HPIPED--VHENYE 480

Query: 514 NDKAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPT 573
           N  A        LAS G R L      V+   G+  +           G++   DPPR  
Sbjct: 481 NKVA-------ELASRGFRALG-----VARKRGEGHWE--------ILGVMPCMDPPRDD 520

Query: 574 VRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIP--VINPEYSVLSGDKLDQMTDDQL 631
               + E  +  + V M+TGDA   A    RQ+G+   + N E   L       M   +L
Sbjct: 521 TAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLG--GGGDMPGSEL 578

Query: 632 ASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTD 691
           A  +++ + FA   P+HK ++V  LQ+RG +VAMTGDGVNDAP+LK AD G+++ +  TD
Sbjct: 579 ADFVENADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATD 637

Query: 692 VAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPN 751
            A+ A+D+V      S I+ A++  + IF+ + +++ ++++ S+     + +  ++ L  
Sbjct: 638 AARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LNQ 696

Query: 752 PLNAMQILWINILMD 766
            LN   I++I I  D
Sbjct: 697 SLNIDLIVFIAIFAD 711

>Scas_710.41
          Length = 904

 Score =  216 bits (550), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 200/733 (27%), Positives = 339/733 (46%), Gaps = 89/733 (12%)

Query: 43  AQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVI 102
           +QL TD   GL+   E+  R+  +G N+ + +E  +   KFL  F+  P+  ++  +A++
Sbjct: 65  SQLKTDPGIGLTT-DEVVRRRKKYGLNQ-MKEENENFIVKFLMYFV-GPIQFVMEAAAIL 121

Query: 103 SFLMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLAS 162
           +  + +               +VGF+QE+++   +E L K +     + R G L  + A+
Sbjct: 122 AAGLSDWVDFGVICGLLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPAN 181

Query: 163 NLVPGDLVRFKVGDRIPADLRIV-ESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPG 221
            +VPGD++    G  IPAD R+V E+  L VD+S +TGE       S AVD KNY     
Sbjct: 182 EIVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGE-------SLAVD-KNY----- 228

Query: 222 SIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKL 281
                GD   + F  + V+ G    +V ATG +T  G    ++      +      ++ +
Sbjct: 229 -----GD---VTFSSSTVKTGTSVMVVTATGDNTFVGRAAALVGEASGGQGHFTDILNDI 280

Query: 282 GQDLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRM 341
           G  L  +  +           +    + + +  + + +  +P GLP +VT T+A+G   +
Sbjct: 281 GTILLVLVIITLLLVWTACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYL 340

Query: 342 AKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKE 401
           AK++AIV++L ++E+L  V ++CSDKTGTLT N +++ +                     
Sbjct: 341 AKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE--------------------- 379

Query: 402 RPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKIN 461
            P  +E   A  L +   C   T  ++ L    +  D A L+SL  +      N++ K  
Sbjct: 380 -PYTVEGVSADDLML-TACLAATRKKKGL----DAIDRAFLKSLNQY--PKAMNALPKYK 431

Query: 462 EIPFN-----SKRKFMAVKTIDANDKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKP 513
            + F+     SK+    VK+ +   + +  VKGA     K VE+           H +  
Sbjct: 432 ILEFHPFDPVSKKVTAVVKSPEG--ETITCVKGAPLFVLKTVEED----------HPVPE 479

Query: 514 NDKAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPT 573
           +      +    LAS G R+L  A          ++  E   E L   G++   DPPR  
Sbjct: 480 DVHENYENKVAELASRGFRSLGVA----------RKRGEGYWEIL---GVMPCMDPPRDD 526

Query: 574 VRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLAS 633
               I E     + V M+TGDA   A   +RQ+G+ V       L       M   +LA 
Sbjct: 527 TARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLGLGGGGDMPGSELAD 586

Query: 634 VIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693
            +++ + FA   P+HK  +V  LQ RG +VAMTGDGVNDAP+LK AD G+++ +  TD A
Sbjct: 587 FVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAA 645

Query: 694 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPL 753
           + A+D+V      S I+  ++  + IF+ + +++ ++++ S+       +  ++ L   L
Sbjct: 646 RSAADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLEIFFGLWIAI-LNRSL 704

Query: 754 NAMQILWINILMD 766
           N   I++I I  D
Sbjct: 705 NIELIVFIAIFAD 717

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  216 bits (549), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 193/730 (26%), Positives = 339/730 (46%), Gaps = 87/730 (11%)

Query: 45  LGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISF 104
           L TD   GL++  E+  R+  +G N+ + +E  +L+ KFL  FI  P+  ++  +A+++ 
Sbjct: 61  LQTDPSYGLTS-DEVTKRRKKYGLNQ-MSEETENLFVKFLMFFI-GPIQFVMEAAAILAA 117

Query: 105 LMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNL 164
            + +                VGF+QEY++   ++ L K +     + R G L  V ++ +
Sbjct: 118 GLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEV 177

Query: 165 VPGDLVRFKVGDRIPADLRIV-ESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSI 223
           VPGD+++ + G  IPAD R+V E   + +D+S +TGE       S AVD +         
Sbjct: 178 VPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGE-------SLAVDKR--------- 221

Query: 224 IPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ 283
              GD     F  + V+ G    IV ATG  T  G    +++            ++ +G 
Sbjct: 222 --FGDST---FSSSTVKRGEAFMIVTATGDSTFVGRAAALVNKAAAGSGHFTEVLNGIGT 276

Query: 284 DLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAK 343
            L  +  V           +    + + +  +++ +  +P GLP +VT T+A+G   +AK
Sbjct: 277 ILLILVIVTLLLVWVASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAK 336

Query: 344 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK----TNCLALSKV 399
           ++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + +  ++      T CLA S+ 
Sbjct: 337 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRK 396

Query: 400 KERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNK 459
           K+                                 +  D A L+SL  +       +  K
Sbjct: 397 KKGL-------------------------------DAIDKAFLKSLISYPRAKAALTKYK 425

Query: 460 INEI-PFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAI 518
           + E  PF+   K +         + ++ VKGA    V K++       + H +  + +  
Sbjct: 426 LLEFHPFDPVSKKVTAIVESPEGERIICVKGA-PLFVLKTVE------EEHPIPEDVREN 478

Query: 519 INDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAI 578
             +    LAS G R L      V+   G+  +           G++   DPPR      +
Sbjct: 479 YENKVAELASRGFRALG-----VARKRGEGHWE--------ILGVMPCMDPPRDDTAQTV 525

Query: 579 EELLQGSVHVIMITGDAENTAVSIARQIGIP--VINPEYSVLSGDKLDQMTDDQLASVID 636
            E     + V M+TGDA   A    RQ+G+   + N E   L       M   +LA  ++
Sbjct: 526 NEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLG--GGGDMPGSELADFVE 583

Query: 637 HVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEA 696
           + + FA   P+HK N+V  LQ+RG +VAMTGDGVNDAP+LK AD G+++ +  TD A+ A
Sbjct: 584 NADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSA 642

Query: 697 SDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAM 756
           +D+V      S I+ A++  + IF+ + +++ ++++ S+     + +  ++ L   LN  
Sbjct: 643 ADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LNRSLNID 701

Query: 757 QILWINILMD 766
            +++I I  D
Sbjct: 702 LVVFIAIFAD 711

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  214 bits (546), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 195/733 (26%), Positives = 334/733 (45%), Gaps = 93/733 (12%)

Query: 45  LGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISF 104
           L TD   GL++  E+A R+  +G N+ + +E  SL  KFL  F+  P+  ++  +A+++ 
Sbjct: 109 LSTDPAYGLTS-DEVARRRKKYGLNQ-MAEENESLIVKFLMFFV-GPIQFVMEAAAILAA 165

Query: 105 LMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNL 164
            + +               +VGF+QE+++   ++ L K +     + R GQL  + A+ +
Sbjct: 166 GLSDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEV 225

Query: 165 VPGDLVRFKVGDRIPADLRIV-ESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSI 223
           VPG++++ + G   PAD RIV E   L +D+S +TGE+    K                 
Sbjct: 226 VPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKH---------------- 269

Query: 224 IPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ 283
              GD     F  + V+ G    +V ATG +T  G    ++      +      ++ +G 
Sbjct: 270 --YGDEV---FSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGI 324

Query: 284 DLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAK 343
            L  +              +    + + +  + + +  +P GLP +VT T+A+G   +AK
Sbjct: 325 ILLVLVIATLLLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 384

Query: 344 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK----TNCLALSKV 399
           ++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + +  +       T CLA S+ 
Sbjct: 385 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRK 444

Query: 400 KERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHF-GINDCRNSVN 458
           K+                                 +  D A L+SL  +    D      
Sbjct: 445 KKGL-------------------------------DAIDKAFLKSLIEYPKAKDALTKYK 473

Query: 459 KINEIPFNSKRKFMAVKTIDANDKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPND 515
            +   PF+   K +         + +V VKGA     K VE+  + I  D  VH+   N 
Sbjct: 474 VLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEED-HPIPED--VHENYENK 530

Query: 516 KAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVR 575
            A        LAS G R L      V+   G+  +           G++   DPPR    
Sbjct: 531 VA-------ELASRGFRALG-----VARKRGEGHWE--------ILGVMPCMDPPRDDTA 570

Query: 576 SAIEELLQGSVHVIMITGDAENTAVSIARQIGIP--VINPEYSVLSGDKLDQMTDDQLAS 633
             I E     + + M+TGDA   A    RQ+G+   + N E   L       M   +LA 
Sbjct: 571 QTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLG--GGGDMPGSELAD 628

Query: 634 VIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693
            +++ + FA   P+HK  +V  LQ RG +VAMTGDGVNDAP+LK AD G+++ +  TD A
Sbjct: 629 FVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAA 687

Query: 694 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPL 753
           + A+D+V      S I+ A++  + IF+ + +++ ++++ S+     + +  ++ L N L
Sbjct: 688 RSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAI-LNNSL 746

Query: 754 NAMQILWINILMD 766
           +   I++I I  D
Sbjct: 747 DINLIVFIAIFAD 759

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  214 bits (546), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 154/482 (31%), Positives = 251/482 (52%), Gaps = 54/482 (11%)

Query: 460  INEIPFNSKRKF--MAVKTIDANDKVVVY---VKGAFEKIVEKSINYI-GRDGKVHKLKP 513
            +  IPF S RK+  + VK  +  +K   Y   +KGA E IV K+ +Y    D  + ++  
Sbjct: 610  VQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAE-IVSKNCSYKRNSDDTLEEINE 668

Query: 514  NDKAIINDAAVALASEGLRTLAFAELEVSATHG-------DKE----------FNEDMVE 556
            ++K   +D    LAS+ LR ++ A  +             DK+          FN    +
Sbjct: 669  DNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQ--K 726

Query: 557  GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI---PVINP 613
            GL   GL+ + DP R  VR ++++  +  V V M+TGD   TA +IAR   I    + + 
Sbjct: 727  GLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSE 786

Query: 614  EYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDA 673
             YS + G +  ++T ++   ++ ++ V AR++PE K  +V  L+  GD+VA+TGDG NDA
Sbjct: 787  AYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDA 846

Query: 674  PALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLST 733
            PALKLAD+G SMG  GT+VA+EASD++L  DDFS I+ AI+ G+ +  +I+ F+ FQL  
Sbjct: 847  PALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIV 906

Query: 734  SVAALSLVAIST--SLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRT 791
            ++ A+ L  +S+  S    + L A+Q+LWIN++MD   A +L  +  D  +M + PR R+
Sbjct: 907  NITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRS 966

Query: 792  DKILTDAVLKRVLISACFIIVGT--IYVFVKEM---AEDGQVTSRD----TTMTFTCFVF 842
              +++ +  K +L  A   ++ T  ++ +  E+     + ++TS        MTF  FV+
Sbjct: 967  TSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSHQQQQLNAMTFNTFVW 1026

Query: 843  FDMFNALSCRHATK-----------SIFEIGFFANKMFNYA--VSLSLLGQLCAIYIPFF 889
               F  L  R   +           S   + FF +   NY     ++++G  C + I FF
Sbjct: 1027 LQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIGS-CQVLIMFF 1085

Query: 890  QG 891
             G
Sbjct: 1086 GG 1087

 Score =  119 bits (297), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 114/446 (25%), Positives = 199/446 (44%), Gaps = 69/446 (15%)

Query: 45  LGTDFDNGLSNPSEIAYRKSI----WGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSA 100
           L TD + G+S P    YRK+     +G N  LP+     + + +     D  + LL  +A
Sbjct: 66  LKTDKNAGISLPEISNYRKTNRYKNYGDNS-LPERIPKSFLQLVWAAFNDKTMQLLTVAA 124

Query: 101 VISFLMG---------------------NXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEA 139
           V+SF++G                     +                V    +Y+ E     
Sbjct: 125 VVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAK 184

Query: 140 LNKLVP-AECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLT 198
           LNK     +  + R+ Q   +   +++ GD++  + GD +PAD  ++ S     DES++T
Sbjct: 185 LNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMI-SGKCEADESSIT 243

Query: 199 GENEPVHK---SSGAVDPKNY----SHIPGSIIPVGDRN--------CIGFMGTLVREGH 243
           GE+  + K    +   D K +    SH     + +GD N        C+   G+ +  G 
Sbjct: 244 GESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGL 303

Query: 244 GKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLS----------------- 286
           G+G++ + G ++V+G     ++  +   TPLQ  + +L  ++S                 
Sbjct: 304 GRGVITSVGINSVYGQTMTSLNA-EPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTR 362

Query: 287 YMSFVXXXXXXXXX---XXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAK 343
           Y+ ++              +G  ++ +F  ++++ V A+PEGLP+ VT+ LA    RM K
Sbjct: 363 YLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTK 422

Query: 344 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERP 403
              +VR L S ET+GS   +CSDKTGTLT N MTV + +   S  + +  L +S+ ++  
Sbjct: 423 DGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLN 482

Query: 404 IK--MEQDVATTLR---IGNICNNGT 424
            K   E++ +++LR   + NI  N T
Sbjct: 483 SKKVFEENCSSSLRNDLLANIVLNST 508

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  205 bits (521), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 196/702 (27%), Positives = 334/702 (47%), Gaps = 92/702 (13%)

Query: 45  LGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISF 104
           L TD   GL++  E+A+R+  +G N+ + DE+ S+  KF+  F+  P+  ++  +A+++ 
Sbjct: 64  LQTDPSYGLTS-DEVAHRRKKYGLNQ-MADERESMIVKFVMFFV-GPIQFVMEAAAILAA 120

Query: 105 LMGNXXXXXXXXXXXXXXXTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNL 164
            + +                VGF+QE+++   ++ L K +     + R GQL  V A+ +
Sbjct: 121 GLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRDGQLVEVPANEV 180

Query: 165 VPGDLVRFKVGDRIPADLRIV-ESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSI 223
           VPGD+++ + G  IPAD R+V E+  L VD+S +TGE       S AVD K Y       
Sbjct: 181 VPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGE-------SLAVD-KGY------- 225

Query: 224 IPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ 283
              GD+    F  + V+ G    +V ATG +T  G    +++     +      ++ +G 
Sbjct: 226 ---GDQT---FSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKASGGQGHFTEVLNGIGI 279

Query: 284 DLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAK 343
            L  +  V           +  + +++ +  + + +  +P GLP +VT T+A+G   +AK
Sbjct: 280 LLLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 339

Query: 344 RKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK----TNCLALSKV 399
           ++AIV++L ++E+L  V ++CSDKTGTLT N +++ + + +  +       T CLA S+ 
Sbjct: 340 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRK 399

Query: 400 KERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHF-GINDCRNSVN 458
           K+                                 +  D A L+SL ++    D      
Sbjct: 400 KKGL-------------------------------DAIDKAFLKSLINYPKAKDALTKYK 428

Query: 459 KINEIPFNSKRKFMAVKTIDANDKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPND 515
            I   PF+   K +         + +V VKGA     K VE+  + I  D  VH+   N 
Sbjct: 429 VIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEED-HPIPED--VHENYENK 485

