Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A03091g38337712731e-176
AEL298C3371823691e-40
Sklu_1042.22981403083e-32
Kwal_14.15243941972687e-26
CAGL0L09383g3661652448e-23
YPR009W (SUT2)2681422335e-22
Scas_710.104371502193e-19
YGL162W (SUT1)2991472047e-18
CAGL0I04246g3571802014e-17
ABL121C128539780.15
AFR117C115226780.15
KLLA0F02750g114852770.19
Scas_625.5114144770.20
CAGL0L03377g120931740.46
CAGL0B03421g135534740.49
CAGL0M03025g125449740.49
Sklu_1993.282327730.57
Kwal_27.10232120949720.65
Scas_662.890622720.73
Scas_573.4147834720.75
YIL130W96422720.78
CAGL0F07865g84438710.86
Kwal_23.475481221710.95
KLLA0F04609g91621711.0
AER183C87932711.0
YDR421W (ARO80)95030701.3
AER370W80121701.3
Kwal_47.1768185427701.4
KLLA0D01452g144539691.8
YLR256W (HAP1)150222682.1
KLLA0F22990g125322682.3
KLLA0A03443g97525682.4
KLLA0F14322g71728672.7
Sklu_2296.691921672.8
KLLA0F25630g100757672.9
CAGL0A00451g110721673.0
Kwal_26.744871444673.1
YKL038W (RGT1)117020673.2
Sklu_2376.692222663.3
CAGL0G08844g84721663.5
Scas_669.863723663.7
Kwal_23.653755274654.4
YLR266C (PDR8)70130654.6
YMR280C (CAT8)143339654.8
KLLA0A09119g108222654.9
CAGL0F09229g83520655.0
YDR213W (UPC2)91338655.3
Scas_637.799826646.0
Kwal_33.1311877930646.1
Sklu_2397.884822646.2
Sklu_2411.1168742646.3
KLLA0D12672g86580646.4
YOL089C (HAL9)103024646.7
CAGL0L01903g128720646.8
AFR096W85219638.2
Scas_696.44116440639.2
Scas_685.2277737639.4
YJL089W (SIP4)82918639.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A03091g
         (377 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A03091g 276333..277484 some similarities with sgd|S0006213 ...   494   e-176
AEL298C [2207] [Homologous to ScYPR009W (SUT2) - SH; ScYGL162W (...   146   1e-40
Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement        123   3e-32
Kwal_14.1524                                                          107   7e-26
CAGL0L09383g 1018859..1019959 some similarities with sp|P53032 S...    99   8e-23
YPR009W (SUT2) [5445] chr16 (576547..577353) Protein with simila...    94   5e-22
Scas_710.10                                                            89   3e-19
YGL162W (SUT1) [1827] chr7 (198142..199041) Protein that binds S...    83   7e-18
CAGL0I04246g 377568..378641 weakly similar to sp|P53032 Saccharo...    82   4e-17
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    35   0.15 
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    35   0.15 
KLLA0F02750g complement(250368..253814) some similarities with s...    34   0.19 
Scas_625.5                                                             34   0.20 
CAGL0L03377g complement(382932..386561) some similarities with s...    33   0.46 
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    33   0.49 
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    33   0.49 
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         33   0.57 
Kwal_27.10232                                                          32   0.65 
Scas_662.8                                                             32   0.73 
Scas_573.4                                                             32   0.75 
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    32   0.78 
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    32   0.86 
Kwal_23.4754                                                           32   0.95 
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    32   1.0  
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    32   1.0  
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    32   1.3  
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    32   1.3  
Kwal_47.17681                                                          32   1.4  
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    31   1.8  
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    31   2.1  
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    31   2.3  
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    31   2.4  
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    30   2.7  
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       30   2.8  
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    30   2.9  
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    30   3.0  
Kwal_26.7448                                                           30   3.1  
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    30   3.2  
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              30   3.3  
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    30   3.5  
Scas_669.8                                                             30   3.7  
Kwal_23.6537                                                           30   4.4  
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    30   4.6  
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    30   4.8  
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    30   4.9  
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    30   5.0  
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    30   5.3  
Scas_637.7                                                             29   6.0  
Kwal_33.13118                                                          29   6.1  
Sklu_2397.8 YML099C, Contig c2397 9784-12330                           29   6.2  
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      29   6.3  
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    29   6.4  
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    29   6.7  
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    29   6.8  
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    29   8.2  
Scas_696.44                                                            29   9.2  
Scas_685.22                                                            29   9.4  
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    29   9.7  

