Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03135g40439820980.0
Kwal_14.150440139813480.0
AEL300C41840512691e-174
YGL169W (SUA5)42640412611e-173
CAGL0I04290g42240412281e-168
Scas_707.4944139811871e-161
CAGL0L02035g65860654.5
Kwal_26.932233188645.5
YPR127W34592645.7
KLLA0F06072g223195646.6
Sklu_2439.427165638.0
YKL075C45037638.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03135g
         (398 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03135g 279951..281165 similar to sp|P32579 Saccharomyces c...   812   0.0  
Kwal_14.1504                                                          523   0.0  
AEL300C [2205] [Homologous to ScYGL169W (SUA5) - SH] (78172..794...   493   e-174
YGL169W (SUA5) [1821] chr7 (186063..187343) Protein involved in ...   490   e-173
CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces c...   477   e-168
Scas_707.49                                                           461   e-161
CAGL0L02035g complement(238416..240392) highly similar to sp|P36...    30   4.5  
Kwal_26.9322                                                           29   5.5  
YPR127W (YPR127W) [5546] chr16 (790077..791114) Protein with sim...    29   5.7  
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...    29   6.6  
Sklu_2439.4 YHR005C, Contig c2439 3407-4217                            29   8.0  
YKL075C (YKL075C) [3185] chr11 complement(292601..293953) Protei...    29   8.2  

>KLLA0A03135g 279951..281165 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein
           singleton, start by similarity
          Length = 404

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/398 (100%), Positives = 398/398 (100%)

Query: 1   MLRSVMKLTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAF 60
           MLRSVMKLTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAF
Sbjct: 1   MLRSVMKLTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAF 60

Query: 61  PTETVYGLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSH 120
           PTETVYGLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSH
Sbjct: 61  PTETVYGLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSH 120

Query: 121 VPEIYHPLVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALS 180
           VPEIYHPLVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALS
Sbjct: 121 VPEIYHPLVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALS 180

Query: 181 DTPIAAPSANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLR 240
           DTPIAAPSANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLR
Sbjct: 181 DTPIAAPSANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLR 240

Query: 241 PGGFTYENILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVPEGDSQ 300
           PGGFTYENILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVPEGDSQ
Sbjct: 241 PGGFTYENILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVPEGDSQ 300

Query: 301 IISSERLGRLKSLVDKEIIQQGAKKVAFLNSLHLNKHFIDGKCIHESLGTTGKEIQANLF 360
           IISSERLGRLKSLVDKEIIQQGAKKVAFLNSLHLNKHFIDGKCIHESLGTTGKEIQANLF
Sbjct: 301 IISSERLGRLKSLVDKEIIQQGAKKVAFLNSLHLNKHFIDGKCIHESLGTTGKEIQANLF 360

Query: 361 ALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAAS 398
           ALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAAS
Sbjct: 361 ALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAAS 398

>Kwal_14.1504
          Length = 401

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/398 (66%), Positives = 314/398 (78%), Gaps = 8/398 (2%)

Query: 2   LRSVMKLTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAFP 61
           L S M   TRILKVDP +I FSDSAHIDGSLPT T AETE+NLLEAA IIRDT  TV FP
Sbjct: 5   LISKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNTVGFP 64

Query: 62  TETVYGLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSHV 121
           TETVYGLGGS+LND SV NIYKAKNRPSDNPLI+H+SS+ QLNR I+   S     L ++
Sbjct: 65  TETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQ-SHATSILHNI 123

Query: 122 PEIYHPLVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALSD 181
           PEIY PL+EKLWPGPLTILLS+P    ++TLSKLTTA+QPTFA RIP+NP+ARALIALSD
Sbjct: 124 PEIYRPLIEKLWPGPLTILLSVPP---KSTLSKLTTADQPTFAVRIPSNPVARALIALSD 180

Query: 182 TPIAAPSANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLRP 241
           TPIAAPSAN STRPSPT A HVFHDL GRIPLILDGG C+VGVESTVVDGLV+PP+LLRP
Sbjct: 181 TPIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRP 240

Query: 242 GGFTYENILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVPEGDSQI 301
           GGFT+E + ++GGP W  C VE K  +   EKV+TPGMKYRHYSP+AKV L VP+ ++++
Sbjct: 241 GGFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQ-ENEL 299

Query: 302 ISSERLGRLKSLVDKEIIQQGAKKVAFLNSLHLNKH-FIDGKCIHESLGTTGKEIQANLF 360
              +RL  +  ++ +    +  K+ A L++L   +   +D + I++SLG T  EIQANLF
Sbjct: 300 AIEQRLETVSRIIKES--TKDIKRFAVLSTLTFPQDLLVDSRGIYKSLGHTNIEIQANLF 357