Query: 516 KAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVR 575
            A        LAS G R L      V+   G+  +           G++   DPPR    
Sbjct: 486 VA-------ELASRGFRALG-----VARKRGEGHWE--------ILGVMPCMDPPRDDTA 525

Query: 576 SAIEELLQGSVHVIMITGDAENTAVSIARQIGIP--VINPEYSVLSGDKLDQMTDDQLAS 633
             + E  +  + V M+TGDA   A    RQ+G+   + N E   L       M   +LA 
Sbjct: 526 ETVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLG--GGGDMPGSELAD 583

Query: 634 VIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693
            +++ + FA   P+HK  +V  LQ RG +VAMTGDGVNDAP+LK AD G+++ +  +D A
Sbjct: 584 FVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGASDAA 642

Query: 694 KEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSV 735
           + A+D+V      S I+ A++  + IF+ + +++ ++++ S+
Sbjct: 643 RSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSL 684

>Scas_297.1
          Length = 800

 Score =  160 bits (405), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/274 (36%), Positives = 154/274 (56%), Gaps = 15/274 (5%)

Query: 593 GDAENTAVSIARQIGI----PVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEH 648
           GD   TA +IAR   I      + PE ++  G K   +T  +   ++ ++ V AR++PE 
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPECAI-EGPKFRTLTKQERIKMLPNLRVMARSSPED 59

Query: 649 KLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFST 708
           K  +V  L+  GD+VA+TGDG NDAPALKLAD+G SMG  GT+VA+EASD++L  DDF+ 
Sbjct: 60  KRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAA 119

Query: 709 ILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIST--SLKLPNPLNAMQILWINILMD 766
           I+ AI+ G+ +  +I+ F+ FQL  ++ A+ L  +S+  S    + L A+Q+LWIN++MD
Sbjct: 120 IVDAIKWGRCVSISIKKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMD 179

Query: 767 GPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIY-------VFV 819
              A +L  +  D  +M + PR R+  ++  +  K +L  +C  ++ T         +F 
Sbjct: 180 TLAALALATDKPDPNIMDRKPRGRSTPLIFPSTWKMILSQSCLQLIVTFILHFNGKEIFF 239

Query: 820 KEMAE-DGQVTSRDTTMTFTCFVFFDMFNALSCR 852
           +   E  G    +   MTF  FV+   F  L  R
Sbjct: 240 RGRDEITGHEQQQLNAMTFNTFVWLQFFTLLVSR 273

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 118/298 (39%), Gaps = 49/298 (16%)

Query: 27  PNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLST 86
           P    +Y   S++D I    T+  N          R  ++  N +   E+V   K FL  
Sbjct: 463 PQNLFKYLNSSLQDGIKLTETETKN-----YRHTQRXKLYSDNRI--PERVP--KTFLQL 513

Query: 87  FIE---DPLILLLIGSAVISFLMGNXXXXXXXXXXXXXXXTVGFV--------------- 128
             E   D  +LLL  +AV+SF++G                 +  V               
Sbjct: 514 IWEAFNDKTMLLLTAAAVVSFVLGLYEALYTPPEYDPEGNPIKKVDWIEGIAIMIAVIVV 573

Query: 129 ------QEYKSEKSLEALNKLVP-AECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPAD 181
                  +Y+ E     LNK     +  + R+ Q       NL+ GD++  + GD IPAD
Sbjct: 574 VFVGAVNDYQKELQFARLNKKKENRKIIVIRNSQELLTSIHNLLVGDIITLQTGDVIPAD 633

Query: 182 LRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIP-----------GSIIPVGDR- 229
             +VE     VDES++TGE++ + K       K +  I            G   P GD+ 
Sbjct: 634 GVLVEG-QCEVDESSITGESDTIKKVKVFNALKTFDVINEGKSNDQILDIGFKTPNGDKI 692

Query: 230 -NCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLS 286
            +C+   G+ +  G GK I+ + G +++ G    M   ++   TPLQ  + +L   +S
Sbjct: 693 PDCMLISGSKLLSGLGKAIITSVGTNSIHGRTM-MALKVEPESTPLQQRLSQLADSIS 749

>Scas_569.0d
          Length = 468

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 136/218 (62%), Gaps = 10/218 (4%)

Query: 614 EYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDA 673
           E  V++G + D++T +Q+ ++     V AR +P+ K+ ++ AL +R    AMTGDGVND+
Sbjct: 78  ENMVMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDS 137

Query: 674 PALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLST 733
           P+LK+A++G++MG  G+DVAK+ASD+VL+DD+F++IL AIEEG+ + +NIQ F+   L+ 
Sbjct: 138 PSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAE 197

Query: 734 SVA-ALSLVA----ISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPR 788
           +VA AL L+          K   PL  +++LWI ++    PA  LG+E    ++M +PP 
Sbjct: 198 NVAQALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPN 257

Query: 789 KR-----TDKILTDAVLKRVLISACFIIVGTIYVFVKE 821
                  T +I+ D  +  ++++ C +   T  V+ K+
Sbjct: 258 DSKSGIFTWEIIVDMFVYGIIMAGCCMGSFTTVVYGKD 295

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 198/821 (24%), Positives = 324/821 (39%), Gaps = 162/821 (19%)

Query: 146  AECHLTRSGQLSHVLASNLVPGDLVRFKVGDR----IPADLRIVESIDLCVDESNLTGEN 201
             E  + +    + V +S+LVPGDL  F++ D     +P D  ++ S D  V+ES LTGE+
Sbjct: 538  CEVRVYKDRFWTQVNSSDLVPGDL--FEISDPSLVVLPCDAVLI-SGDCIVNESMLTGES 594

Query: 202  EPVHK--SSGAVDPKNYSHIPGSIIPVGDRNCIGFMGT---LVREGHGKG----IVIATG 252
             PV K  ++ A   +       S +         F GT    VR   G+G    +VI TG
Sbjct: 595  VPVSKYAATEATMAQLLQDFKSSQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTG 654

Query: 253  KHTVFGSVFEMMSGIDKP-----------KTPLQTAMDKLGQDLSYMSFVXXXXXXXXXX 301
              T  GS+   M    KP                T +   G  +S + F+          
Sbjct: 655  FSTTKGSLVRSMV-FPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRL-------- 705

Query: 302  XQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVN 361
              G  +  M   A+ +    +P  LP  +T+  +  + R+ K+         V   G V+
Sbjct: 706  --GLEYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVD 763

Query: 362  VICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALS-------KVKERPIKMEQDVATTL 414
            ++C DKTGTLT   + V  I      E  +  L LS       +V ++    + + A   
Sbjct: 764  MMCFDKTGTLTEEGLDVLGI-HFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEF 822

Query: 415  RIGNICNN--GTYSQEHL--KYLGNPTDIAILESLQ------------------------ 446
            +  N   +    +S +H+  + LG+P D+ + E  +                        
Sbjct: 823  KAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPA 882

Query: 447  --------HFGINDCRNSVNKINEIPFNSKRKFMAV--KTIDANDKVVVYVKGAFEKIVE 496
                    +F  ND  N +  I    F S+ + M+V  K    N     + KGA E I +
Sbjct: 883  VVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKEN-TYWSFTKGAPEVIAD 941

Query: 497  KSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEV---SATHGDKEFNED 553
                 I     +    P D    ++        G R +A A   +   S  +  K   E+
Sbjct: 942  -----ICNPATI----PKD---FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQKVSREE 989

Query: 554  MVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIG------ 607
            + + L F G I   +  +   ++A++EL   ++  +M TGD   TAVS+ R  G      
Sbjct: 990  VEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSER 1049

Query: 608  --IPVIN--------------------------------PEYS---VLSGDKL------- 623
              IP +N                                PE S    ++GD         
Sbjct: 1050 VFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRND 1109

Query: 624  DQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV 683
            + + DD +++V+   +++AR +P+ K  +V  LQK    V   GDG ND  ALK A+IG+
Sbjct: 1110 EILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGI 1169

Query: 684  SMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAI 743
            S+ +    VA   +  V    D S +L  I+EG+     + +F  FQ  +  +A+  + I
Sbjct: 1170 SLSEAEASVAAPFTSAVF---DISCVLDVIKEGRASL--VTSFSCFQYMSLYSAIQFITI 1224

Query: 744  STSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR--TDKILTDAVLK 801
            +      + L   Q L+I++L+  P A S+     + ++++K P     + KIL    L 
Sbjct: 1225 TILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNSKLVKKRPSANLVSPKILVPLCLN 1284

Query: 802  RVLISAC----FIIVGTIYVFVKE-MAEDGQVTSRDTTMTF 837
              LI       +I V     ++K  +  D  V S D T+ F
Sbjct: 1285 ITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSDNTVLF 1325

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score =  115 bits (287), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 193/849 (22%), Positives = 334/849 (39%), Gaps = 179/849 (21%)

Query: 132  KSEKSLEALNKLVPAEC--HLTRSGQLSHVLASNLVPGDLVRFKVGD----RIPADLRIV 185
            ++++S E L++L    C   + R G  S V +S+LVPGD+  +++ D     +P D  I+
Sbjct: 523  ETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDI--YELTDPSLSLLPCD-SIL 579

Query: 186  ESIDLCVDESNLTGENEPVHKSSGA-----------VDPKNYSHIPGSIIPVGDRNCIGF 234
             S D  V+ES LTGE+ PV K +             +D +  S +  S +         F
Sbjct: 580  ISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSSFVSKSFL---------F 630

Query: 235  MGT---LVREGHGK----GIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSY 287
             GT    VR   G+    G+V  TG  T  GS+   M    KP T  +   D   + + Y
Sbjct: 631  NGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMV-FPKP-TGFKFYEDSF-KYIGY 687

Query: 288  MSFVXXXXXXXXXXXQGRSWLE---MFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKR 344
            +S +             R  L+   M   A+ +    +P  LP  +++     + R+ K+
Sbjct: 688  ISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKK 747

Query: 345  KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENK-------------- 390
                     V   G ++V+C DKTGTLT + + V  +  +  ++ +              
Sbjct: 748  GIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLL 807

Query: 391  -----TNCLALSKVKERPIKMEQDVATTLRI--------------------------GNI 419
                 ++C++   +K +   +      +LR+                          GN 
Sbjct: 808  QSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFTKWSDEEETGNR 867

Query: 420  CNNGTYSQEHLKYLGNPTDIAILESLQH------FGINDCRNSVNKINEIPFNSKRKFMA 473
              +  Y + H      P +     ++ H      F   +  N +  +    F S  + M+
Sbjct: 868  KVHSLYEERH-DGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMS 926

Query: 474  VKTIDANDKVVV-YVKGAFEKIVE---KSINYIGRDGKVHKLKPNDKAIINDAAVALASE 529
            V     ++ V + + KGA E I E   K    +  +  +H    N   +I  A   L  +
Sbjct: 927  VIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQ 986

Query: 530  GLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVI 589
                        S  +  K   E++   L F G I   +  + T +  +E L +  +  I
Sbjct: 987  ------------SWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTI 1034

Query: 590  MITGDAENTAVSIARQIG--------IPVIN-----PEYSVL-------SGDKLDQMT-- 627
            M TGD   TA+S+ R+ G        + VIN      E  ++       S D LD +T  
Sbjct: 1035 MCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLR 1094

Query: 628  ------DD-------------------QLASVIDHV----NVFARATPEHKLNIVRALQK 658
                  DD                   Q+  VI+++    +++AR +P+ K  +V  LQ 
Sbjct: 1095 PLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQS 1154

Query: 659  RGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 718
             G  V   GDG ND  ALK ADIG+S+ +    VA   +  +    + S +L  ++EG+ 
Sbjct: 1155 IGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF---EISCVLDVMKEGRA 1211

Query: 719  IFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPV 778
                + +F  FQ  +  +A   V I       + L   Q L+I++ +  P A  +     
Sbjct: 1212 AL--VTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSK- 1268

Query: 779  DHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTI--YVFVKEM--------AEDGQV 828
             +EV+ K  ++ T  +++  +L  +L+    + V  +  ++ V+ M         +D  V
Sbjct: 1269 PYEVLAK--KRPTANLVSPKILIPLLVHIVILFVFQLVPWLAVQHMKWYRQPVVGDDEHV 1326

Query: 829  TSRDTTMTF 837
             S D T+ F
Sbjct: 1327 ASSDNTILF 1335

>Scas_665.30
          Length = 1439

 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 183/854 (21%), Positives = 327/854 (38%), Gaps = 179/854 (20%)

Query: 128  VQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDR----IPADLR 183
            V+  +++KSL  ++     E  + R    ++V +++LVPGD+  +++ D      P D  
Sbjct: 310  VETRRTQKSLADMSHFA-CEVRVFRDEFWTNVNSADLVPGDI--YEISDPSLTVFPCD-S 365

Query: 184  IVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHI----PGSIIPVGDRNCIGFMGTLV 239
            ++ S D  V+ES LTGE+ PV K     +P+    +      + I         F GT +
Sbjct: 366  LLLSGDCIVNESMLTGESVPVSKFPA--EPETMLQLLDDFQNTQISSYLSKSFLFNGTTI 423

Query: 240  ---REGHGK----GIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKL----------- 281
               R  +G+     +V+ TG  T  GS+   M    KP T  +   D             
Sbjct: 424  IRARIPYGQSAALAMVVRTGFSTTKGSLVRSMV-FPKP-TGFKFYEDSFKYIGVMALIAL 481

Query: 282  -GQDLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLR 340
             G  +S + F+            G     M   A+ +    +P  LP  +T+     + R
Sbjct: 482  FGFSISCIQFIKI----------GLDKRTMILRALDIITIVVPPALPATLTIGTGFALSR 531

Query: 341  MAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKI-WCLGSMENK--------- 390
            + K+         V   G ++++C DKTGTLT N + V  +  C+ S  N          
Sbjct: 532  LKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQD 591

Query: 391  ----------TNCLALSKVKERPIKMEQDVATTLR------IGNICNNGTYSQEHLKYLG 434
                       +C +    + +   +      +LR      IG+  +   +      Y  
Sbjct: 592  VHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEE 651

Query: 435  N-------------------PTDIAILESLQH---------FGINDCRNSVNKINEIPFN 466
            +                   P +I I+ ++ H         F  ND  N +  I    F 
Sbjct: 652  DFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFL 711

Query: 467  SKRKFMAVKTIDANDKVV-VYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVA 525
            S+ + M+V    +N+ V   + KGA E I +              L  N + ++N     
Sbjct: 712  SELRRMSVIVKPSNEDVYWAFTKGAPEVITQIC--------NKATLPANFEEMLN----Y 759

Query: 526  LASEGLRTLAFAELEV---SATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELL 582
               +G R +A A   +   +  +  K   E++   + F G I   +  +      ++ L 
Sbjct: 760  YTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQ 819

Query: 583  QGSVHVIMITGDAENTAVSIARQIGI---------------------------------- 608
            + S+  +M TGD   TA+S+ RQ  +                                  
Sbjct: 820  EASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTL 879

Query: 609  ------PVINPE------------YSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKL 650
                  P+ N              + ++ GD+ + +++D + +V+    ++AR +P+ K 
Sbjct: 880  DSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKH 939

Query: 651  NIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTIL 710
             ++  LQ+    V   GDG ND  ALK AD+G+S+ +    VA   +  V    D S +L
Sbjct: 940  ELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVL 996

Query: 711  TAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPA 770
              I+EG+     + +F  FQ  +  +A+  + I+      + L   Q L+I++L+  P A
Sbjct: 997  DVIKEGRACL--VTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIA 1054

Query: 771  QSLGV-EPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKE------MA 823
              +   +P D  V ++P        +   +L  +++   F I+  I V  +E      + 
Sbjct: 1055 IFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVG 1114

Query: 824  EDGQVTSRDTTMTF 837
             D  V S D T+ F
Sbjct: 1115 GDDVVESSDNTILF 1128

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score =  112 bits (279), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 180/822 (21%), Positives = 317/822 (38%), Gaps = 152/822 (18%)