>KLLA0A03091g 276333..277484 some similarities with sgd|S0006213
           Saccharomyces cerevisiae YPR009w, hypothetical start
          Length = 383

 Score =  494 bits (1273), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 263/377 (69%), Positives = 263/377 (69%)

Query: 1   MSSIIIDNCNNTSXXXXXXXAVVHHDERNTYLNKLSASNFKQDKXXXXXXXXXXXXXXXX 60
           MSSIIIDNCNNTS       AVVHHDERNTYLNKLSASNFKQDK                
Sbjct: 1   MSSIIIDNCNNTSLPPLLLPAVVHHDERNTYLNKLSASNFKQDKSVSGLNLISNSSSWSK 60

Query: 61  XXXXYTTSKTAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKDTIGSSYN 120
               YTTSKTAV                                      PKDTIGSSYN
Sbjct: 61  PSANYTTSKTAVLLTPPNSNINSSTATASSSLDDLASLASVAAATNNVALPKDTIGSSYN 120

Query: 121 SHQHPLIHDCLQRKRSNSSADEESLAAPVAFXXXXXXXXXXXXXXXXXXTSFXXXXXXXX 180
           SHQHPLIHDCLQRKRSNSSADEESLAAPVAF                  TSF        
Sbjct: 121 SHQHPLIHDCLQRKRSNSSADEESLAAPVAFKKRGRKNSRKNSMRMSSNTSFTLSSAVSS 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXVSNSPSSVEEDAGVTRGFDDNQLLANISGAKVITSSK 240
                                  VSNSPSSVEEDAGVTRGFDDNQLLANISGAKVITSSK
Sbjct: 181 NTTSSTTSRSSSRSKSPLSRAQSVSNSPSSVEEDAGVTRGFDDNQLLANISGAKVITSSK 240

Query: 241 CKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLHCPLSIDTCRPDILMKI 300
           CKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLHCPLSIDTCRPDILMKI
Sbjct: 241 CKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLHCPLSIDTCRPDILMKI 300

Query: 301 PTEVRKQLAERKDMSLVRHVDKLIAFSSCSSCQKKKDRDCSFSKGFTRNDIAVFSTLNKK 360
           PTEVRKQLAERKDMSLVRHVDKLIAFSSCSSCQKKKDRDCSFSKGFTRNDIAVFSTLNKK
Sbjct: 301 PTEVRKQLAERKDMSLVRHVDKLIAFSSCSSCQKKKDRDCSFSKGFTRNDIAVFSTLNKK 360

Query: 361 LGKRNSLGDFTVKDYLN 377
           LGKRNSLGDFTVKDYLN
Sbjct: 361 LGKRNSLGDFTVKDYLN 377

>AEL298C [2207] [Homologous to ScYPR009W (SUT2) - SH; ScYGL162W
           (SUT1) - SH] (81182..82195) [1014 bp, 337 aa]
          Length = 337

 Score =  146 bits (369), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/182 (48%), Positives = 117/182 (64%), Gaps = 16/182 (8%)

Query: 204 VSNSPSSVEEDAGVTRG------FDDNQLLANISGAKVITSSKCKRQRTGPSCDVCRSKK 257
           VS SP   E  +G  RG         N LL   +   VIT+SK KRQRTGPSCD+CRSKK
Sbjct: 159 VSMSPLMSESVSGFQRGDVQRTGSPPNSLLQEPT---VITASKYKRQRTGPSCDICRSKK 215

Query: 258 IKCDATVLVISQDPSLL--FNCKEDESLHCPLSIDTCRPDILMKIPTEVRKQLAERKDMS 315
           IKCDAT+ ++ QD S+   FN    E LH P+++     + L +IP EVR Q    K+++
Sbjct: 216 IKCDATITILFQDASVTGSFN----EMLHAPVNVSELANEWLSQIPDEVR-QALLTKELT 270