Query: 361 ALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAAS 398
           ALLR+VDE+DNVD+I VEG +   EGLA+MNRLRKAAS
Sbjct: 358 ALLREVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAAS 395

>AEL300C [2205] [Homologous to ScYGL169W (SUA5) - SH] (78172..79428)
           [1257 bp, 418 aa]
          Length = 418

 Score =  493 bits (1269), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 247/405 (60%), Positives = 300/405 (74%), Gaps = 15/405 (3%)

Query: 2   LRSVMKLTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAFP 61
             S M   T++L+VDP+AIHFS +AHIDGSLP  +  ETEK+LLEAA +IRD  ETVAFP
Sbjct: 13  FHSAMSYNTKVLRVDPSAIHFSATAHIDGSLPRISDPETEKHLLEAARLIRDDGETVAFP 72

Query: 62  TETVYGLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYS-DISDDCKPLSH 120
           TETVYGLGGS+LND SV+NIYKAKNRPSDNPLI+H+SS++QLNR IY  D   D   L +
Sbjct: 73  TETVYGLGGSSLNDASVRNIYKAKNRPSDNPLISHVSSIAQLNRRIYQQDREGDV--LRN 130

Query: 121 VPEIYHPLVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALS 180
           +P +YH LV +LWPGPLTILL I   +    LS LTTA QPTFA RIPA+P+ARALIALS
Sbjct: 131 IPVVYHELVRQLWPGPLTILLPI---NEETALSVLTTAGQPTFAVRIPADPVARALIALS 187

Query: 181 DTPIAAPSANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLR 240
           DTPIAAPSAN STRPSPT AEHV+HDL G+IPLILDGG C VGVESTV+DGLV PPMLLR
Sbjct: 188 DTPIAAPSANVSTRPSPTAAEHVYHDLKGKIPLILDGGSCRVGVESTVIDGLVNPPMLLR 247

Query: 241 PGGFTYENILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVPEGDSQ 300
           PGGFTYE I+ +GG  W  C VE ++ +   EKV+TPGMKY+HYSP+A  +   P  D  
Sbjct: 248 PGGFTYEEIIELGGEQWSHCKVENRMTVGSGEKVRTPGMKYKHYSPRASTVAFAPIND-D 306

Query: 301 IISSERLGRLKSLVDKEIIQQGA---KKVAFLNSLHLNKHFIDG-----KCIHESLGTTG 352
           + +SER+  + S + K +   G    +KV  L S+    + ++        +  SLG++G
Sbjct: 307 LPTSERMKIVTSEIMKYMTSHGTDKRQKVGLLTSIMFPNNLLESITDEVDVVVYSLGSSG 366

Query: 353 KEIQANLFALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAA 397
           KE+Q+NLFA+LR++DEED VDLI VEG     EGLA+MNRLRKAA
Sbjct: 367 KEVQSNLFAMLRRLDEEDEVDLIFVEGISDRNEGLAVMNRLRKAA 411

>YGL169W (SUA5) [1821] chr7 (186063..187343) Protein involved in
           translation initiation, mutation suppresses the effect
           of an aberrant upstream ATG in CYC1 [1281 bp, 426 aa]
          Length = 426

 Score =  490 bits (1261), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 256/404 (63%), Positives = 296/404 (73%), Gaps = 16/404 (3%)

Query: 10  TRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAFPTETVYGLG 69
           T+ILKV+P +I FS  AHIDGSLPT T  ETE  L+EAA IIRDT ETVAFPTETVYGLG
Sbjct: 18  TKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFPTETVYGLG 77

Query: 70  GSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPL-SHVPEIYHPL 128
           GSALND SV +IY+AKNRPSDNPLITH+SS+ QLNR +++        L  ++P IY PL
Sbjct: 78  GSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDNIPSIYRPL 137

Query: 129 VEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALSDTPIAAPS 188
           +  LWPGPLTILL +P  S  + LSKLTTA+QPTFA RIPANP+ARALIALSDTPIAAPS
Sbjct: 138 ISSLWPGPLTILLPVP-SSEHSALSKLTTADQPTFAVRIPANPVARALIALSDTPIAAPS 196

Query: 189 ANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLRPGGFTYEN 248
           ANASTRPSPT A HV+HDL  +IP+ILDGG C VGVESTVVDGL  PP LLRPGGFTYE 
Sbjct: 197 ANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRPGGFTYEE 256

Query: 249 ILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVP--EGDSQIISSER 306
           I+ +GG  W  C VE K  ++  EKV+TPGMKYRHYSP AKV+LLVP  EGD  +   +R
Sbjct: 257 IVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVLLVPHCEGDGILKGVDR 316

Query: 307 LGRLKSLVDKEI-IQQGAKKVAFLNSLHLNKHFIDGKCIH-----------ESLGTTGKE 354
           + RLK L++ E+      KK+A L SL L    +  K  +           E LG +G+E
Sbjct: 317 MERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDFSSKTFIIERLGQSGEE 376

Query: 355 IQANLFALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAAS 398
           IQ NLFA LRKVDE D VDLI VEG     EGLA+MNRLRKAA+
Sbjct: 377 IQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAAA 420

>CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein,
           start by similarity
          Length = 422

 Score =  477 bits (1228), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 249/404 (61%), Positives = 298/404 (73%), Gaps = 19/404 (4%)

Query: 8   LTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAFPTETVYG 67
           L T +LKVD  +I F ++AHIDG LP    A +   LL+AA IIRDT ETVAFPTETVYG
Sbjct: 17  LRTEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHIIRDTEETVAFPTETVYG 76

Query: 68  LGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSHVPEIYHP 127
           LGGS+LND SV+NIYKAKNRPSDNPLITH+SS+ QLNR IY+D  +D   L ++P+IYHP
Sbjct: 77  LGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYNDY-EDGDILRNIPKIYHP 135

Query: 128 LVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALSDTPIAAP 187
           L+EKLWPGPLTILL IP   N  +LSKLTT +QPTFA RIPAN IARALIAL+DTPIAAP
Sbjct: 136 LIEKLWPGPLTILLPIPPERNV-SLSKLTTGDQPTFAVRIPANSIARALIALADTPIAAP 194

Query: 188 SANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLRPGGFTYE 247
           SANASTRPSPT A HV+HDL GRIPLI+DGG C+VGVESTVVDGL  PP LLRPGGFTYE
Sbjct: 195 SANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLCLPPALLRPGGFTYE 254

Query: 248 NILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVP-EGDSQIISSER 306
           +IL++GG  W+ C VE K  + + EKV+TPGMKY+HY+P AKVI+L+P + D+Q+   ++
Sbjct: 255 DILHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVLLPNDSDTQMQLIDK 314

Query: 307 LGRLKSLVDKEIIQQGAKKVAFLNSLHL-------------NKHFIDGKCIHESLGTTGK 353
           +    S    +II    KKVA + +L L             N      + +   LG +G+
Sbjct: 315 MKVFLSSHQPDIID---KKVAIMTTLKLTPILNEISLFASSNYKGTKTEFLVSELGASGE 371

Query: 354 EIQANLFALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAA 397
            IQANLFA LRK DE DNVD I+VEG     EGLA+MNRLRKA+
Sbjct: 372 AIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKAS 415

>Scas_707.49
          Length = 441

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 246/398 (61%), Positives = 295/398 (74%), Gaps = 15/398 (3%)

Query: 8   LTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAFPTETVYG 67
             T+I KVDP  I F +++HIDG+LP  T   TE  LLEAA IIRDT +TVAFPTETVYG
Sbjct: 45  FQTKIAKVDPTKIFFPENSHIDGTLPIITDPITESALLEAAQIIRDTDQTVAFPTETVYG 104

Query: 68  LGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSHVPEIYHP 127
           LGGSALND+SV NIYKAKNRPSDNPLITH+SS++QLNR I+     D   L ++P IYH 
Sbjct: 105 LGGSALNDQSVINIYKAKNRPSDNPLITHVSSINQLNRKIFKSHKTDSS-LQNIPIIYHK 163

Query: 128 LVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALSDTPIAAP 187
           L++ LWPGPLTILL  P  + R TLS  TT +QPTFA RIP+N IARALIALSDTPIAAP
Sbjct: 164 LIKTLWPGPLTILL--PTENTRGTLSVKTTNSQPTFAVRIPSNVIARALIALSDTPIAAP 221

Query: 188 SANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLRPGGFTYE 247
           SAN ST+PSPT A HVFHDL G+IPLILDGG C+VGVESTV+DGL  PPMLLRPGG T E
Sbjct: 222 SANTSTKPSPTLASHVFHDLKGKIPLILDGGPCNVGVESTVLDGLSRPPMLLRPGGLTLE 281

Query: 248 NILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVPEGDSQIISSERL 307
           +IL +GG  W +C VE K N+K  E V+TPGMKY+HYSP AKVILL+P  DS      + 
Sbjct: 282 HILELGGQDWIDCKVENKQNVKQGETVRTPGMKYKHYSPDAKVILLIPPPDSN-----QR 336