Query: 146  AECHLTRSGQLSHVLASNLVPGDLVRFKVGD----RIPADLRIVESIDLCVDESNLTGEN 201
             E  + R G  S + +S LVPGD+  +++ D     +P D  I+ S D  V+ES LTGE+
Sbjct: 539  CEVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGES 595

Query: 202  EPVHKSSGAVDP--KNYSHIPGSIIPVGDRNCIGFMGT-LVREGHGKG------IVIATG 252
             PV K   + +   + +     + I         F GT L+R     G      + + TG
Sbjct: 596  VPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTG 655

Query: 253  KHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQGRSWLEMFQ 312
              T  GS+   M           +   K    ++ ++F             G     M  
Sbjct: 656  FSTTKGSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRTMIL 715

Query: 313  IAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTGTL 371
             A+ +    +P  LP  +T+  +  + R+ K K I    P+ V   G ++V+C DKTGTL
Sbjct: 716  RALDIITIVVPPALPATLTIGTSFALNRL-KEKGIFCIAPTRVNIGGKIDVMCFDKTGTL 774

Query: 372  TANHMTV--SKIWCLGSMENKT------------------NCLALSKVKERPIKMEQDVA 411
            T + + V   ++ C  +    +                  +C      K R   +     
Sbjct: 775  TEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTC 834

Query: 412  TTLRI-----------------------GNICNNGTYSQEHLKYLGN--PTDIAILESLQ 446
             +LR+                        +  N+  +S    ++ G   P +  I+ ++ 
Sbjct: 835  HSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIV 894

Query: 447  H---------FGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVV-VYVKGAFEKIVE 496
            H         F  ND  N +  I    F S+ + M+V     N+ V   Y KGA E I++
Sbjct: 895  HPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIID 954

Query: 497  KSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEV---SATHGDKEFNED 553
                 I     +    P+D    +D        G R +A A   +   +  +  K   E+
Sbjct: 955  -----ICNPATL----PSD---YDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREE 1002

Query: 554  MVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI----- 608
            +   + F G I   +  +      + +L   ++  +M TGD   TA+S+ ++  +     
Sbjct: 1003 VESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDR 1062

Query: 609  --------------PVIN------------------------PEYSVLSGDKL------- 623
                          PVI+                        P    ++G+         
Sbjct: 1063 VYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQ 1122

Query: 624  DQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGV 683
            D  +++ +  ++   ++FAR +P+ K  +V  LQK    V   GDG ND  ALK AD+G+
Sbjct: 1123 DNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGI 1182

Query: 684  SMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAI 743
            S+ +    VA   +  +    D + +L  I+EG+     + +F  FQ  +  +A+  ++I
Sbjct: 1183 SLSEAEASVAAPFTSKIF---DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISI 1237

Query: 744  STSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR--TDKILTDAVLK 801
            +      + L   Q L+I++L+  P A ++      HE+ +K P     + KIL   +L 
Sbjct: 1238 TILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSANLVSPKILVPLILD 1297

Query: 802  RVLISACFIIVGTIYV-----FVKEM-AEDGQVTSRDTTMTF 837
             V +   F  +  I++     ++K +   D  V S D T+ F
Sbjct: 1298 IVFL-FLFQFLPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLF 1338

>Kwal_26.9207
          Length = 1469

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 193/858 (22%), Positives = 326/858 (37%), Gaps = 181/858 (21%)

Query: 132  KSEKSLEALNKLVPAEC--HLTRSGQLSHVLASNLVPGDLVRFKVGD----RIPADLRIV 185
            +++K+ + L ++  + C   + R G    V +S LVPGD+  +++ D      P D  ++
Sbjct: 541  ETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGDV--YEISDPSLSTFPCD-SLL 597

Query: 186  ESIDLCVDESNLTGENEPVHKSSGAVDPKNYS---HIPGSIIPVGDRNCIGFMGTLV--- 239
             S D  V+ES LTGE+ PV K   A D   Y        + I         F GT +   
Sbjct: 598  LSGDCIVNESMLTGESVPVSKIP-ASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRV 656

Query: 240  ----REGHGKGIVIATGKHTVFGSVFEMM-----SGIDKPKTPLQ-----TAMDKLGQDL 285
                 +     +V+ TG  T  GS+   M     SG    +   +     T +   G  +
Sbjct: 657  RIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFKYIGFMTLIALAGFSI 716

Query: 286  SYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK 345
            S ++F+            G ++  M   A+ +    +P  LP  +++  +  + R+ K+ 
Sbjct: 717  SCINFIRL----------GLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKG 766

Query: 346  AIVRRLPSVETLGSVNVICSDKTGTLTANHMT--------------------VSKIWCLG 385
                    V   G ++V+C DKTGTLT + +                     ++ +  L 
Sbjct: 767  IFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLF 826

Query: 386  SMENKTNCLALSKVKERPIKMEQDVATTLRI--GNIC-----------NNGTYSQEHLKY 432
            +  +  +C +    K R   +      +LR+  G +             N +Y+++   +
Sbjct: 827  NKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDF 886

Query: 433  LGN------------PTDIAILESLQH---------FGINDCRNSVNKINEIPFNSKRKF 471
              +            P +  I  ++ H         F  ND  N +  I    F S+ + 
Sbjct: 887  KFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRR 946

Query: 472  MAVKTIDANDKVVV-YVKGAFEKIVE---KSINYIGRDGKVHKLKPNDKAIINDAAVALA 527
            M+V      + V   + KGA E I E   KS      +  + +   N   +I  A   L 
Sbjct: 947  MSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLP 1006

Query: 528  SEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVH 587
                RT  FA+         K   E++   + F G +   +  +P+    +  L    + 
Sbjct: 1007 K---RTWRFAQ---------KVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAGIR 1054

Query: 588  VIMITGDAENTAVSIARQIG--------IPVINPEYS----------------VLSGDKL 623
             IM TGD   TA+S+ R+ G        +P IN                    +L G  L
Sbjct: 1055 SIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVTL 1114

Query: 624  DQM---TDDQLA------------------SVIDHV----NVFARATPEHKLNIVRALQK 658
            + M   +D  +A                  S I+ V    +++AR +P+ K  +V  LQ 
Sbjct: 1115 EPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG 1174

Query: 659  RGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 718
               +V   GDG ND  ALK AD+GVS+ +    VA   +  V    + S IL  I+EG+ 
Sbjct: 1175 LDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVF---EISCILDVIKEGRA 1231

Query: 719  IFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPV 778
                  +F  FQ  +  +A+  V ++        L   Q L+I++ +  P A  +     
Sbjct: 1232 SLTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKP 1289

Query: 779  DHEVMRKPPRKR--TDKILTDAVLKRVLISACFIIVGTIYVFVKEM--------AEDGQV 828
             H++++K P     + KIL   V     I+   +   T ++ V+ M          D  V
Sbjct: 1290 YHKLVKKRPSANLVSPKILAPLVAN---IAIILVFQATPWLVVQAMRWYQAPVVGGDDAV 1346

Query: 829  TSRDTTMTFTCFVFFDMF 846
             S D T+ F    FF  F
Sbjct: 1347 QSSDNTVLF----FFSNF 1360

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 147/593 (24%), Positives = 234/593 (39%), Gaps = 143/593 (24%)

Query: 132 KSEKS--LEALNKLVPAECHLTR-SGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESI 188
           KSE S  +  L  L P+ C +    G    +    L P D+V    G +IPAD  ++ + 
Sbjct: 391 KSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN- 449

Query: 189 DLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIV 248
           +  VDES +TGE+  V K  G       S + G              G++   GH     
Sbjct: 450 ETEVDESLITGESMLVEKIVG-------SQVIG--------------GSVNGPGHFYFRA 488

Query: 249 IATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ-------DLSYMSFVXXXXXXXXXX 301
           I  G+ T   ++   M      K P+Q   DK+          LS ++F+          
Sbjct: 489 IRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTMK 548

Query: 302 X--------QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS 353
                     G+ ++ M Q+++S+ + A P  L +     + +G    A    +++    
Sbjct: 549 TPPLIFNSENGKFFMCM-QMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDV 607

Query: 354 VETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATT 413
           +E   ++     DKTGTLT   M+V         EN  N    S V +   KM   ++  
Sbjct: 608 LEKCSALQTFLFDKTGTLTTGRMSV---------ENFIN--YNSDVSDLHWKM---ISLC 653

Query: 414 LRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPFNSKRKFMA 473
             IG          EH      P   AI        +N   + VNK             +
Sbjct: 654 ESIG----------EH------PVAKAI--------VNYADSHVNK------------SS 677

Query: 474 VKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRT 533
           +  +D +++ V+  KG    I +K+ +      K+H +   +K +  D       E L  
Sbjct: 678 IFDLDLSNEEVLIGKGISCNITDKNTS------KIHTITIGNKKLFPD-------ESLSD 724

Query: 534 LAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITG 593
           +A + L  S    D           +  G   ++D  +      +E L    +   M+TG
Sbjct: 725 IASSTLTESYVSIDG----------SLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTG 774

Query: 594 DAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIV 653
           DA  +A+ +A+Q+GI                              +VF+  TPE K +IV
Sbjct: 775 DAHQSALKVAQQLGISA---------------------------NDVFSEVTPEQKRDIV 807

Query: 654 RALQKRG-DIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDD 705
             LQ  G + VA  GDG+ND+PAL  AD+G+S+   GTD+A EA+D+V+ D D
Sbjct: 808 IQLQNNGTERVAFVGDGINDSPALVEADLGISISS-GTDIAIEAADIVILDSD 859

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 99.4 bits (246), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 182/834 (21%), Positives = 314/834 (37%), Gaps = 168/834 (20%)

Query: 146  AECHLTRSGQLSHVLASNLVPGDLVRFKVGDR----IPADLRIVESIDLCVDESNLTGEN 201
             +  + R    + + +S LVPGD+  ++V D     +P D  I+ S D  V+ES LTGE+
Sbjct: 551  CDVRVLRDKFWTTISSSELVPGDI--YEVSDPNITILPCD-SILLSSDCIVNESMLTGES 607

Query: 202  EPVHKSSGA-------VDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGI--VIATG 252
             PV K            D    + I   +      N    +   +  G    +  V+ TG
Sbjct: 608  VPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTG 667

Query: 253  KHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQGRSWLE--- 309
              T  GS+   M    KP T  +   D   + + +MS +             +  L+   
Sbjct: 668  FSTTKGSLVRSMV-FPKP-TGFKFYRDSF-KYIGFMSLIAIFGFCVSCVQFIKLGLDKKT 724

Query: 310  MFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTG 369
            M   A+ +    +P  LP  +T+     + R+ ++         +   G ++V+C DKTG
Sbjct: 725  MILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTG 784

Query: 370  TLTANHMTV--------------------SKIWCLGSMENKTNCLALSKVKERPIKMEQD 409
            TLT + + V                    S I  +    +  +C +    K R   M   
Sbjct: 785  TLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLL 844

Query: 410  VATTLRI--GNICNN----------GTYSQE-------HLKYLGN------PTDIAILES 444
               +LR   GN+  +          G   +E       H  Y G       P +  I+ +
Sbjct: 845  TCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPA 904

Query: 445  LQH---------FGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVVV-YVKGAFEKI 494
            + H         F  ND  N +  +    F S+ + M+V     ND V   + KGA E I
Sbjct: 905  VVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVI 964

Query: 495  VEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEV---SATHGDKEFN 551
             E               K    A   +        G R +A A   +   +  +  K   
Sbjct: 965  SEICN------------KSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSR 1012

Query: 552  EDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIG---- 607
            E++   L F G I   +  +      ++ L   ++  IM TGD   TA+S+ R+ G    
Sbjct: 1013 EEVESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQC 1072

Query: 608  ----IPVIN-----------------PE-------------------------YSV-LSG 620
                +P IN                 P+                         Y++ +SG
Sbjct: 1073 SRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSG 1132

Query: 621  DKL-------DQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDA 673
            D         +++ ++ L  ++ + +++AR +P+ K  ++  LQK    V   GDG ND 
Sbjct: 1133 DVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDC 1192

Query: 674  PALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLST 733
             ALK AD+G+S+ +    VA   +  +    + S +L  I EG+     + +F  FQ  +
Sbjct: 1193 GALKAADVGISLSEAEASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMS 1247

Query: 734  SVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDK 793
              +A+  + I+      + L   Q L+I++L+  P A  +       ++ +K P   +  
Sbjct: 1248 LYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRP---SAN 1304

Query: 794  ILTDAVLKRVLISAC---------FIIVGTIYVFVKEM-AEDGQVTSRDTTMTF 837
            +++  +L  +LIS           +IIV  +  ++K +   D  V S D T+ F
Sbjct: 1305 LVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 142/616 (23%), Positives = 248/616 (40%), Gaps = 110/616 (17%)

Query: 145 PAECHLTRSGQLSHVLASNLVPGDLV---RFKVGDRIPADLRIVESIDLCVDESNLTGEN 201
           P   ++ R G+   +  + L+P D+V   R      +P DL +V+   + V+E+ L+GE+
Sbjct: 251 PYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALPCDLILVDGTCI-VNEAMLSGES 309

Query: 202 EPVHKSSGAVDPKNYS-HIPGSIIPVGDRNCIGFMGTLVRE---------------GHGK 245
            P+ K S  + P N    I G+     D+  +   GT V +               G   
Sbjct: 310 TPLLKESIRLRPGNEELQIEGT-----DKISVLHGGTKVLQVTTPEKTGKVPSPPDGGAI 364

Query: 246 GIVIATGKHTVFGSVFEMM------SGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXXXXX 299
            IV  TG  T  GS+  +M       G+D  K  L   +      L   + V        
Sbjct: 365 AIVTKTGFETSQGSLVRVMIYSSERVGVDN-KEALYFILF-----LLIFAVVASWYVWVE 418

Query: 300 XXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGS 359
               GR   ++    + +  + +P  LP+ +T+ +   +  ++K          +   G 
Sbjct: 419 GTKMGRVQSKLILDCILIITSVVPPELPMELTMAVNSSLSALSKFYVYCTEPFRIPFAGR 478

Query: 360 VNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNI 419
           ++V C DKTGTLT   +    +  L S  +  +   L    + P       +T+L +G  
Sbjct: 479 IDVCCFDKTGTLTGEDLVFEGLAGLSS--DPKDIRHLYSATDCP------NSTSLVVG-- 528

Query: 420 CNNGTYSQEHLKYLGNPTDIAILESLQHFG------INDCRNSVNKINEIPFNSK-RKFM 472
             +     E  + +G+P + A L++L+          N+    V  +    F+S  ++  
Sbjct: 529 AAHALVRLEDGEIVGDPMEKATLKALKWTVEKGDKVFNEKNGQVTILRRFQFSSALKRSS 588

Query: 473 AVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLR 532
           +V T D   K+   VKGA E I E+         +++K      + +    +ALAS+ L 
Sbjct: 589 SVATHDG--KLYSAVKGAPETIRERLFTIPANYDEIYKSFTRSGSRV----LALASKKLE 642

Query: 533 TLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMIT 592
            ++ +++E      D+E  E     L F G +  + P +      I+ L + +   +MIT
Sbjct: 643 KMSQSQIE----DADREHFE---RDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMIT 695

Query: 593 GDAENTAVSIARQIGI-------------------------PVINPEYSV---------- 617
           GD   TAV +A+++GI                           ++ E+ V          
Sbjct: 696 GDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGI 755

Query: 618 -------LSGDKLDQMT-DDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDG 669
                  ++G  L+ +    QL  +I H  ++AR +P  K  I+  L+  G    M GDG
Sbjct: 756 FDKYDLAVTGHALEALKGHHQLQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTLMCGDG 815

Query: 670 VNDAPALKLADIGVSM 685
            ND  ALK A +GV++
Sbjct: 816 TNDVGALKQAHVGVAL 831

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 137/616 (22%), Positives = 238/616 (38%), Gaps = 111/616 (18%)

Query: 145 PAECHLTRSGQLSHVLASNLVPGDLV---RFKVGDRIPADLRIVESIDLCVDESNLTGEN 201
           P   ++ R G+   +    L P DLV   R      IP DL +++     V+E+ L+GE+
Sbjct: 252 PYAINVFRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLIDG-SCIVNEAMLSGES 310