Query: 316 LVRHVDKLIAFSSCSSCQKKKDRDCSFSKGFTRNDIAVFSTLNKKLGKRNSLGDFTVKDY 375
           L++HVDKLIAF  C+SC K+K+  C+FSKGFTR DI V++ L  K GKR+S+  F++ DY
Sbjct: 271 LLKHVDKLIAFKPCTSCSKRKNCFCTFSKGFTRADINVYTNLCVKFGKRSSIDQFSLNDY 330

Query: 376 LN 377
            N
Sbjct: 331 RN 332

>Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement
          Length = 298

 Score =  123 bits (308), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/140 (47%), Positives = 88/140 (62%), Gaps = 6/140 (4%)

Query: 240 KCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLHCPLSIDTCR--PDIL 297
           K KRQR GPSCDVCR +KIKCDAT+ ++ Q  SL+ +    +SLH  LS       P  L
Sbjct: 156 KSKRQRVGPSCDVCRVRKIKCDATIRIVHQAESLVSSI--SDSLHAVLSAQDLELLPKYL 213

Query: 298 M-KIPTEVRKQLAERKDMS-LVRHVDKLIAFSSCSSCQKKKDRDCSFSKGFTRNDIAVFS 355
             ++P ++  Q+ +  D + LV+HVDKL+ F  C SC KK +  C FSKG TR DI +F+
Sbjct: 214 ADRVPLDLLLQVKDPADKTQLVKHVDKLVVFKPCRSCHKKHNAACQFSKGLTRADINIFN 273

Query: 356 TLNKKLGKRNSLGDFTVKDY 375
            L KK GKR +L D+T  DY
Sbjct: 274 RLEKKTGKRAALKDYTYHDY 293

>Kwal_14.1524
          Length = 394

 Score =  107 bits (268), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 95/197 (48%), Gaps = 66/197 (33%)

Query: 241 CKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLL-FNCKEDESLHCPLSIDTCRPDILMK 299
            KRQR GPSCD CR KKIKCDA+V V+ QD +L+ F+  ++ESLH  ++      ++   
Sbjct: 197 AKRQRIGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYS----ELKAA 252

Query: 300 IPTEVRKQLAER----------KDMSLVRHVDKLIAFSSCSSCQKK--------KDRD-- 339
           +P+ V K L  R          +   +VRHVDK++ F +C+SC ++        K+ D  
Sbjct: 253 LPSHVWKNLPARVLEALESQDSRAGEVVRHVDKVVFFRACASCARRNASGSGSGKESDGE 312

Query: 340 -----------------------------------------CSFSKGFTRNDIAVFSTLN 358
                                                    C+FSKGFTR+DI VF+ L 
Sbjct: 313 SGTSAPATPAGPTGSVRAAAGVAAAAAGTTATPAAALGPACCTFSKGFTRSDINVFTRLQ 372

Query: 359 KKLGKRNSLGDFTVKDY 375
           K+LG R  L DFTV +Y
Sbjct: 373 KQLGPRGQLADFTVAEY 389

>CAGL0L09383g 1018859..1019959 some similarities with sp|P53032
           Saccharomyces cerevisiae YGL162w SUT1 or tr|Q12286
           Saccharomyces cerevisiae YPR009w, hypothetical start
          Length = 366

 Score = 98.6 bits (244), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 99/165 (60%), Gaps = 16/165 (9%)

Query: 224 NQLLANI-SGAKVITSSKCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDES 282
           N + +NI S + ++ ++  KRQR GPSCD CRSKKIKCDA + ++ QD ++L      +S
Sbjct: 200 NTMASNIKSTSDLVANNAGKRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMF--GQS 257

Query: 283 LHCPLS---IDT-------CRPDILMKIPTEVRKQLAERK-DMSLVRHVDKLIAFSSCSS 331
           LH  L+   I+T        +      I  ++  ++  R+ D  +++H+DK+I F  C+S
Sbjct: 258 LHHELTKHEIETQLGQEVYSQSSTFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTS 317

Query: 332 CQKKKDRD-CSFSKGFTRNDIAVFSTLNKKLGKRNSLGDFTVKDY 375
           C +KK+   C+FSKGFTR DI +FS +  ++ ++  + + T K+Y
Sbjct: 318 CSRKKNTAVCAFSKGFTRADINIFSKIGSRVAQK-PIYEMTYKEY 361