Query: 308 GRLKSLVDK--EII-QQGAKKVAFLNSLHLNKH---FIDG-KCIHESLGTTGKEIQANLF 360
             +KS + +  EI+ Q+  KK+A L    LN+    F +    I + LG  G EIQANLF
Sbjct: 337 PTVKSYLHELNEIVGQEKGKKIAILTGPILNREEKLFPNNTDIIVKHLGDEGNEIQANLF 396

Query: 361 ALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAAS 398
           A+LR+ DE DNVD+++VEG+  + EGLAIMNRL+KA++
Sbjct: 397 AMLREADEIDNVDVMIVEGSSEDGEGLAIMNRLKKASA 434

>CAGL0L02035g complement(238416..240392) highly similar to sp|P36013
           Saccharomyces cerevisiae YKL029c MAE1 malic enzyme,
           hypothetical start
          Length = 658

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 334 LNKHFIDGKCIHESLGTTGKEIQANLFALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRL 393
           L+K+  D  C ++ +  TG  + A+L A L+  D E     ++V G  A   GL I +++
Sbjct: 331 LDKYRYDLPCFNDDIQGTGAVVTASLLAALKHTDRELKDTKVLVFG--AGSAGLGIADQI 388

>Kwal_26.9322
          Length = 331

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 37/88 (42%)

Query: 68  LGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSHVPEIYHP 127
           LGG +L++ + + I     +  +      +     +  ++ + I+D C  L      Y P
Sbjct: 149 LGGLSLSEVTAEQIRAVHAKFGEYLCCVEVEMSLFVPDILTNGIADTCNELGIPIVCYSP 208

Query: 128 LVEKLWPGPLTILLSIPDGSNRNTLSKL 155
           L   L  G +T    +PDG+ +    +L
Sbjct: 209 LCNGLLTGAITSTNDVPDGAFKKNFKRL 236

>YPR127W (YPR127W) [5546] chr16 (790077..791114) Protein with
           similarity to S. pombe pyridoxal reductase [1038 bp, 345
           aa]
          Length = 345

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 67  GLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQL--NRVIYSDISDDCKPLSHVPEI 124
           G+  S +N+E ++ I+K   +      +T +     L  N ++++ I+  C  L      
Sbjct: 159 GISLSEVNEEQIRAIHKDWGK-----FLTCVEVELSLFSNDILHNGIAKTCAELGLSIIC 213

Query: 125 YHPLVEKLWPGPLTILLSIPDGSNRNTLSKLT 156
           Y PL   L  G L     IP+G  R +L + +
Sbjct: 214 YSPLGRGLLTGQLKSNADIPEGDFRKSLKRFS 245

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 40/95 (42%), Gaps = 15/95 (15%)

Query: 210 RIPLILDGGKCSVGVESTVVDGLVTPPMLLRPGGFTYENILNIGGPLWKECLVETKVNIK 269
           R  L ++G KC VGV      GL     L+  GG ++          WKE +  T+++I 
Sbjct: 642 RYTLFINGSKCEVGVRKLSDGGL-----LIAVGGKSHT-------IYWKEEVAATRLSID 689

Query: 270 DDE---KVKTPGMKYRHYSPKAKVILLVPEGDSQI 301
                 +V+    + R  SP   V  LV  GD  I
Sbjct: 690 SKTTLLEVENDPTQLRTPSPGKLVKFLVENGDHVI 724

>Sklu_2439.4 YHR005C, Contig c2439 3407-4217
          Length = 271

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 213 LILDGGKCSVGVESTVVDGLVTPPMLLRPGGFTYENILNIGGPLWKECLVETKVNIKDDE 272
           L+L  G+     +STV+  L     LL  GGFTY+  L     +W + +   K+ I    
Sbjct: 45  LLLGAGESG---KSTVLKQL----RLLHQGGFTYQERLQYSQIIWADTIQSMKILIIQAR 97

Query: 273 KVKTP 277
           K+  P
Sbjct: 98  KLNIP 102

>YKL075C (YKL075C) [3185] chr11 complement(292601..293953) Protein
           of unknown function [1353 bp, 450 aa]
          Length = 450

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 284 YSPKAKVILLVPEGDSQIISSERLGRLKSLVDKEIIQ 320
           Y P  K+I L  E +  ++ SE+ G L SL D E +Q
Sbjct: 247 YKPMMKIISLYNEYNELMVKSEKNGFLPSLQDSENVQ 283

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,099,756
Number of extensions: 583611
Number of successful extensions: 1677
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1688
Number of HSP's successfully gapped: 22
Length of query: 398
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 294
Effective length of database: 12,995,837
Effective search space: 3820776078
Effective search space used: 3820776078
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)