Query: 202 EPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVRE---------------GHGKG 246
            P+ K S  + P N       +    D+N +   GT   +               G    
Sbjct: 311 TPLLKESIKLRPANDQLQLDGV----DKNAVLHGGTKALQVTAPENRTGVITPPDGGALA 366

Query: 247 IVIATGKHTVFGSVFE-MMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQGR 305
           +V  TG  T  GS+   M+   ++     + A+  +   L + + V            GR
Sbjct: 367 VVTKTGFETSQGSLVRVMIFSAERVDVGNKEALYFILFLLIF-AIVASWYVWKEGTRMGR 425

Query: 306 SWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICS 365
              ++    + +  + +P  LP+ +T+ +   +  ++K          +   G ++V C 
Sbjct: 426 IQSKLILDCILIITSVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCF 485

Query: 366 DKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNICNNGTY 425
           DKTGTLTA  +       L  + + ++         R +K   D +  +       +   
Sbjct: 486 DKTGTLTAEDLVFEG---LAGLHDGSDI--------RTLKSANDASQEVLSAIGAAHALV 534

Query: 426 SQEHLKYLGNPTDIAILES----------LQHFGINDCRNSVNKINEIPFNSKRKFMAVK 475
             +  + +G+P + A L++          ++  G ++ R     +    F+S  K  A  
Sbjct: 535 KLDDGEIVGDPMEKATLKASSWTVDFKDVVKRAGADNIR----ILRRFQFSSSLKRSASI 590

Query: 476 TIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLA 535
              +N +    VKGA E I E+ +N +          P+D    +D   +    G R LA
Sbjct: 591 ASQSN-RFFAAVKGAPETIRER-LNSV----------PSD---YDDIYKSFTRSGSRVLA 635

Query: 536 FAELEV---SATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMIT 592
            A  ++   S +  D    +++  GLTF   +  + P +      I+ L + S   IMIT
Sbjct: 636 LAYKDLPKMSNSQIDNIDRDEIETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMIT 695

Query: 593 GDAENTAVSIARQIGI----------PV-------------------INPEYSVLSGDKL 623
           GD   TAV +A+++GI          P+                    NP+       ++
Sbjct: 696 GDNPLTAVHVAKEVGIVDRETLILDEPIDGSSHALVMRDVNETIVKPFNPDADTFDEKEI 755

Query: 624 DQMTD--------------DQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDG 669
            Q  D               QL  VI H  ++AR +P  K  I+  L+  G    M GDG
Sbjct: 756 FQKYDLAVTGHALKLLQGHKQLRDVIRHTWIYARVSPSQKEFILITLKDMGYQTLMCGDG 815

Query: 670 VNDAPALKLADIGVSM 685
            ND  ALK A +G+++
Sbjct: 816 TNDVGALKQAHVGIAL 831

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 138/618 (22%), Positives = 233/618 (37%), Gaps = 114/618 (18%)

Query: 145 PAECHLTRSGQLSHVLASNLVPGDLV---RFKVGDRIPADLRIVESIDLCVDESNLTGEN 201
           P   ++ R+ +   +  + L+P DLV   R      IP DL +++     V+E+ L+GE+
Sbjct: 253 PYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDG-SAIVNEAMLSGES 311

Query: 202 EPVHKSSGAVDP-KNYSHIPGSIIPVGDRNCIGFMGTLVRE---------------GHGK 245
            P+ K S  + P ++   + G      D+  +   GT   +               G   
Sbjct: 312 TPLLKESIKLRPSEDNLQLDGV-----DKIAVLHGGTKALQVTPPEHKSDIPPPPDGGAL 366

Query: 246 GIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSF------VXXXXXXXX 299
            IV  TG  T  GS+  +M       +  + ++D   + L ++ F      +        
Sbjct: 367 AIVTKTGFETSQGSLVRVMI-----YSAERVSVDN-KEALMFILFLLIFAVIASWYVWVE 420

Query: 300 XXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGS 359
               GR   ++    + +  + +P  LP+ +T+ +   +  +AK          +   G 
Sbjct: 421 GTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGR 480

Query: 360 VNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNI 419
           ++V C DKTGTLT   +    +   G   +  N   L    E P       +T L IG  
Sbjct: 481 IDVCCFDKTGTLTGEDLVFEGL--AGISADSENIRHLYSAAEAP------ESTILVIG-- 530

Query: 420 CNNGTYSQEHLKYLGNPTDIAILESL------QHFGINDCRNSVNKINEIPFNSKRKFMA 473
             +     E    +G+P + A L+++      ++    +    ++ I    F+S  K  +
Sbjct: 531 AAHALVKLEDGDIVGDPMEKATLKAVGWAVERKNSNYREGTGKLDIIRRFQFSSALK-RS 589

Query: 474 VKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRT 533
                 ND +   VKGA E I E+  +      +++K              +    G R 
Sbjct: 590 ASIASHNDALFAAVKGAPETIRERLSDIPKNYDEIYK--------------SFTRSGSRV 635

Query: 534 LAFAELEVSATHGDK--EFNEDMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIM 590
           LA A   +      K  + N D VE  LTF G +  + P +      I+ L + S   IM
Sbjct: 636 LALASKSLPKMSQSKIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIM 695

Query: 591 ITGDAENTAVSIARQIGIPV-----------------------------INPEYSVLSGD 621
           ITGD   TAV +A+++GI                                +P        
Sbjct: 696 ITGDNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHS 755

Query: 622 KLDQMTD--------------DQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTG 667
           KL    D               QL  ++ H  V+AR +P  K  ++  L+  G    M G
Sbjct: 756 KLFDRYDIAVTGYALNALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCG 815

Query: 668 DGVNDAPALKLADIGVSM 685
           DG ND  ALK A +G+++
Sbjct: 816 DGTNDVGALKQAHVGIAL 833

>Scas_583.14*
          Length = 875

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 99/414 (23%), Positives = 167/414 (40%), Gaps = 73/414 (17%)

Query: 322 IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKI 381
           +P  LP+ +T+ +   +  ++K          +   G ++V C DKTGTLT   +    +
Sbjct: 97  VPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGL 156

Query: 382 WCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAI 441
             L         L  S+        +    T L +G    +     +  + +G+P + A 
Sbjct: 157 AGLSDKSEDVRHLFSSE--------DASQETILVVG--AAHALVKLDDGEIVGDPMEKAT 206

Query: 442 LESL------QHFGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIV 495
           L++L        F        +  +    F+S  K  +       DK+   VKGA E I 
Sbjct: 207 LKALGWKVEGNDFTSRPKTGKLQILRRFQFSSALK-RSSSVASHKDKLFTAVKGAPETIR 265

Query: 496 EKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMV 555
           E+         +++K      + +    +ALAS+ L  L+  +L+        + + D +
Sbjct: 266 ERLAVVPKNYDEIYKSFTRSGSRV----LALASKSLPNLSSKQLD--------DLDRDEI 313

Query: 556 E-GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIP----- 609
           E GLTF G +  + P +P     I+ L + +   IMITGD   TAV +A+++ I      
Sbjct: 314 ETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETL 373

Query: 610 VINPEYSVLSG-------------------DKLDQ-----------------MTDD--QL 631
           +++   +V  G                   DK D                  + +D  QL
Sbjct: 374 ILDKSETVGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQL 433

Query: 632 ASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSM 685
             +I H  V+AR +P  K  I+  L++ G    M GDG ND  ALK A +GV++
Sbjct: 434 KDLIRHTWVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAHVGVAL 487

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 163/697 (23%), Positives = 262/697 (37%), Gaps = 179/697 (25%)

Query: 153 SGQLSHVLASN-------LVPGDLVRFKVGDRIPADLRIVESIDLC----VDESNLTGEN 201
           + +L HV+  N       L  GDL++   GDRIPADL +++S +      +    L GE 
Sbjct: 252 NNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGET 311

Query: 202 E-------------------------------PVHKSSGAVDPKNYSHIPGSIIPVGDRN 230
           +                                +HK  G V  K+ +  P S+      N
Sbjct: 312 DWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSNPLSV-----DN 366

Query: 231 CIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTAMDKLGQDLSYMS 289
            +     L   G     V+ TG+ T       M +   K KT L +  ++ + + L    
Sbjct: 367 TLWANTVLASSGFCIACVVYTGRDTRQA----MNTTTAKVKTGLLELEINSISKILCACV 422

Query: 290 FVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI-- 347
           F                W       + L    IP  L + + +  ++   ++   K I  
Sbjct: 423 FALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPE 482

Query: 348 --VRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCL----------- 394
             VR     E LG +  + SDKTGTLT N M + KI  LG++   +  L           
Sbjct: 483 TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI-HLGTVSYTSETLDIVSDYVQSLV 541

Query: 395 ------------ALSKVKERPIKMEQDVATTLRIGNICNN--GTYSQEHLKY-LGNPTDI 439
                       ALS  ++      +D+  TL I   C+N   T+  + L Y   +P +I
Sbjct: 542 SSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAI---CHNVTPTFEDDELTYQAASPDEI 598

Query: 440 AILESLQHFGIN---DCRNSVNKINE-------------IPFNSKRKFMAVKTIDAN-DK 482
           AI++  +  G++     R+S++ ++E              PFNS  K M +   D   D+
Sbjct: 599 AIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDE 658

Query: 483 VVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAEL 539
                KGA     KIVE                 ND   + +    +A EGLRTL     
Sbjct: 659 YWFMQKGADTVMSKIVES----------------ND--WLEEETGNMAREGLRTLVIGRK 700

Query: 540 EVSAT---HGDKEFNED------------------MVEGLTFTGLIAMNDPPRPTVRSAI 578
           +++        KE+N+                   +   L   GL  + D  +  V+S+I
Sbjct: 701 KLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSI 760

Query: 579 EELLQGSVHVIMITGDAENTA--VSIARQIG---------IPVINPEYS----------- 616
           E L    + + M+TGD   TA  VSI+ ++            V  PE +           
Sbjct: 761 ELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINR 820

Query: 617 ----VLSGDKLD---QMTDDQLASVIDHVN--VFARATPEHKLNIVRALQK-RGDIVAMT 666
               ++ G+ L    +  + +   V+ H+   +  R TP+ K ++   ++K  G  V   
Sbjct: 821 NACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI 880

Query: 667 GDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 702
           GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 881 GDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSIT 916

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 103/434 (23%), Positives = 171/434 (39%), Gaps = 77/434 (17%)

Query: 304 GRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 363
           GR   ++    + +  + +P  LP+ +T+ +   +  ++K          +   G ++V 
Sbjct: 426 GRVQSKLILDCILIITSVVPSELPMELTMAVNNSLAVLSKFYVYCTEPFRIPLAGRIDVC 485

Query: 364 CSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKMEQDVATTLRIGNICNNG 423
           C DKTGTLT   +    +  L       N   L K  E P+       T L IG    + 
Sbjct: 486 CFDKTGTLTGEDLVFEGLAGLAGKNQPVN--HLFKGTEVPLD------TNLVIG--AAHA 535

Query: 424 TYSQEHLKYLGNPTDIAILESL-QHFGINDCRNSVNKINEIPFNSKRKFMAVKTIDANDK 482
               +  + +G+P + A L +     G+ D  ++  K+ +I     R+F     +  +  
Sbjct: 536 LVRLDDDEVVGDPMEKATLAATGWKVGVKDSLSN-EKVGDISI--LRRFQFSSALKRSST 592

Query: 483 VVVY-------VKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLA 535
           + V+       VKGA E I E+         +V+K             +ALAS+ L +++
Sbjct: 593 IAVHNKQHYSAVKGAPETIRERLSQVPTDYDQVYK----SFTRAGSRVLALASKKLPSMS 648

Query: 536 FAELEVSATHGDKEFNEDMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGD 594
             ++E        +   + VE  L F G +  + P +      I+ L + S   IMITGD
Sbjct: 649 IKQIE--------KLEREAVESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGD 700

Query: 595 AENTAVSIARQIGI----------PV-------------------INPEYSVLSGDKLDQ 625
              TAV +A+++ I          P+                    NPE       KL  
Sbjct: 701 NPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFRNIEETIVNPFNPEKDTFEHSKLFA 760

Query: 626 MTD--------------DQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVN 671
             D               QL  +I H  V+AR +P  K  I+ +L+  G    M GDG N
Sbjct: 761 KYDIAVTGHALQLLSGHSQLNELIRHTWVYARVSPAQKEFIMNSLKDMGYQTLMCGDGTN 820

Query: 672 DAPALKLADIGVSM 685
           D  ALK A +G+++
Sbjct: 821 DVGALKQAHVGIAL 834

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 156/679 (22%), Positives = 257/679 (37%), Gaps = 153/679 (22%)

Query: 154 GQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESID----------------------LC 191
           G+   V + +L  GDL++   G R+PADL +++S +                       C
Sbjct: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIAC 313

Query: 192 VDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFM--------GTLVREGH 243
               NL  ++     +  A  P+   H     +   D N  G            L   G 
Sbjct: 314 TLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGF 373

Query: 244 GKGIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTAMDKLGQDLSYMSFVXXXXXXXXXXX 302
             G VI TG+ T       M +   K KT L +  ++ + + L    F+           
Sbjct: 374 CIGCVIYTGRDTRQA----MNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGL 429

Query: 303 QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI----VRRLPSVETLG 358
               W       + L    IP  L + + +  ++   ++   K I    VR     E LG
Sbjct: 430 HNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLG 489

Query: 359 SVNVICSDKTGTLTANHMTVSKI-----------------WCLGSMENK----TNCLALS 397
            +  + SDKTGTLT N M + K+                 +  G +E+K    TN    S
Sbjct: 490 RIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRS 549

Query: 398 KVKERPIKMEQDVATTLRIGNICNN--GTYSQEHLKY-LGNPTDIAILESLQHFGIN--- 451
             ++       D+ TTL    IC+N   T+  + L Y   +P +IAI++  +  G++   
Sbjct: 550 TTRKDAATHVIDLITTLA---ICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFK 606

Query: 452 DCRNSVNKINE-------------IPFNSKRKFMAVKTIDAN-DKVVVYVKGAFEKIVEK 497
             R+S++ ++E              PFNS  K M +   D   D+     KGA       
Sbjct: 607 RDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGA------- 659

Query: 498 SINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAEL---------------EVS 542
                  D  ++++  N+  +  +    +A EGLRTL                    EVS
Sbjct: 660 -------DTVMNRIVANNDWLEEETG-NMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVS 711

Query: 543 ATHGDKE------FNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAE 596
           A+  ++E       ++ +   L   GL  + D  +  V+S+IE L    + + M+TGD  
Sbjct: 712 ASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 771

Query: 597 NTA--VSIA-----------------------RQIGIPVINPEYSVL-SGDKLD---QMT 627
            TA  VSI+                        Q+    +N    +L  G+ L    +  
Sbjct: 772 ETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYY 831

Query: 628 DDQLASVIDHVN--VFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVS 684
             +   V+ H+   +  R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV 
Sbjct: 832 RQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVG 891

Query: 685 M-GKMGTDVAKEASDMVLT 702
           + GK G   A  A+D  +T
Sbjct: 892 IVGKEGKQ-ASLAADFSIT 909

>Scas_704.38
          Length = 1161

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 165/700 (23%), Positives = 262/700 (37%), Gaps = 183/700 (26%)

Query: 153 SGQLSHVL-ASNLVP------GDLVRFKVGDRIPADLRIVESID----LCVDESNLTGEN 201
           + +L HVL  S LVP      GDL++   GDR+PADL +++S +      +    L GE 
Sbjct: 262 NSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGET 321

Query: 202 ---------------EP----------------VHKSSGAVDPKNYSHIPGSIIPVGDRN 230
                          EP                +H   G V  K+ S  P SI      N
Sbjct: 322 DWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSI-----DN 376