>YPR009W (SUT2) [5445] chr16 (576547..577353) Protein with
           similarity to Sut1p, involved in sterol uptake [807 bp,
           268 aa]
          Length = 268

 Score = 94.4 bits (233), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 86/142 (60%), Gaps = 15/142 (10%)

Query: 240 KCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLHCPLS---IDTCRPDI 296
           K KRQR GPSCD CR KKIKC+AT+++  QD +L+ +   +  LH  LS   I+  R   
Sbjct: 130 KRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSN--LHYTLSQDDINQFRMKF 187

Query: 297 LMKIPTEVRKQLAERKDMSLVRHVDKLIAFSSCSSCQKK--KDRDCSFSKGFTRNDIAVF 354
             K+P  +           +++H+DK++ F +C+SC ++  K+  C FS+GFT++D+ VF
Sbjct: 188 FRKLPDVM-------GTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVF 240

Query: 355 STLNKKLGKRNSLGDFTVKDYL 376
             +N KL K  S+ + TV DY+
Sbjct: 241 PKINSKL-KDKSIFEMTVDDYV 261

>Scas_710.10
          Length = 437

 Score = 89.0 bits (219), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 242 KRQRTGPSCDVCRSKKIKCDATVLVISQDPSLL----------FNCKEDESLHCPLSIDT 291
           KRQR GPSCD CR KKIKCD+ + V+ +   +L          FN  E E L   L  +T
Sbjct: 283 KRQRVGPSCDHCRFKKIKCDSQIKVVLESNHILNLISNKIHYVFNADEIELLKTTLLKNT 342

Query: 292 CRPDILMKIPTEVRKQLAERKDMS-LVRHVDKLIAFSSCSSCQKKKDRDCSFSKGFTRND 350
             P+ L    T  ++ +AE      L++H DK+I FS C+SC  K ++DC FS GFTR+D
Sbjct: 343 TLPEKLANTTTINKRNIAEGSVYPILLKHFDKIILFSPCTSCD-KNEQDCLFSMGFTRSD 401

Query: 351 IAVFSTLNKKLGKRNSLG-----DFTVKDY 375
           IA    + K L   N        D T+ DY
Sbjct: 402 IATCKMILKNLPNNNDNIKKNIFDLTIMDY 431

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 56/137 (40%), Gaps = 15/137 (10%)

Query: 226 LLANISGAKVITSSKCK----RQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDE 281
           L  N +  K  TSS  K    R+R   SCD CR +KIKCD+   +I     L+     DE
Sbjct: 112 LERNYTFQKSKTSSTSKAPPIRKRNSSSCDYCRQRKIKCDSNFNIIRTSNQLIGPMFPDE 171

Query: 282 SLHCPLSIDTCRPDILMKIPTEVRKQLAERK---------DMSLVRHVDKLIAFSSCSSC 332
             H     +      +M  P E+   L   +         +  L ++ + LI F+ C++C
Sbjct: 172 IFHILTKKEIDELQQVMVPPLELPSTLFNYQWNWEANPEGNPILFKNKNDLILFTPCTNC 231

Query: 333 QKKKDRDCSFSKGFTRN 349
             +    C F   F  N
Sbjct: 232 SMQ--FTCQFKDKFHPN 246

>YGL162W (SUT1) [1827] chr7 (198142..199041) Protein that binds
           Ssn6p and counteracts Ssn6p-Tup1p-mediated
           transcriptional repression, involved in sterol uptake
           [900 bp, 299 aa]
          Length = 299

 Score = 83.2 bits (204), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 81/147 (55%), Gaps = 17/147 (11%)

Query: 242 KRQRTGPSCDVCRSKKIKCDATVLVISQDPSLL-FNCKEDESLHCPLSIDTCRPDIL--M 298
           KRQR+GPSCD CR KKIKC+A + ++ QD +++     +   +  P  I   R  +L  +
Sbjct: 152 KRQRSGPSCDKCRLKKIKCNAKIEILLQDDTIMPMISNKLRYVLTPDDIRLYRGTLLRNI 211

Query: 299 KIPTEVRKQLAERKDMSLVRHVDKLIAFSSCSSCQKK----------KDRDCSFSKGFTR 348
            IP +V +    RK   L++H+DKL+  + C  C KK          K+  C+FSKGFTR
Sbjct: 212 AIPDDVIEGTGSRK---LIKHIDKLVLLTPCLPCIKKKHSSSSTNFPKNDKCTFSKGFTR 268

Query: 349 NDIAVFSTLNKKLGKRNSLGDFTVKDY 375
            DI + S ++ K  K  ++ D T  DY
Sbjct: 269 ADINISSKISLKF-KDKTIYDITYDDY 294

>CAGL0I04246g 377568..378641 weakly similar to sp|P53032
           Saccharomyces cerevisiae YGL162w SUT1 hypoxic protein
           involved in sterol uptake, start by similarity
          Length = 357

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 84/180 (46%), Gaps = 61/180 (33%)

Query: 241 CKRQRTGPSCDVCRSKKIKCDATVLVISQDPSL--LFNCKEDESLHCPLSIDTCRPDILM 298
            KRQR GPSCD CR KKIKC+AT  ++ QD  +  LF+ K    LH   S     P+ ++
Sbjct: 164 AKRQRVGPSCDKCRVKKIKCNATSNILVQDLDIVSLFSTK----LHYEFS-----PEEIL 214

Query: 299 KIPTEVRKQLAER---------------------KDMSLVRHVDKLIAFSSCSSCQKKKD 337
              +EV + +  +                     ++ +LV+H+DKLI F  C SCQKKK+
Sbjct: 215 NENSEVNQYMRRKHIIDAPSIQNLKECIRKNQNPQNKTLVKHIDKLIIFQPCDSCQKKKN 274

Query: 338 R-----------------------------DCSFSKGFTRNDIAVFSTLNKKLGKRNSLG 368
                                         +C+FSKGFTR+DI++++ +     K  S+G
Sbjct: 275 NLLITANSTPIEIRQNPKFQKTHELLISHCNCTFSKGFTRSDISIYTKITYHQKKGKSIG 334

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 34.7 bits (78), Expect = 0.15,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 245 RTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESL 283
           R   +CD CRSKK +CD      SQ  ++ F CK  + L
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 111

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
           (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 238 SSKCKRQRTGPSCDVCRSKKIKCDAT 263
           SSK KR R   SC +CR +K+KCD T
Sbjct: 7   SSKRKRNRVPLSCTICRKRKVKCDKT 32

>KLLA0F02750g complement(250368..253814) some similarities with
           sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
           transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 10/52 (19%)

Query: 210 SVEEDAGVTRGFDDNQLLANISGAKVITSSKCKRQRTGPSCDVCRSKKIKCD 261
           S+ EDAG+          A  S A+ +T+   K+ R   +CD CR +KIKCD
Sbjct: 4   SITEDAGIP---------AITSHAEGVTTKPAKK-RVSKACDRCRRRKIKCD 45

>Scas_625.5
          Length = 1141

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 5/44 (11%)

Query: 237 TSSKCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKED 280
           +SS+ KR +   +CD CR KKIKCD      S++ +L  NC+ +
Sbjct: 62  SSSQKKRTKASRACDQCRKKKIKCD-----FSEEKTLCSNCQRN 100

>CAGL0L03377g complement(382932..386561) some similarities with
           sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
           interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 3/31 (9%)

Query: 232 GAKVITSSKCKRQRTGPSCDVCRSKKIKCDA 262
           G  V+T +K   +R   +CD CRSKKIKCD 
Sbjct: 14  GELVLTRTK---KRHSQACDRCRSKKIKCDG 41

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
           Saccharomyces cerevisiae YLR256w HAP1 transcription
           factor, hypothetical start
          Length = 1355

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 4/34 (11%)

Query: 230 ISGAKVITSSKCKRQRTGPSCDVCRSKKIKCDAT 263
           I GA    + K KR R   SC +CR +K+KCD T
Sbjct: 7   IPGA----APKKKRNRIPLSCTICRKRKVKCDKT 36

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
           Saccharomyces cerevisiae YMR280c CAT8 transcription
           factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 230 ISGAKVITSSKCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCK 278
           +SG+   +       R   +CD CR KK KCD  +   SQ   + F CK
Sbjct: 40  VSGSNTGSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECK 88