Query: 231 CIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTAMDKLGQDLSYMS 289
            +     L   G   G V+ TG+ T       M +     KT L +  ++ + + L    
Sbjct: 377 TLWANTVLASTGFCIGCVVYTGRDTRQA----MNTTTATVKTGLLELEINSISKILCASV 432

Query: 290 FVXXXXXXXXXXXQGRSW-LEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKR---- 344
           F                W L++ +  +  +       +P+ + V L L     A +    
Sbjct: 433 FALSIILVVFAGFHNSDWYLDVMRYLILFSTI-----IPVSLRVNLDLAKSVYAHQIEHD 487

Query: 345 ----KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCL------ 394
               + IVR     E LG +  + SDKTGTLT N M + KI  LG++   +  L      
Sbjct: 488 DTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIH-LGTVSYTSETLDIVSDY 546

Query: 395 ----------ALSKVKERPIKMEQDVATTLR----IGNICNN--GTYSQEHLKY-LGNPT 437
                     A    K  P    +D++  +R       IC+N   T+  + L Y   +P 
Sbjct: 547 VDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPD 606

Query: 438 DIAILESLQHFGINDCRNSVNKINEI----------------PFNSKRKFMAVKTIDAN- 480
           +IAI++  +  G++  +   + I+ +                PFNS  K M +   D   
Sbjct: 607 EIAIVKFTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQK 666

Query: 481 DKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLA-- 535
           D+     KGA     +IVE                 ND   + +    +A EGLRTL   
Sbjct: 667 DEYWFMQKGADTVMARIVEN----------------ND--WLEEETGNMAREGLRTLVVG 708

Query: 536 ---------------FAELEVSATHGDKEFNEDMVEGLTFT----GLIAMNDPPRPTVRS 576
                          + +  +S  + D++ N  + + L +     GL  + D  +  V+S
Sbjct: 709 RKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKS 768

Query: 577 AIEELLQGSVHVIMITGDAENTA--VSIARQ---------IGIPVINPEYS--------- 616
           +IE L    + + M+TGD   TA  VSI+ +         I   +  PE +         
Sbjct: 769 SIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKV 828

Query: 617 ------VLSGDKLDQMTDDQLASVIDHV-----NVFARATPEHKLNIVRALQK-RGDIVA 664
                 ++ G+ L            D V      V  R TP+ K ++   +++  G  V 
Sbjct: 829 NKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVC 888

Query: 665 MTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLTD 703
             GDG ND   ++ AD+GV + GK G   A  A+D  +T+
Sbjct: 889 CIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSITE 927

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 152/681 (22%), Positives = 254/681 (37%), Gaps = 169/681 (24%)

Query: 159 VLASNLVPGDLVRFKVGDRIPADLRIVESID----LCVDESNLTGENE------------ 202
           V + NL  GDLV+     RIPAD+ +++S +      V    L GE +            
Sbjct: 283 VPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQN 342

Query: 203 --------PVHKSSGAVDPKNYSHI-------PGSIIPVGDRNCIGFMGTLVREGHGKGI 247
                    VH ++ A  P+   H+        GS  P+   N +     L   G     
Sbjct: 343 LTQDEMLTKVHITASA--PEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVAC 400

Query: 248 VIATGKHTVFGSVFEMMSGIDKPKTPLQTAM-----DKLGQDLSYMSFVXXXXXXXXXXX 302
           VI TG  T           ++  K+ ++T +     + L + L    F            
Sbjct: 401 VIYTGTDT--------RQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGL 452

Query: 303 QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSV 354
               W     + +   +      +P+ + V L LG    A++          IVR     
Sbjct: 453 DDDKWY----VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIP 508

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKI------WCLGSMENKTNCL-------------- 394
           E LG +  + SDKTGTLT N M + KI      + + +M+  T+ +              
Sbjct: 509 EDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGV 568

Query: 395 ALSKVKERPIKMEQDVATTLRIGNICNNGT--YSQEHLKY-LGNPTDIAILESLQHFGIN 451
           A++  ++   +  +D+  TL     C+N T  +    L Y   +P +IAI++  +  G++
Sbjct: 569 AVTGSRKEVSQRVRDLVVTL---ATCHNVTPNFEDNELAYQAASPDEIAIVKFTERVGLS 625

Query: 452 ---DCRNSVNKINE-------------IPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIV 495
                R+S+   +E              PF S  K M +   D     + +++   + ++
Sbjct: 626 LFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVM 685

Query: 496 EKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSAT----------- 544
            K +            + ND   + +    +A EGLRTL  A  ++S             
Sbjct: 686 SKIV------------QSND--WLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKD 731

Query: 545 ------HGDKEFNE----DMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGD 594
                 + D+  NE     +   L   GL  + D  +  V+++IE L    V + M+TGD
Sbjct: 732 ASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGD 791

Query: 595 AENTA----VS---IARQIGIPVINP-----------EYSVLSGDKLDQMTDDQLASVID 636
              TA    VS   I+R   +  I             EY   + +    +  D LA  + 
Sbjct: 792 KVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMS 851

Query: 637 H-------------VNVFARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIG 682
           H             V +  R TP+ K ++   +++  G  V   GDG ND   ++ AD+G
Sbjct: 852 HYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVG 911

Query: 683 VSM-GKMGTDVAKEASDMVLT 702
           V + GK G   A  A+D  +T
Sbjct: 912 VGIVGKEGKQ-ASLAADYSIT 931

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 80/157 (50%), Gaps = 32/157 (20%)

Query: 555 VEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPE 614
           V G  F GL  +ND  +    + ++ L +      MITGD  + A  +AR++GI      
Sbjct: 751 VNGHVF-GLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI------ 803

Query: 615 YSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKR--GDIVAMTGDGVND 672
                                   NV++  +P  K ++V+ +Q +   + VA+ GDG+ND
Sbjct: 804 ---------------------SFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGIND 842

Query: 673 APALKLADIGVSMGKMGTDVAKEASDMV-LTDDDFST 708
           APAL L+D+G+++   GT++A EA+D+V L  +D +T
Sbjct: 843 APALALSDLGIAI-STGTEIAIEAADIVILCGNDLNT 878

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 100/268 (37%), Gaps = 41/268 (15%)

Query: 132 KSEKSLEALNKLVPAECHL---TRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESI 188
           ++  +L  L +L P+ C +       +   +    L   D+V  K G +IPAD  I+   
Sbjct: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454

Query: 189 DLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIV 248
           +  +DES +TGE+  V K +G               PV         G++   GH     
Sbjct: 455 ESEIDESLMTGESILVPKKTG--------------FPV-------IAGSVNGPGHFYFRT 493

Query: 249 IATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ-------DLSYMSFVXXXX------ 295
              G+ T   ++ ++M      K P+Q   D L          L+ ++F           
Sbjct: 494 TTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISA 553

Query: 296 ---XXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 352
                     +  ++    Q A S+ + A P  L +     + +G    A+   +++   
Sbjct: 554 NPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGE 613

Query: 353 SVETLGSVNVICSDKTGTLTANHMTVSK 380
            +E   S+     DKTGTLT   M V K
Sbjct: 614 VLEKFNSITTFVFDKTGTLTTGFMVVKK 641

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 108/242 (44%), Gaps = 47/242 (19%)

Query: 515  DKAIINDAAVALASEGLRTLAFAE-----LEVSATHGDKEFNEDMVEGLTFTGLIAMNDP 569
            ++ ++ D    L SE L+ LA  +     L V+A      F  D    +    + A  D 
Sbjct: 874  NERLLRDYKCHLTSEQLKLLAEWKARGKSLMVTAIKSRSYFGNDNFYPVM---MCAAKDE 930

Query: 570  PRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDD 629
             RP  +  I+EL +  +   MI+GD E TA ++A+++ I                     
Sbjct: 931  IRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQELDID-------------------- 970

Query: 630  QLASVIDHVNVFARATPEHKLNIVRALQKRG-------DIVAMTGDGVNDAPALKLADIG 682
                     NV A   PE K   V+ +Q           +VAM GDG+NDAPAL  AD+G
Sbjct: 971  ---------NVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVG 1021

Query: 683  VSMGKMGTDVAKEASDMVLTD--DDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSL 740
            +++   G+++A  + D VL    +   ++L  ++  K +FN I+   T+ L  ++ AL +
Sbjct: 1022 IALAS-GSELAMTSCDFVLLSPINTLVSLLALLKLSKTVFNRIKFNFTWALVYNMLALPI 1080

Query: 741  VA 742
             A
Sbjct: 1081 AA 1082

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 311 FQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG-SVNVICSDKTG 369
            + A+S+ V A P G+ +     L +G    AK   + R   +    G  + ++C DKTG
Sbjct: 713 LEFAISVFVIACPCGIGLAAPTALFVGSGMAAKFGILCRGGGAAFQEGCKIAIVCFDKTG 772

Query: 370 TLT-ANHMTVS 379
           TLT  N M V+
Sbjct: 773 TLTLGNEMKVT 783

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 148/673 (21%), Positives = 254/673 (37%), Gaps = 160/673 (23%)

Query: 161 ASNLVPGDLVRFKVGDRIPAD---------------------------LRIVESIDLCVD 193
           + +L  GD+++ K G R+PAD                           LR+  S+   + 
Sbjct: 270 SKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLT 329

Query: 194 ESNL--------TGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGK 245
           E++L        +     +H   G +  K+ +  P S+      N +     L       
Sbjct: 330 ENDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTV-----LASSAACI 384

Query: 246 GIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTAMDKLGQDLSYMSFVXXXXXXXXXXXQG 304
             ++ TG+ T       + +   K KT L +  ++ L + L    F+             
Sbjct: 385 CCIVYTGRETRQA----LNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNN 440

Query: 305 RSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK----AIVRRLPSVETLGSV 360
             W       + L    IP  L + + +  ++   ++   K     IVR     E LG +
Sbjct: 441 NDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRI 500

Query: 361 NVICSDKTGTLTANHMTVSKIWC----------------LGSMENKTNCLALSKVKERPI 404
             + SDKTGTLT N M + KI                  + SM ++T+    +  ++   
Sbjct: 501 EYLLSDKTGTLTQNDMQLKKIHLGTVSYTNETMDIVTDFIQSMNSRTSNSTPTTTRKNIS 560

Query: 405 KMEQDVATTLRIGNICNN--GTYSQEHLKY-LGNPTDIAILESLQHFGINDCRNSVNKIN 461
               D+ TTL    IC+N   T+    L Y   +P +IAI++  +  G++  R   + I+
Sbjct: 561 DRVIDLVTTLA---ICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSIS 617

Query: 462 ----------------EIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRD 505
                             PFNS  K M V   D   +   +++   + ++    + + R+
Sbjct: 618 LFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMS---SIVVRN 674

Query: 506 GKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSAT---HGDKEFNED--------- 553
             + +   N           +A+EGLRTL     ++S       +KE++E          
Sbjct: 675 DWLEEETSN-----------MATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREV 723

Query: 554 ---------MVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTA--VSI 602
                    +   L   GL  + D  +  V+S+IE L    + + M+TGD   TA  VSI
Sbjct: 724 HMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 783

Query: 603 ARQI--------GIPVIN-PEYS---------------VLSGDKLD---QMTDDQLASVI 635
           + ++         +  +N PE +               ++ G+ L    Q   D+   ++
Sbjct: 784 SAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIV 843

Query: 636 DHVN----VFARATPEHKLNI-VRALQKRGDIVAMTGDGVNDAPALKLADIGVSM-GKMG 689
             VN    V  R TP+ K ++ V   Q  G  V   GDG ND   ++ AD+GV + GK G
Sbjct: 844 --VNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEG 901

Query: 690 TDVAKEASDMVLT 702
              A  A+D  +T
Sbjct: 902 KQ-ASLAADFSIT 913

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 32/167 (19%)

Query: 562 GLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGD 621
           G   ++D  R      ++ LL    +V M+TGD    A+ ++  +GIP +N         
Sbjct: 581 GRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIP-LN--------- 630

Query: 622 KLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADI 681
                            NVF+   PE K +++R L+++ D VA  GDG+ND+ AL  +D+
Sbjct: 631 -----------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDL 673

Query: 682 GVSMGKMGTDVAKEASDMVLTDDD----FSTILTAIEEGKGIFNNIQ 724
           G+S+    +D+  +A+ +V+ D       + IL AI+  +  FN ++
Sbjct: 674 GISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 60/150 (40%), Gaps = 22/150 (14%)

Query: 132 KSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLC 191
           ++  SL  +    P+ C +  SG    V    L  GD+V  + G ++PAD  ++E  +  
Sbjct: 238 RAADSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTVLEG-EAE 296

Query: 192 VDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIAT 251
           VDES +TGE+  V K             PGS +  G  N  G  G L R           
Sbjct: 297 VDESLMTGESTLVPK------------YPGSRVLCGSVN--GAAGFLYRAD-------LV 335

Query: 252 GKHTVFGSVFEMMSGIDKPKTPLQTAMDKL 281
           G+ T    +   M      K P+Q   D L
Sbjct: 336 GEETRLAGIVAAMKQAQLAKAPIQRYADFL 365

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 163/710 (22%), Positives = 272/710 (38%), Gaps = 175/710 (24%)

Query: 136 SLEALNKLVPAECHLTRSGQLSHVL-ASNLVP------GDLVRFKVGDRIPADLRIVESI 188
           S EA++ +   +     + +L  VL  + LVP      GDL++   G RIPADL +++S 
Sbjct: 231 SKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSS 290

Query: 189 D----------------------LCVDESNLTGEN-------------EPVHKSSGAVDP 213
           +                       C    NL+ ++             + +H+  G +  
Sbjct: 291 EPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTY 350

Query: 214 KNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTP 273
           K+ S    S+      N +     L   G   G V+ TG  T       M + +   KT 
Sbjct: 351 KDSSSNALSV-----DNTMWANTVLASVGSCIGCVVYTGTDTRQA----MNTTMSSVKTG 401

Query: 274 L-QTAMDKLGQDLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTV 332
           L +  ++ L + L    FV             + W     + +   +      +P+ + V
Sbjct: 402 LLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWY----VDIMRYLILFSTIIPVSLRV 457

Query: 333 TLALGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKI--- 381
            L LG    A++          IVR     E LG +  + SDKTGTLT N M + K+   
Sbjct: 458 NLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG 517

Query: 382 ---WCLGSME------------NKTNCLALSKVKERPIKMEQDVATTLRIGNICNN--GT 424
              + + +M+            + T  +  S  K+      +D+  TL    IC+N   T
Sbjct: 518 TVSYTMDTMDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLA---ICHNVTPT 574

Query: 425 YSQEHLKY-LGNPTDIAILESLQHFGIN---DCRNSVNKINE-------------IPFNS 467
           +    L Y   +P +IAI++  +  G++     R+SV+  ++              PFNS
Sbjct: 575 FEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNS 634

Query: 468 KRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKL-KPNDKAIINDAAVAL 526
             K M +   D        VKG      E      G D  + ++ + ND   +++    +
Sbjct: 635 DTKRMGIIVYDK-------VKG------EHWFMQKGADTVMARIVQSND--WLDEEVGNM 679

Query: 527 ASEGLRTLAFAELEVSATHGD---KEFNE------------------DMVEGLTFTGLIA 565
           A EGLRTL     ++S    +   KE+++                   +   L   GL  
Sbjct: 680 AREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTG 739

Query: 566 MNDPPRPTVRSAIEELLQGSVHVIMITGDAENTA--VSIARQI---------GIPVINPE 614
           + D  +  V+S+IE L    V + M+TGD   TA  VSI+ ++            +  PE
Sbjct: 740 VEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPE 799

Query: 615 YS---------------VLSGDKLDQM----TDDQLASVIDHVNVFA-RATPEHKLNIVR 654
            +               ++ G+ L         +    V+D   V A R TP+ K ++  
Sbjct: 800 GALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVAL 859

Query: 655 ALQK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 702
            +++  G  V   GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 860 LIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSVT 908

>Kwal_55.21575
          Length = 989

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 119/295 (40%), Gaps = 47/295 (15%)

Query: 132 KSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLC 191
           K+  SL  L  L P+ C +  +G+   +    L  GD V  K G +IP D  I+E  +  
Sbjct: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEG-ESE 453