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 236 ITSSKCKRQRTGPSCDVCRSKKIKCDA 262
           ++  + KR+R   +CD CR KK+KCD 
Sbjct: 1   MSEPQSKRRRVTRACDECRKKKVKCDG 27

>Kwal_27.10232
          Length = 1209

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 235 VITSSKCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESL 283
           V +++     R   +CD CRSKK +CD      SQ  ++ F CK  + L
Sbjct: 59  VTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107

>Scas_662.8
          Length = 906

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 241 CKRQRTGPSCDVCRSKKIKCDA 262
            KR+R   +CD CR KK+KCD 
Sbjct: 28  VKRRRVTRACDECRKKKVKCDG 49

>Scas_573.4
          Length = 1478

 Score = 32.3 bits (72), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 228 ANISGAKVITSSKCKRQRTGPSCDVCRSKKIKCD 261
           AN +G    T  K KR R   SC +CR +K+KCD
Sbjct: 23  ANANGTS--TKVKRKRNRVPLSCTICRKRKVKCD 54

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region, putative transcription
           factor [2895 bp, 964 aa]
          Length = 964

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 241 CKRQRTGPSCDVCRSKKIKCDA 262
            KR+R   +CD CR KK+KCD 
Sbjct: 12  VKRRRVTRACDECRKKKVKCDG 33

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, start by
           similarity
          Length = 844

 Score = 32.0 bits (71), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 227 LANISGAKVITSSKCKRQ---RTGPSCDVCRSKKIKCD 261
           L +I G KV T+S  KR+   ++   CD C+ +++KCD
Sbjct: 28  LVDIGGKKVSTTSTGKRKFHNKSKNGCDHCKRRRVKCD 65

>Kwal_23.4754
          Length = 812

 Score = 32.0 bits (71), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 242 KRQRTGPSCDVCRSKKIKCDA 262
           KR+R   +CD CR KK+KCD 
Sbjct: 7   KRRRVTRACDECRKKKVKCDG 27

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 242 KRQRTGPSCDVCRSKKIKCDA 262
           KR+R   +CD CR KK+KCD 
Sbjct: 6   KRRRVTRACDECRKKKVKCDG 26

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 232 GAKVITSSK-CKRQRTGPSCDVCRSKKIKCDA 262
             + +T +K   R+R   +CD+CR+KKI+C+ 
Sbjct: 62  APEAMTETKTVMRKRVSKACDICRAKKIRCNG 93

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
           transcription regulator of ARO9 and ARO10, member of the
           Zn2Cys6 transcription factor family [2853 bp, 950 aa]
          Length = 950

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 242 KRQRTGPSCDVCRSKKIKCDATVLVISQDP 271
           KR+RT  +C  CRS+K+KCD   +    DP
Sbjct: 17  KRRRTYQACISCRSRKVKCDLGPVDNPHDP 46

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
           complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 242 KRQRTGPSCDVCRSKKIKCDA 262
           KR+R   +CD CR KK+KCD+
Sbjct: 10  KRRRVTRACDECRKKKVKCDS 30

>Kwal_47.17681
          Length = 854

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 19/27 (70%)

Query: 240 KCKRQRTGPSCDVCRSKKIKCDATVLV 266
           + ++ RT  +C+VC  +K++CDA + V
Sbjct: 9   RVRKPRTNRACEVCHDRKVRCDANIRV 35

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 245 RTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESL 283
           R   +CD CR+KKI+CD      +Q  ++ F CK  + L
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKL 216

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 240 KCKRQRTGPSCDVCRSKKIKCD 261
           K KR R   SC +CR +K+KCD
Sbjct: 54  KRKRNRIPLSCTICRKRKVKCD 75

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor singleton,
           hypothetical start
          Length = 1253

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 240 KCKRQRTGPSCDVCRSKKIKCD 261
           K KR R   SC +CR +K+KCD
Sbjct: 15  KRKRNRVPLSCTICRKRKVKCD 36

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor, start by similarity
          Length = 975

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%)

Query: 237 TSSKCKRQRTGPSCDVCRSKKIKCD 261
           ++  CKRQR    C  CR  K KCD
Sbjct: 22  SNGACKRQRISFVCQACRKNKTKCD 46

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 235 VITSSKCKRQRTGPSCDVCRSKKIKCDA 262
           ++ ++  K +R   +CD CR KKIKCD 
Sbjct: 48  LMPTASTKVKRFSQACDRCRLKKIKCDG 75