Query: 192 VDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIAT 251
           VDES +TGE+  V +  G      +  I GSI                  G  + ++ AT
Sbjct: 454 VDESLITGESLMVPRYKG------FPVIAGSI-----------------NGPNRFLLTAT 490

Query: 252 --GKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQD-------LSYMSFVXXXXXXXXXXX 302
             G  T    + + M      K P+Q   D L          L+ ++FV           
Sbjct: 491 SVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSN 550

Query: 303 --------QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSV 354
                    G+ ++   ++ +S+ V A P  L +     + +G    AK   +++    +
Sbjct: 551 PPSIFDSPNGKFFI-CLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDIL 609

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTN----CLALSK-VKERPI 404
           E   S+     DKTGTLT  HMTV +   +G  +N T     C+  S+ V E P+
Sbjct: 610 EKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPV 664

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 95/198 (47%), Gaps = 48/198 (24%)

Query: 505 DGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLI 564
           DGK + +   ++ ++ D  ++L+++   TLA+ ++           N ++V      G  
Sbjct: 703 DGKAYHVVIGNRNVMQD--MSLSADASSTLAYVKI-----------NGELV------GRF 743

Query: 565 AMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLD 624
            ++D  +      ++ L +    V M+TGD   +A+ +A ++GI                
Sbjct: 744 EISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGI---------------- 787

Query: 625 QMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDI-VAMTGDGVNDAPALKLADIGV 683
                      +  NV++  TP  K  +V+ LQ  G   VA  GDG+ND+PAL  +D+GV
Sbjct: 788 -----------EANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGV 836

Query: 684 SMGKMGTDVAKEASDMVL 701
           S+   GTD+A EA+D+++
Sbjct: 837 SI-STGTDIAMEAADVII 853

>Scas_615.9
          Length = 942

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 69/148 (46%), Gaps = 29/148 (19%)

Query: 559 TFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVL 618
           T  G   + D  +  V   I+ L      + M+TGD+   A+ +A+Q+GI          
Sbjct: 693 TLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAMKVAQQVGIAA-------- 744

Query: 619 SGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRG-DIVAMTGDGVNDAPALK 677
                               NV++  TP  K  IV +LQ      VA  GDG+ND+P L 
Sbjct: 745 -------------------NNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLV 785

Query: 678 LADIGVSMGKMGTDVAKEASDMVLTDDD 705
            +DIGV++   GTD+A EA+D+V+  +D
Sbjct: 786 TSDIGVAL-STGTDIAMEAADIVVLGND 812

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 112/269 (41%), Gaps = 42/269 (15%)

Query: 132 KSEKSLEALNKLVPAECHLTRSG---QLSHV-LASNLVP-GDLVRFKVGDRIPADLRIVE 186
           ++  SL  L +L P++C + +     Q SH+ + +NL+   D++  K G +IPAD  I++
Sbjct: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQ 401

Query: 187 SIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKG 246
             +  +DES +TGE+  VHK  G+            +I           G+L   GH   
Sbjct: 402 G-ESEIDESLMTGESILVHKQKGS-----------QVIA----------GSLNGPGHFYF 439

Query: 247 IVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ-------DLSYMSFVXXXXXXXX 299
             I  G  T    + + M      K P+Q   D L          LS ++F+        
Sbjct: 440 KAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITFITWITLSNL 499

Query: 300 XXX--------QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRL 351
                          +   FQIA+S+ V A P  L +     + +G    A+   +++  
Sbjct: 500 LTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGVLIKGG 559

Query: 352 PSVETLGSVNVICSDKTGTLTANHMTVSK 380
             +E   ++  I  DKTGT+T   MTV +
Sbjct: 560 DILERFNTITKIVFDKTGTITTGQMTVQR 588

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 92/210 (43%), Gaps = 38/210 (18%)

Query: 561  TGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSG 620
            T  +A+ D  RP  +  ++ L +  +   MI+GD    A ++A ++GI            
Sbjct: 1011 TLFLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGIK----------- 1059

Query: 621  DKLDQMTDDQLASVIDHVNVFARATPE---HKLNIVRALQKRGDIVAMTGDGVNDAPALK 677
                              +V A   PE    K+  +R    +G  +AM GDG+NDAPA+ 
Sbjct: 1060 ------------------HVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIA 1101

Query: 678  LADIGVSMGKMGTDVAKEASDMVL--TDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSV 735
             AD+G+S+   G+D+A  + D VL    +  + I+  ++  K +F  ++    + L   V
Sbjct: 1102 AADVGISLAS-GSDLAMISCDFVLLSKKNPLTGIVVLLQLSKKVFRRVKFNFVWAL---V 1157

Query: 736  AALSLVAISTSLKLPNPLNAMQILWINILM 765
              +  V I+  +  P     +  +W +I M
Sbjct: 1158 YNIICVPIAAGVLYPYKETRLSPVWASIAM 1187

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 86/225 (38%), Gaps = 23/225 (10%)

Query: 157 SHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNY 216
           + V A  L  GD +  K G     D  IV+  +   DES+LTGE+ P+            
Sbjct: 657 TSVSAEMLELGDHILIKPGASPAVDALIVQG-ETEFDESSLTGESRPI------------ 703

Query: 217 SHIPGSIIPVGDRNCIGFMGTLVREGHGKG------IVIATGKHTVFGSVFEMMSGIDKP 270
           +H PG  I  G  N +G    + +     G      ++ A     + G+  E ++ +   
Sbjct: 704 THFPGDQIFAGTVN-VGQCAVIAKVSTAPGNSLLDHVISAVRDGQLRGAPIERIADVLTG 762

Query: 271 K-TPLQTAMDKLGQDLSY-MSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPI 328
              P    +  L   +   + F             G       + A+++ V A P G+ +
Sbjct: 763 YFVPFIVLLAILTWAIWLILGFAGVLSQEKLDGSVGGWPFWSLEFAIAVFVIACPCGIGL 822

Query: 329 IVTVTLALGVLRMAKRKAIVRRLPSVETLGS-VNVICSDKTGTLT 372
                L +G    AK   + R   +   +GS V  +C DKTGTLT
Sbjct: 823 AAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLT 867

>Kwal_23.5789
          Length = 1133

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 165/709 (23%), Positives = 272/709 (38%), Gaps = 174/709 (24%)

Query: 136 SLEALNKLVPAECHLTRSGQLSHVLA-SNLVP------GDLVRFKVGDRIPADLRIVESI 188
           S EAL+ +         + +L  VL+ S LVP      GDL++   G R PADL +++S 
Sbjct: 221 SKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSS 280

Query: 189 D----LCVDESNLTGENE-------PV--HKS----------SGAVDPKNYSHIPGSII- 224
           +    + +    L GE +       P+  H S          + +V  K+ ++  G +  
Sbjct: 281 EPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTF 340

Query: 225 ------PVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTA 277
                 P+   N +         G     V+ TG  T       M + +   KT L +  
Sbjct: 341 GEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQA----MNTSMSSVKTGLLELE 396

Query: 278 MDKLGQDLSYMSFVXXXXXXXXXXXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALG 337
           ++ L + L    F+               W     + +   +      +P+ + V L LG
Sbjct: 397 INSLSKILCACVFILSVALVAFAGFNNNDWY----VDIMRYLILFSTIIPVSLRVNLDLG 452

Query: 338 VLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKI------WC 383
               A +        + IVR     E LG +  + SDKTGTLT N M + K+      + 
Sbjct: 453 KSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYT 512

Query: 384 LGSME-------------NKTNCLALSKVKERPIKMEQDVATTLRIGNICNN--GTYSQE 428
           + +M+             N +   + SK K+ P ++ +D+  TL    +C+    T+   
Sbjct: 513 MDTMDIVTDYVRAMSDNLNSSAVPSASK-KDLPGRV-RDLVLTLA---LCHQVTPTFEDG 567

Query: 429 HLKY-LGNPTDIAILESLQHFGINDCRNSVNKINEI----------------PFNSKRKF 471
            L Y   +P +IAI++  +  G+   R   + I  +                PFNS  K 
Sbjct: 568 ELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKR 627

Query: 472 MAVKTIDAN-DKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALA 527
           M +   D   D+     KGA     KIV+K                ND   + +    LA
Sbjct: 628 MGIVIFDKQKDEYWFLQKGADVVMSKIVQK----------------ND--WLEEETGNLA 669

Query: 528 SEGLRTLAFAELEVSAT-----HGDKE----------------FNEDMVEGLTFTGLIAM 566
            EGLRTL      +S         D E                 ++ +   L   GL  +
Sbjct: 670 REGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGV 729

Query: 567 NDPPRPTVRSAIEELLQGSVHVIMITGDAENTA--VSIARQI--------GIPVIN-PEY 615
            D  +  V+S+IE L    + + M+TGD   TA  VSI+ ++         +  +N PE 
Sbjct: 730 EDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEG 789

Query: 616 SVLSGDKLDQMTD-------DQLASVIDH---------VNVFA----RATPEHKLNIVRA 655
           ++   + L   T+       + L   +++         VN+ A    R TP+ K ++   
Sbjct: 790 ALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATF 849

Query: 656 LQK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 702
           +++  G  V   GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 850 IREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQ-ASLAADFSIT 897

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 28/143 (19%)

Query: 562 GLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGD 621
           G   + D  +   +  I  L   +  V M+TGD   +A+ +A  + IP   P        
Sbjct: 757 GRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------- 806

Query: 622 KLDQMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADI 681
                            NV++  TP+ K   V  L++ G ++A  GDG+ND+ AL  +D+
Sbjct: 807 -----------------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDL 849

Query: 682 GVSMGKMGTDVAKEASDMVLTDD 704
           G+++   GT+VA EA+ +V+ +D
Sbjct: 850 GIAISS-GTEVAIEAAGIVILND 871

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 106/274 (38%), Gaps = 52/274 (18%)

Query: 132 KSEKSLEALNKLVPAECHLTRSG--QLSHVLASNLVP-GDLVRFKVGDRIPADLRIVESI 188
           K+  +L  L  L P+ C +       ++  +   L+  GD+   K G +IP+D  + + I
Sbjct: 397 KTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGI 456

Query: 189 DLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGI- 247
              VDES +TGE   V K  G+V       + G  I                  +G G+ 
Sbjct: 457 SE-VDESLMTGETNLVVKEIGSV-------VTGGTI------------------NGSGLI 490

Query: 248 ---VIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQD-------LSYMSFVXXXXXX 297
              V + G  T   ++ ++M      K  +Q   D +          LS ++F+      
Sbjct: 491 YFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTSLT 550

Query: 298 XXX-----------XXQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 346
                           + R ++   QIA S+ + A P  L +     + +G    ++   
Sbjct: 551 RSEKIISKLSIFGETSESRFYM-CLQIATSVVIVACPCALGLATPTAIMVGTGVASENGV 609

Query: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHMTVSK 380
           +++    +E    VN    DKTGTLT  HMTV +
Sbjct: 610 LIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 92/203 (45%), Gaps = 37/203 (18%)

Query: 555  VEGLTFTGLIAMNDPPR-------PTVRSAIEE-------LLQGSVHVIM-----ITGDA 595
            VEG +++GL       R       P VR A+E+        + GSV  +      +  DA
Sbjct: 971  VEGTSYSGLKLQGGNCRWLGHNNDPDVRKALEQGYSVFCFSVNGSVTAVYALEDSLRADA 1030

Query: 596  ENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKLNIVRA 655
             +T +++ RQ GI +      +LSGD    +        I+  N+ + ATP  K   ++ 
Sbjct: 1031 VST-INLLRQRGISL-----HILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIKD 1084

Query: 656  L----------QKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDD 705
            +          Q +  +V   GDG NDA  L  A IGV + + G++VAK A+D+V+    
Sbjct: 1085 IVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINE-GSEVAKLAADVVMLKPK 1143

Query: 706  FSTILTAIE-EGKGIFNNIQNFL 727
             + ILT I    K +F    NFL
Sbjct: 1144 LNNILTMITVSQKAMFRVKLNFL 1166

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 123/301 (40%), Gaps = 51/301 (16%)

Query: 127 FVQE---YKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLR 183
           FV E   +++ KS+   +    +   + ++G+ + +    L  GD+ +     RIP D  
Sbjct: 674 FVSELARHRAVKSISVRSLQASSAILVDKTGKETEINIRLLQYGDIFKVLPDSRIPTDGT 733

Query: 184 IVESIDLCVDESNLTGENEPVHKS------SGAVDPKNYSHIPGSIIPVGDRNCIGFMGT 237
           ++      VDE+ +TGE+ PV K       +G+V+      +  S +P    N I  + T
Sbjct: 734 VISGSSE-VDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLP--GNNTISTIAT 790

Query: 238 LVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ-------DLSYMSF 290
           +V E                         + KPK  +Q   DK+          ++ ++F
Sbjct: 791 MVDEAK-----------------------LTKPK--IQNIADKIASYFVPTIIGITVVTF 825

Query: 291 VXXXXXXXXXXXQGRS--WLEMFQIAVSLAVAAIPE--GLPIIVTVTLALGVLRMAKRKA 346
                       Q RS   ++    A+++ + + P   GL + +   +A GV   AKR  
Sbjct: 826 CVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGV--AAKRGV 883

Query: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTN-CLALSKVKERPIK 405
           I +   S+E   + + +  DKTGTLT   +TV      G   N  +  L L++  + P+ 
Sbjct: 884 IFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVVHETVRGDRHNSQSLLLGLTEGIKHPVS 943

Query: 406 M 406
           M
Sbjct: 944 M 944

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 103/460 (22%), Positives = 176/460 (38%), Gaps = 119/460 (25%)

Query: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSM------ENKTNCL------ 394
           +VR    VE LG +  I SDKTGTLT N M    +   G        E++   +      
Sbjct: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEI 604

Query: 395 ---ALSKVKERPIKMEQDVA-------TTLRIGNICNNGTYSQEHLKY-LGNPTDIAILE 443
              +   +K++    E D A       T L   +     T S   +KY   +P + A+++
Sbjct: 605 GFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQ 664

Query: 444 SLQHFGIN-DCR--NSVN------------KINEIPFNSKRKFMAVKTIDANDKVVVYVK 488
                G   D R  NSV+             +N   FNS RK M+      +  + ++ K
Sbjct: 665 GAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCK 724

Query: 489 GAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDK 548
           GA   I+E+       D + +    +    + D     A+EGLRTL  A    S T  +K
Sbjct: 725 GADTVILER------LDSEFNPYVQSTLRHLED----YAAEGLRTLCIA----SRTIPEK 770

Query: 549 EFNE-----------------------DMVE-GLTFTGLIAMNDPPRPTVRSAIEELLQG 584
           E+ E                       +++E  L F G  A+ D  +  V   I  L + 
Sbjct: 771 EYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEGVPETIHHLQEA 830

Query: 585 SVHVIMITGDAENTAVSI-------ARQIGIPVINPE------------YSVLSGDKLDQ 625
            + V ++TGD + TA++I       +  + + ++N E             + +   ++ Q
Sbjct: 831 GLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQ 890

Query: 626 MTDDQLASVIDHVN-----------------------VFARATPEHKLNIVRALQKR-GD 661
              + LA VID  +                       +  R +P  K  +V+ ++++   
Sbjct: 891 QDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSS 950

Query: 662 IVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVL 701
           ++   GDG ND   ++ A +GV +  M    A  ++D  +
Sbjct: 951 LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAI 990

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 152 RSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESID---LC-VDESNLTGE 200
           RSG+       ++  GD++R +  + IPADL I+ S +   LC ++ +NL GE
Sbjct: 294 RSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIETANLDGE 346

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
           complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 108/476 (22%), Positives = 174/476 (36%), Gaps = 150/476 (31%)

Query: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIKM 406
           +VR    VE LG +  I SDKTGTLT N M        G       C   S  +++    
Sbjct: 537 VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAG------RCYIQSIPEDKDAAF 590

Query: 407 EQDVATTLR-------------------------IGNICN--------NGTYSQEHLKY- 432
           ++ +    R                         + +IC+        NG+     +KY 
Sbjct: 591 DEGIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGS-----IKYQ 645

Query: 433 LGNPTDIAILESLQHFG---INDCRNSVNKINE-------------IPFNSKRKFMAVKT 476
             +P + A+++     G   I    NSV  + E               FNS RK M+   
Sbjct: 646 AASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIF 705

Query: 477 IDANDKVVVYVKGA----FEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLR 532
              ++ + +  KGA     E++   S  Y+     +  L+              A+EGLR
Sbjct: 706 RFPDNSIRLLCKGADTVILERLAATSNPYVA--ATLRHLED------------YAAEGLR 751

Query: 533 TLAFAELEVSATHGDKEFNE-----------------------DMVE-GLTFTGLIAMND 568
           TL  A    S T  + E+ E                       +M+E GL   G  A+ D
Sbjct: 752 TLCIA----SRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIED 807

Query: 569 PPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI-------ARQIGIPVINPEYSVLSG- 620
             +  V   I  L Q  + V ++TGD + TA++I       +  + + ++N +    +  
Sbjct: 808 KLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRN 867

Query: 621 ---DKLDQMTDDQ--------LASVIDHVNV-FA----------------------RATP 646
              DKL  + D Q        LA VID  ++ FA                      R +P
Sbjct: 868 NLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSP 927

Query: 647 EHKLNIVRALQKR-GDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVL 701
             K  +V+ +++R   ++   GDG ND   ++ A +GV +  M    A  ++D  L
Sbjct: 928 LQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAL 983

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 10/106 (9%)

Query: 128 VQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVES 187
           V++ K   S + LN    A+ +    GQ       ++  GD++R +  + IPADL ++ S
Sbjct: 263 VEDLKRSNSDKELNH-SRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSS 321

Query: 188 ID---LC-VDESNLTGE-----NEPVHKSSGAVDPKNYSHIPGSII 224
            +   LC ++ +NL GE      +   ++S  +D +  S + G I+
Sbjct: 322 SEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKIL 367

>Kwal_26.7070
          Length = 1315

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 120/308 (38%), Gaps = 79/308 (25%)

Query: 460 INEIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAII 519
           +N   FNS RK M+      N ++ ++ KGA   I+E+             LK  +   I
Sbjct: 692 LNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILER-------------LKAGENPYI 738

Query: 520 NDAAVAL---ASEGLRTLAFAELEV---------------SATHGDK-----EFNEDMVE 556
                 L   A+EGLRTL  A   V               S T  D+     +  E + +
Sbjct: 739 EATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEK 798

Query: 557 GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI-------ARQIGIP 609
            L   G  A+ D  +  V   I  L    + V ++TGD + TAV+I       +  + + 
Sbjct: 799 DLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLL 858

Query: 610 VINPE------------YSVLSGDKLDQMTDDQLASVIDHVNV-FA-------------- 642
           +IN E               +S  ++ Q   + LA VID  ++ FA              
Sbjct: 859 IINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFALEADLEDYLLAIGK 918

Query: 643 --------RATPEHKLNIVRALQKRGD-IVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693
                   R +P  K  +V+ ++++ D ++   GDG ND   ++ A +GV +  M    A
Sbjct: 919 LCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 978

Query: 694 KEASDMVL 701
             ++D  +
Sbjct: 979 ARSADFAI 986

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 19/30 (63%)

Query: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHM 376
           +VR    VE LG +  I SDKTGTLT N M
Sbjct: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRNVM 569

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 119/305 (39%), Gaps = 82/305 (26%)

Query: 460 INEIPFNSKRKFMAVKTIDANDKVVVYVKGA----FEKIVEKSINYIGRDGKVHKLKPND 515
           +N   FNS RK M+      +D + +  KGA     E++ E    Y+  D     L+   
Sbjct: 674 LNICEFNSTRKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYV--DATTRHLED-- 729

Query: 516 KAIINDAAVALASEGLRTLAFAELEV--------------SATHGDKEFN------EDMV 555
                      A+EGLRTL  A  ++              +AT  D          E++ 
Sbjct: 730 ----------YATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIE 779

Query: 556 EGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI-------ARQIGI 608
            GLT  G  A+ D  +  V   I  L +  + + ++TGD + TA++I       +  + +
Sbjct: 780 SGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNL 839

Query: 609 PVINPE------------YSVLSGDKLDQMTDDQLASVID-HVNVFA------------- 642
            +I+ E             + L    L +   + LA VID H   FA             
Sbjct: 840 LIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIG 899

Query: 643 ---------RATPEHKLNIVRALQKRGD-IVAMTGDGVNDAPALKLADIGVSMGKM-GTD 691
                    R +P  K  +V+ ++++ + ++   GDG ND   ++ A +GV +  M G  
Sbjct: 900 KMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQ 959

Query: 692 VAKEA 696
            A+ A
Sbjct: 960 AARSA 964

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHM 376
           +V+    VE LG +  I SDKTGTLT N M
Sbjct: 524 VVKTSSLVEELGQIEYIFSDKTGTLTRNIM 553

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/336 (22%), Positives = 130/336 (38%), Gaps = 77/336 (22%)

Query: 499  INYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLAFA-----------------ELEV 541
            +NYIG D  +   +   +  + D   + ++EGLRTL FA                 E + 
Sbjct: 942  LNYIGSDALISNEEYVLEKTLEDIE-SFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKT 1000

Query: 542  SATHGDKEFNE---DMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENT 598
            S +   ++ +E    + + L   G  A+ D  +  V  AIE++ +  + + M+TGD   T
Sbjct: 1001 SLSERKQKIDEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRET 1060

Query: 599  AVSIARQIGI---------------------PVINPEYS---------VLSGDKLDQMTD 628
            A++I     +                       I+ E           V+ G  L    D
Sbjct: 1061 AINIGYSCKLIHDYSTVVILTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFED 1120

Query: 629  D--------QLASVIDHVNVFARATPEHKLNIVRALQK--RGDIVAMTGDGVNDAPALKL 678
            +        +L +  D V V  RA+P  K  +V  ++   +  +    GDG ND   ++ 
Sbjct: 1121 NPTLMSVFTELCTKTDSV-VCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQS 1179

Query: 679  ADIGVSM-GKMGTDVAKEAS----------DMVLTDDDFSTILTAIEEGKGIFNNIQNFL 727
            ADIGV + GK G   ++ A            ++L    ++ I TA    K I       L
Sbjct: 1180 ADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTA----KFILCTFYKEL 1235

Query: 728  TFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINI 763
            TF L+  +     +   TSL  P  L+    L+ ++
Sbjct: 1236 TFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSL 1271

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 112/287 (39%), Gaps = 73/287 (25%)

Query: 167 GDLVRFKVGDRIPADLRIVESI---------DLCVD-ESNLTGE------NEPVHKSSGA 210
           GD V  +  D +PAD+ I+ S           + +D E+NL G+      N+    +SG 
Sbjct: 269 GDFVLLQQDDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGL 328

Query: 211 V---------DPKN-YSHIPGSI-----------IPVGDRNCIGFMGTLVREGHG-KGIV 248
                     DP N   +  G++            P+G  N I + G+++R      G+V
Sbjct: 329 ANINAQVTVEDPNNDLYNFEGNLELNSGSSSKKKYPLGPDNVI-YRGSIIRNTRNCVGMV 387

Query: 249 IATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQD----------LSYMSFVXXXXXXX 298
           I TG+ +        M+ +  P+T       K+             +S  S++       
Sbjct: 388 IFTGEESKI-----RMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIK 442

Query: 299 XXXXQGRSWLEMFQ---IAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI-------- 347
                 ++W  + +    A ++    I     I +++ + + ++++A+ + +        
Sbjct: 443 RYVNNNKAWYLLQEDAGTAPTIMSFIIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYH 502

Query: 348 --------VRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGS 386
                   VR    +E LG V+ I SDKTGTLT N M   K+   G+
Sbjct: 503 AESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGT 549

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 104/259 (40%), Gaps = 67/259 (25%)

Query: 501  YIGRDGKVHKLKPNDKAIIN---DAAVALASEGLRTLAFA-----------------ELE 540
            YIG +    KL  N++ I+    +A    ++EGLRTL ++                 E +
Sbjct: 923  YIGDE----KLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAK 978

Query: 541  VSATHGDKEFNE---DMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAEN 597
             S T+   +  E    +   L   G  A+ D  +  V  AI+++ +  + + M+TGD   
Sbjct: 979  TSLTNRSTQIAEVGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRE 1038

Query: 598  TAVSIARQIGIPVINPEYSVLS-------------GDKLDQMTDDQLASVID-------- 636
            TA++I     +        +L              G++LD         VID        
Sbjct: 1039 TAINIGYACKLIYDYSTVVILKKNDDNLISKMTALGEELDTGKIAHCVLVIDGASLAVFE 1098

Query: 637  ----HVNVF------------ARATPEHKLNIVRALQ-KRGDIVAMT-GDGVNDAPALKL 678
                 ++VF             RA+P  K  IV  ++ K  D+V +  GDG ND   ++ 
Sbjct: 1099 NNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQS 1158

Query: 679  ADIGVSM-GKMGTDVAKEA 696
            ADIGV + GK G   ++ +
Sbjct: 1159 ADIGVGITGKEGLQASRSS 1177

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 112/287 (39%), Gaps = 70/287 (24%)

Query: 163 NLVPGDLVRFKVGDRIPADLRIV----ESIDLCVD------ESNLTGENE---------- 202
           +L  G+ V     D +PAD+ ++    E+ +  V+      E+NL  +N           
Sbjct: 276 DLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTS 335

Query: 203 ----PVHKSSGAV-DPKN--YS-----HIPGSIIPVGDRNCIGFMGTLVREGHG-KGIVI 249
                +H ++  + DP N  Y+      I G + P+G  N + + G+++R      GIVI
Sbjct: 336 ATGLSMHSATTTLEDPNNDLYNFEGTVEIDGELYPLGSDNVV-YRGSILRNTQSIVGIVI 394

Query: 250 ATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXXXXXXXXQ------ 303
            TG+ T        M+ I  P+T       K+   + +M FV           Q      
Sbjct: 395 FTGEETKI-----RMNAIKNPRTKAPKLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKN 449

Query: 304 ----GRSWLEMFQ----IAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI-------- 347
                R+W  +FQ     A ++    I     I +++ +   +++  + K +        
Sbjct: 450 YVDNNRAWY-LFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYH 508

Query: 348 --------VRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGS 386
                    R    +E LG V+ I SDKTGTLT N M   K    GS
Sbjct: 509 IESDTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGS 555

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 108/259 (41%), Gaps = 67/259 (25%)

Query: 499  INYIGRDGKVHKLKPNDKAIINDAAVAL---ASEGLRTLAFA-----------------E 538
            + +IG D    +L  N++ +I     A+   ++EGLRTL +A                 +
Sbjct: 1002 LEHIGSD----ELILNEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQ 1057

Query: 539  LEVSATHGDKEFNE---DMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDA 595
             + S T    + +E   ++ +GL   G+ A+ D  +  V  AIE++ +  + + M+TGD 
Sbjct: 1058 AKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDK 1117

Query: 596  ENTAVSIARQ---------IGIPVINPEYSVLSGDKLDQMTDD----QLASVID------ 636
              TA++I            + I     E  +   + + Q  D         VID      
Sbjct: 1118 RETAINIGYSCMLIKDYSTVVILTTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAM 1177

Query: 637  ------HVNVF------------ARATPEHKLNIVRALQKRG-DIVAMT-GDGVNDAPAL 676
                  +++VF             RA+P  K  +V  ++    ++V +  GDG ND   +
Sbjct: 1178 FEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMI 1237

Query: 677  KLADIGVSM-GKMGTDVAK 694
            + ADIGV + GK G   ++
Sbjct: 1238 QSADIGVGIAGKEGLQASR 1256

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 88/217 (40%), Gaps = 38/217 (17%)

Query: 201 NEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGK-GIVIATGKHTVFGS 259
           N  ++   G ++ KN+ +      P+G  N I + G+++R      G+VI +G+ T    
Sbjct: 377 NIDLYNFEGNLELKNHRNDTIMKYPLGPDNVI-YRGSILRNTQNVVGMVIFSGEETKI-- 433

Query: 260 VFEMMSGIDKPKTPLQTAMDKLGQDLSYMSFVXXXXX----------XXXXXXQGRSWLE 309
               M+ +  P+T       K+   + +M FV                     Q ++W  
Sbjct: 434 ---RMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWY- 489

Query: 310 MFQ----IAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI----------------VR 349
           +FQ    +A ++    I     I +++ + + ++++ + K +                 R
Sbjct: 490 LFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESR 549

Query: 350 RLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGS 386
               +E LG V+ I SDKTGTLT N M   K    GS
Sbjct: 550 TATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGS 586

>Scas_89.1
          Length = 271

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 95/231 (41%), Gaps = 38/231 (16%)

Query: 558 LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTA--VSIARQI---GIPV-- 610
           L   GL  + D  +  V+S+IE L    V + M+TGD   TA  VSI+ ++   G  V  
Sbjct: 35  LELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHT 94

Query: 611 ------------------INPEYSVL-SGDKLDQM----TDDQLASVIDHVNVFA-RATP 646
                             IN    +L  G+ L         +    V+D   V A R TP
Sbjct: 95  VTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTP 154

Query: 647 EHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLTDD 704
           + K ++   +++  G  V   GDG ND   ++ AD+GV + GK G   A  A+D  +T  
Sbjct: 155 QQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSVTQF 213

Query: 705 DFSTILTAIEEGKGIFNNIQNFLTFQLSTSV---AALSLVAISTSLKLPNP 752
              T L  +  G+  +        F +   +      ++ ++ + L L NP
Sbjct: 214 CHLTKLL-LWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKLSLSNP 263

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 92/199 (46%), Gaps = 49/199 (24%)

Query: 460  INEIPFNSKRKFMA----VKTIDAND--KVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513
            +N + FNS RK M+    + + + N+  + ++  KGA + I+   ++           K 
Sbjct: 882  LNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGA-DSIIYSRLS-----------KN 929

Query: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEVSATHGDKEFNE------------------ 552
            ND+ ++   A+ L   A+EGLRTL  A+ E+S     +E+NE                  
Sbjct: 930  NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEY-QEWNEKHEIAAAALVDREDEMEK 988

Query: 553  --DMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIP 609
              D++E  LT  G  A+ D  +  V  +I  L +  + + ++TGD   TA++I       
Sbjct: 989  VADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG--FSCN 1046

Query: 610  VINPEYSVL----SGDKLD 624
            ++N E  +L    SGD +D
Sbjct: 1047 LLNNEMELLVIKASGDDVD 1065

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 700
             R +P  K  +V+ ++   D++ +  GDG ND   ++ ADIGV +        +E    V
Sbjct: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA------GEEGRQAV 1198

Query: 701  LTDD 704
            ++ D
Sbjct: 1199 MSSD 1202

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERP-IKMEQDVA 411
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R  I +E++ A
Sbjct: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGA 758

>Scas_669.3
          Length = 1638

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 28/133 (21%)

Query: 495  VEKS-INYIGRDGKVHKLKPNDKAIINDAAVAL---ASEGLRTLAFA----ELEVSATHG 546
            VEK  + YIG D     L  ND  +I     A+   ++EGLRTL ++    +L+      
Sbjct: 971  VEKGMLEYIGSDD----LLLNDGYVIEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWE 1026

Query: 547  DK----------------EFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIM 590
            D+                E  E++ + L   G  A+ D  +  V  AIE++ +  + + M
Sbjct: 1027 DRYHDAKISLTNRKSKIAEVGEEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWM 1086

Query: 591  ITGDAENTAVSIA 603
            +TGD   TA++I 
Sbjct: 1087 LTGDKRETAINIG 1099

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 72/192 (37%), Gaps = 36/192 (18%)

Query: 225 PVGDRNCIGFMGTLVREGHGK-GIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQ 283
           PVG  N + + G+++R      G+VI TGK T        M+ ++ P+T        +  
Sbjct: 387 PVGPDN-VAYRGSIIRNTDNVIGMVIYTGKETKI-----RMNALNNPRTKAPKLQKNINI 440