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query: 242 KRQRTGPSCDVCRSKKIKCDA 262
           +++R+  +CD CR KKIKCD 
Sbjct: 21  RQERSSQACDRCRLKKIKCDG 41

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%)

Query: 205 SNSPSSVEEDAGVTRGFDDNQLLANISGAKVITSSKCKRQRTGPSCDVCRSKKIKCD 261
           + +P S+   A      D+ +  +  S     T+   +R +   +CD CR KKIKCD
Sbjct: 72  ATTPRSINTGASTVPEPDNTRRDSVSSNVSTATTESRRRSKVSRACDQCRKKKIKCD 128

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
           cerevisiae YGL013c PDR1 transcription factor,
           hypothetical start
          Length = 1107

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 15/21 (71%)

Query: 242 KRQRTGPSCDVCRSKKIKCDA 262
           +R + G +CD CR +KIKC+ 
Sbjct: 23  RRTKVGKACDSCRRRKIKCNG 43

>Kwal_26.7448
          Length = 714

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 221 FDDNQLLANISGAKVITSSKCKRQRTGPSCDVCRSKKIKCDATV 264
           FDD      +   K IT  + +  R G  CD C+ ++IKCD T+
Sbjct: 68  FDDVSPRETVVLKKRITRRRHRNSRLG--CDECKRRRIKCDETL 109

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
           regulation of glucose transporters, acts as a
           transcriptional repressor that is converted to an
           activator upon glucose-induced phosphorylation [3513 bp,
           1170 aa]
          Length = 1170

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%)

Query: 242 KRQRTGPSCDVCRSKKIKCD 261
           KR +   +CD CR KKIKCD
Sbjct: 39  KRTKASRACDQCRKKKIKCD 58

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 15/22 (68%)

Query: 240 KCKRQRTGPSCDVCRSKKIKCD 261
           K KRQRT   C  C+ +KIKCD
Sbjct: 18  KKKRQRTTVVCTNCKKRKIKCD 39

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 242 KRQRTGPSCDVCRSKKIKCDA 262
           KR++   +CD CR KK+KCD 
Sbjct: 12  KRRKVTRACDDCRKKKVKCDG 32

>Scas_669.8
          Length = 637

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 18/23 (78%)

Query: 242 KRQRTGPSCDVCRSKKIKCDATV 264
           +R++T  +C+VC+ +K+KCD  +
Sbjct: 8   ERRKTPYACNVCKKRKVKCDKLI 30

>Kwal_23.6537
          Length = 552

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 242 KRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLHCPLSIDTCRPDILMKI- 300
           KR R   +C  CR +K KCD+         S  +NC+ D+ +  PLS    RP       
Sbjct: 12  KRLRVRKACLPCRQRKRKCDSG-FPCGMCTSYGYNCQYDD-VDGPLSFYEKRPSPKQSTS 69

Query: 301 PTEVRKQLAERKDM 314
           P+ ++K+  ER  M
Sbjct: 70  PSTIQKKEVERPSM 83

>YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys[6]
           zinc finger transcription factor, likely involved in
           pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 231 SGAKVITSSKCKRQRTGPSCDVCRSKKIKC 260
           +G  V +  K KR++   SC  CR +K+KC
Sbjct: 12  TGEPVSSGKKGKRRKVIKSCAFCRKRKLKC 41

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 245 RTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESL 283
           R   +CD CRSKK +CD      SQ  ++ F C+  + L
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL 103

>KLLA0A09119g complement(797533..800781) weakly similar to sp|P12383
           Saccharomyces cerevisiae YGL013c PDR1 transcription
           factor, start by similarity
          Length = 1082

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 243 RQRTGPSCDVCRSKKIKCDATV 264
           R++   +CD CR KKIKC  T+
Sbjct: 48  RRKVSRACDSCRKKKIKCSGTL 69

>CAGL0F09229g complement(908186..910693) weakly similar to sp|P39961
           Saccharomyces cerevisiae YER184c, hypothetical start
          Length = 835

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 243 RQRTGPSCDVCRSKKIKCDA 262
           + R   +CDVCR +K+KCD 
Sbjct: 14  KDRVIRACDVCRKRKVKCDG 33

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
           element binding protein involved in the regulation of
           sterol biosynthetic gene expression and the uptake and
           intracellular esterification of sterols [2742 bp, 913
           aa]
          Length = 913

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 227 LANISGAKVITSSKCKRQ---RTGPSCDVCRSKKIKCD 261
           L  + G KV T+S  KR+   ++   CD C+ +++KCD
Sbjct: 25  LIEVDGKKVSTTSTGKRKFHNKSKNGCDNCKRRRVKCD 62

>Scas_637.7
          Length = 998

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 3/26 (11%)

Query: 236 ITSSKCKRQRTGPSCDVCRSKKIKCD 261
           ITS K   +R   +CD CR +KIKCD
Sbjct: 95  ITSGK---KRVSKACDHCRKRKIKCD 117

>Kwal_33.13118
          Length = 779

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 237 TSSKCKRQRTGPSCDVCRSKKIKCDATVLV 266
           +S K +++R   SC+VCR  K +CD   LV
Sbjct: 44  SSRKPRKKRKTYSCEVCRKFKTRCDFEPLV 73

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 240 KCKRQRTGPSCDVCRSKKIKCD 261
           K +R +T   C  CRS+K+KCD
Sbjct: 10  KPRRAKTFTGCWTCRSRKVKCD 31

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 7/42 (16%)

Query: 221 FDDNQLLANISGAKVITSSKCKRQRTGPSCDVCRSKKIKCDA 262
           ++D  L    +G+K       +R R   +C++C+ +KIKCD 
Sbjct: 6   YNDPSLYGKDNGSK-------QRLRVRKACEICKKRKIKCDG 40

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 12/80 (15%)

Query: 249 SCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLHCPLSIDTCRPDILMKIPTEVRKQL 308
           +CD CR KK KC  TV   +       NC +  +L C  S    R  +     TE+  ++
Sbjct: 94  ACDACRKKKWKCSKTVPTCT-------NCLK-YNLDCVYSPQVVRTPLTRAHLTEMENRV 145

Query: 309 AE----RKDMSLVRHVDKLI 324
           AE     K++  V  +D+L+
Sbjct: 146 AELEQFLKELFPVWDIDRLL 165

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 238 SSKCKRQRTGPSCDVCRSKKIKCD 261
           S K  ++R   +CD CR +KI+CD
Sbjct: 124 SGKNLKKRVSKACDHCRKRKIRCD 147

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
           cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 13/20 (65%)

Query: 242 KRQRTGPSCDVCRSKKIKCD 261
           KR     +CD CR KKIKCD
Sbjct: 8   KRTNVSRACDQCRRKKIKCD 27

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
           complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 14/19 (73%)

Query: 244 QRTGPSCDVCRSKKIKCDA 262
           +R+  +CD CR KKIKCD 
Sbjct: 23  KRSSQACDRCRLKKIKCDG 41

>Scas_696.44
          Length = 1164

 Score = 28.9 bits (63), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 20/40 (50%)

Query: 245 RTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLH 284
           R   +CD CRSKK +CD      SQ   + F CK  + L 
Sbjct: 76  RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQ 115

>Scas_685.22
          Length = 777

 Score = 28.9 bits (63), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 230 ISGAKVITSSKCKRQRTGPSCDVCRSKKIKCDATVLV 266
           + G K +   + +++R   SCDVCR  K +CD  V V
Sbjct: 45  VQGEKSL--KRPRKKRKTFSCDVCRKFKTRCDFEVTV 79

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
           activator of gluconeogenic genes through CSRE elements,
           activated by Snf1p kinase, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (66%)

Query: 245 RTGPSCDVCRSKKIKCDA 262
           R   +CD CR KKIKCD 
Sbjct: 41  RKAHACDRCRLKKIKCDG 58

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.128    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,413,215
Number of extensions: 275712
Number of successful extensions: 912
Number of sequences better than 10.0: 83
Number of HSP's gapped: 905
Number of HSP's successfully gapped: 86
Length of query: 377
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 274
Effective length of database: 13,030,455
Effective search space: 3570344670
Effective search space used: 3570344670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)