Query: 284 DLSYMSFVXXX----------XXXXXXXXQGRSWLEMFQIA---------VSLAVAAIPE 324
            +++M FV                     + ++W  + + A         + +    IP 
Sbjct: 441 IITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFIIMYNTIIPL 500

Query: 325 GLPIIVTVTLALGVLRM----------AKRKAIVRRLPSVETLGSVNVICSDKTGTLTAN 374
            L + + +  A+    M                 R    +E LG V+ + SDKTGTLT N
Sbjct: 501 SLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTLTDN 560

Query: 375 HMTVSKIWCLGS 386
            M   K    GS
Sbjct: 561 KMIFRKFSICGS 572

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 460 INEIPFNSKRKFMAV--KTIDANDKVVVYVKGAFEKIVEK 497
           +N I FNS+RK M+V  KT D  +KV++  KGA   I+E+
Sbjct: 779 LNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMILER 818

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 122/307 (39%), Gaps = 77/307 (25%)

Query: 460 INEIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAII 519
           +N   FNS RK M+      +  + ++ KGA   I+E+       D + ++        +
Sbjct: 693 LNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILER------LDDEANQYVEATMRHL 746

Query: 520 NDAAVALASEGLRTLAFAELEVSATHGDKE-----FNE----------------DMVE-G 557
            D     ASEGLRTL  A  ++S   G+ E     +NE                +++E  
Sbjct: 747 ED----YASEGLRTLCLAMRDIS--EGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKN 800

Query: 558 LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI-------ARQIGIPV 610
           L   G  A+ D  +  V   I  L +  + + ++TGD + TA++I       +  + + +
Sbjct: 801 LILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLI 860

Query: 611 INPE------------YSVLSGDKLDQMTDDQLASVIDHVNV-FA--------------- 642
           IN E             + L+  +L       LA VID  ++ FA               
Sbjct: 861 INEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKL 920

Query: 643 -------RATPEHKLNIVRALQKR-GDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAK 694
                  R +P  K  +V+ ++++   ++     G ND   ++ A +GV +  M    A 
Sbjct: 921 CKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAA 980

Query: 695 EASDMVL 701
            ++D+ L
Sbjct: 981 RSADIAL 987

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 19/30 (63%)

Query: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHM 376
           +VR    VE LG +  I SDKTGTLT N M
Sbjct: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIM 570

>Scas_636.16
          Length = 1554

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 97/439 (22%), Positives = 162/439 (36%), Gaps = 132/439 (30%)

Query: 311  FQIAVSLAVAAIPEGLPIIVTVT-------LALGVLRMAKR---KAIVRRLPSVETLGSV 360
            F +AV L  + +P  L I V +        + L VL   +R       +     + LG +
Sbjct: 581  FWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQI 640

Query: 361  NVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVK-------ERPIKMEQDVATT 413
              I SDKTGTLT N M   K    G    +    AL+ ++       E+  ++E++    
Sbjct: 641  EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQ 700

Query: 414  LR------IGNICNNGTYSQEHLKY---------LGN----------------------- 435
             R      +  I NN  +  E L +         LGN                       
Sbjct: 701  DREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVL 760

Query: 436  -----------------PTDIAILESLQHFG--------------INDCRNSVNKINEIP 464
                             P + A++ + +  G              +   +     +N + 
Sbjct: 761  VEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILE 820

Query: 465  FNSKRKFMA--VKTIDANDK----VVVYVKGAFEKIVEKSINYIGRDGKVHKLKP--NDK 516
            FNS RK M+  VK   A +K     ++  KGA   I  +    + R       KP  ND+
Sbjct: 821  FNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSR----LSR-------KPGYNDE 869

Query: 517  AIINDAAVAL---ASEGLRTLAFAELEVSATHGDKEFNE--------------------D 553
             ++   A+ L   A+EGLRTL   + E+S +   +E+NE                    D
Sbjct: 870  TLLEKTALHLEQYATEGLRTLCVGQREISWSEY-QEWNEKYNIAAASLAGREEELDHVAD 928

Query: 554  MVE-GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVIN 612
            ++E  L   G  A+ D  +  V  +I  L +  + + ++TGD   TA++I     +   +
Sbjct: 929  LIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTD 988

Query: 613  PEYSVL--SGDKLDQMTDD 629
             E  V+  +G+ + +  DD
Sbjct: 989  MELLVIKTTGEDVKEFGDD 1007

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 700
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+GV +       A   SD  
Sbjct: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1141

Query: 701  LTDDDFSTILTAIEEGKGIFNNI 723
            +    + T L  +  GK  +  +
Sbjct: 1142 IGQFRYVTRLVLV-HGKWCYKRL 1163

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 94/217 (43%), Gaps = 46/217 (21%)

Query: 460  INEIPFNSKRKFMAV------KTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513
            +N + FNS RK M+        T     K ++  KGA       S+ Y   D        
Sbjct: 882  LNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGA------DSVIYSRLD-----RTQ 930

Query: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEV-----------------SATHGDKEFNE- 552
            ND  ++   A+ L   A+EGLRTL  A+ E+                 S T+ ++E ++ 
Sbjct: 931  NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKV 990

Query: 553  -DMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPV 610
             D++E  L   G  A+ D  +  V  +I  L +  + + ++TGD   TA++I       V
Sbjct: 991  TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIG--FSCNV 1048

Query: 611  INPEYSVL----SGDKLDQMTDDQLASVIDHVNVFAR 643
            +N +  +L    SG+ +++   D +  V + V  + R
Sbjct: 1049 LNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 3/101 (2%)

Query: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 700
             R +P  K  +V+ ++K  D++ +  GDG ND   ++ AD+GV +       A   SD  
Sbjct: 1146 CRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1205

Query: 701  LTDDDFSTILTAIEEGKGIFNNIQNFL-TFQLSTSVAALSL 740
            +    + T L  +  GK  +  +   +  F     +  LSL
Sbjct: 1206 IGQFRYVTRLVLV-HGKWCYKRLAEMIPQFFYKNVIFTLSL 1245

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 701 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 748

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 76/174 (43%), Gaps = 40/174 (22%)

Query: 460  INEIPFNSKRKFMA----VKTIDAND--KVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513
            +N + FNS RK M+    +  ++  D  + ++  KGA   I  +     G          
Sbjct: 837  LNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSG---------S 887

Query: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEVSATHGDKEFNE------------------ 552
            N +AI+   A+ L   A+EGLRTL  A+ E+S +  +K +NE                  
Sbjct: 888  NSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEK-WNEKYDIAAASLANREDELEV 946

Query: 553  --DMVEG-LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIA 603
              D +E  L   G  A+ D  +  V   IE L +  + + ++TGD   TA++I 
Sbjct: 947  VADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIG 1000

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402
           + LG V  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 656 DDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 703

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMG 686
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+G+ + 
Sbjct: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148

>Scas_576.8
          Length = 1591

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 91/203 (44%), Gaps = 44/203 (21%)

Query: 460  INEIPFNSKRKFMA--VKTIDAND----KVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513
            +N + FNS RK M+  VK   AN     + ++  KGA       SI Y  R G   K   
Sbjct: 853  LNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGA------DSIIY-SRLGT--KNGA 903

Query: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEVS---ATHGDKEFN---------EDMVEG- 557
            N + ++   A+ L   A+EGLRTL  A+ E+S       +K ++         E+ +E  
Sbjct: 904  NSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAV 963

Query: 558  -------LTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPV 610
                   LT  G  A+ D  +  V  +I  L Q  + + ++TGD   TA++I       +
Sbjct: 964  SDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIG--FSCNL 1021

Query: 611  INPEYSVL----SGDKLDQMTDD 629
            +N +  +L    +GD + +  +D
Sbjct: 1022 LNNDMELLVVKTNGDDVQEFGND 1044

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMG 686
             R +P  K  +V+ +    D++ +  GDG ND   ++ AD+GV + 
Sbjct: 1119 CRVSPAQKAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIA 1164

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402
           + +G +  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 672 DDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALAGLRKR 719

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 89/237 (37%), Gaps = 70/237 (29%)

Query: 525  ALASEGLRTLAFAELEVSATHGDKEFN------------------------EDMVEGLTF 560
            A  +EGLRTL ++   +    G++E+                         E +   LT 
Sbjct: 947  AFTTEGLRTLLYSFKWI----GNQEYETWNSRYSAAKAALVNRREQMDTVGEIIERDLTL 1002

Query: 561  TGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQI-------------- 606
             G I + D  +  V  AI++L +  + + M+TGD   TA++I                  
Sbjct: 1003 LGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHDYSTVIILAP 1062

Query: 607  -------GIPVINPEYS---------VLSGDKLDQMTDD--------QLASVIDHVNVFA 642
                    I  I  E           V+ G  L     +        +L +  D V +  
Sbjct: 1063 NDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSV-ICC 1121

Query: 643  RATPEHKLNIVRALQK--RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEA 696
            R++P  K  +V  ++K  +  +    GDG ND   ++ ADIGV + GK G   ++ +
Sbjct: 1122 RSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSS 1178

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 23/129 (17%)

Query: 354 VETLGSVNVICSDKTGTLTANHMTVSKIWCLGSM--------ENKTNCLALSKVKERPIK 405
           +E LG V+ I SDKTGTLT N M   K    G+         + +T C    K  E  I 
Sbjct: 495 LEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGTAWEHDVARKDQETGCSQTKKDVE-VIS 553

Query: 406 MEQDVATTLRIGNICNNGTYSQEHLK--------YLGNPTDIAILE--SLQHFGINDCRN 455
           +E +      I N   N T ++  ++        Y G P+  + +E   LQ    N  ++
Sbjct: 554 VESNSF----IKNFELNSTDTRTSVEYKGLASATYTGRPSIASQIELMKLQQNSANTNKS 609

Query: 456 SVNKINEIP 464
           S  KI+ +P
Sbjct: 610 SSPKISRLP 618

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 78/173 (45%), Gaps = 39/173 (22%)

Query: 460  INEIPFNSKRKFMA----VKTIDANDK--VVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513
            +N + FNS RK M+    +   DAN K   ++  KGA       S+ Y     ++ K   
Sbjct: 844  LNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGA------DSVIY----SRLDKTGL 893

Query: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEVSATHGDK--------------------EF 550
            N+++++   A+ L   A+EGLRTL  A+ E+S    ++                    + 
Sbjct: 894  NEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKV 953

Query: 551  NEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIA 603
            ++++   L   G  A+ D  +  V  +I  L +  + + ++TGD   TA++I 
Sbjct: 954  SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIG 1006

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 710

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
           Saccharomyces cerevisiae YER166w or sp|Q12675
           Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 73/174 (41%), Gaps = 40/174 (22%)

Query: 460 INEIPFNSKRKFMAV------KTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513
           +N + FNS RK M+        T +   + ++  KGA   I  +     G          
Sbjct: 833 LNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGE--------- 883

Query: 514 NDKAIINDAAVAL---ASEGLRTLAFAELEVSATHGDKEFN-------------EDMVE- 556
           ND+ ++   A+ L   A+EGLRTL  A+ E++ +    E+N             E+ +E 
Sbjct: 884 NDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEY-TEWNARYDIAAASLTNREEQLEI 942

Query: 557 -------GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIA 603
                   L   G  A+ D  +  V  +I  L +  + + ++TGD   TA++I 
Sbjct: 943 VSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIG 996

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 652 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 699

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMG 686
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+G+ + 
Sbjct: 1099 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIA 1144

>Kwal_23.3556
          Length = 1597

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 74/186 (39%), Gaps = 43/186 (23%)

Query: 553  DMVE-GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGI--- 608
            ++VE  L   G  A+ D  +  V  AI+++ +  + + M+TGD   TA++I     +   
Sbjct: 1013 ELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHD 1072

Query: 609  ------------------PVINPEYS---------VLSGDKLDQMTDD--------QLAS 633
                                ++ E           V+ G  L     +        +L +
Sbjct: 1073 YSTVVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFVELCT 1132

Query: 634  VIDHVNVFARATPEHKLNIVRALQK--RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGT 690
              D V +  RA+P  K  +V  ++   +  +    GDG ND   ++ ADIGV + GK G 
Sbjct: 1133 KTDSV-ICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGKEGL 1191

Query: 691  DVAKEA 696
              ++ +
Sbjct: 1192 QASRSS 1197

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 354 VETLGSVNVICSDKTGTLTANHMTVSKIWCLGS 386
           +E LG V+ I SDKTGTLT N M    +   GS
Sbjct: 518 LEELGQVSYIFSDKTGTLTDNKMVFRALSVCGS 550

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMG 686
             R +P  K  +V+ +++  D+V +  GDG ND   ++ AD+G+ + 
Sbjct: 1108 CRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIA 1153

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 72/173 (41%), Gaps = 40/173 (23%)

Query: 460  INEIPFNSKRKFMA----VKTIDANDK--VVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513
            +N + FNS RK M+    +   D N K   ++  KGA       S+ Y   D        
Sbjct: 844  LNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGA------DSVIYSRLD-----RSR 892

Query: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEV---------------SATHGDKEFNEDMV 555
            ND  ++   A+ L   A+EGLRTL  A+ E+               +A+  ++E   + V
Sbjct: 893  NDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERV 952

Query: 556  -----EGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIA 603
                   L   G  A+ D  +  V  +I  L    + + ++TGD   TA++I 
Sbjct: 953  ADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIG 1005

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 710

>YDL150W (RPC53) [718] chr4 (183344..184612) RNA polymerase III,
           fourth-largest essential subunit (C53) [1269 bp, 422 aa]
          Length = 422

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 677 KLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVA 736
           KLAD+G+       D  + A+++ L + D   IL  +   K + N  + F+ FQL T + 
Sbjct: 258 KLADLGLEKEFQSVDGKEAAAELELLNADHQHILRKL---KKMNNKPERFMVFQLPTRLP 314

Query: 737 ALSLVAI 743
           A    A+
Sbjct: 315 AFERPAV 321

>YLR347C (KAP95) [3730] chr12 complement(823827..826412)
           Karyopherin-beta, targets proteins with nuclear
           localization (NLS) sequences to the nuclear pore complex
           [2586 bp, 861 aa]
          Length = 861

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 807 ACFIIVGTIYVFVKEMAEDGQVTSRDTT 834
           A F  VGTI+ F+ ++AED Q+ S D T
Sbjct: 771 ALFPYVGTIFQFIAQVAEDPQLYSEDAT 798

>Scas_227.0d
          Length = 307

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 358 GSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKV 399
           GS   +C DKTGTLT N M+V + +   S  N ++   L+ V
Sbjct: 3   GSATAVCFDKTGTLTENVMSVVRGFVGDSYFNDSDNALLTSV 44

>Scas_505.4
          Length = 1025

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 640 VFARATPEHKLNIVRALQKR-GDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASD 698
           V  R +P  K  +V+ ++++   ++   GDG ND   ++ A +GV +  M    A  ++D
Sbjct: 590 VCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD 649

Query: 699 MVL 701
           + +
Sbjct: 650 IAV 652

>Kwal_47.19321
          Length = 486

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 338 VLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMT--VSKIWCL-GSMENKTNCL 394
           V+ M +++ + R +P       V  + +D  GTL A+  T   +K+ C+ G+  N     
Sbjct: 187 VVPMLQKQLVKRNIPI-----DVVALINDTVGTLVASMYTDAETKMGCIFGTGVNGAYYD 241

Query: 395 ALSKVKERPIKMEQDVATTLRIGNICNNGTYSQEHL 430
            +S V++   ++ +D+   + +   C  G++  EHL
Sbjct: 242 VVSGVEKLEGRLPEDITNDMPMAINCEYGSFDNEHL 277

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,558,176
Number of extensions: 1142113
Number of successful extensions: 3368
Number of sequences better than 10.0: 89
Number of HSP's gapped: 3286
Number of HSP's successfully gapped: 192
Length of query: 924
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 813
Effective length of database: 12,753,511
Effective search space: 10368604443
Effective search space used: 10368604443
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)