Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01221g87285942280.0
AFR242C82361115570.0
Kwal_47.1917383660613051e-167
YGL227W (VID30)95862911101e-137
CAGL0I04114g91067810771e-133
Scas_712.239734218641e-101
Scas_669.10585150800.22
ABL026W48067750.70
Sklu_2430.753987694.5
Kwal_33.13461219726686.8
Scas_712.5112268678.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01221g
         (859 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces c...  1633   0.0  
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...   604   0.0  
Kwal_47.19173                                                         507   e-167
YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulate...   432   e-137
CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...   419   e-133
Scas_712.23                                                           337   e-101
Scas_669.10                                                            35   0.22 
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...    33   0.70 
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                          31   4.5  
Kwal_33.13461                                                          31   6.8  
Scas_712.5                                                             30   8.9  

>KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30 singleton, start by similarity
          Length = 872

 Score = 1633 bits (4228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 805/859 (93%), Positives = 805/859 (93%)

Query: 1   MSNSKMDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSG 60
           MSNSKMDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSG
Sbjct: 1   MSNSKMDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSG 60

Query: 61  SVSFQSLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFYARDDISNT 120
           SVSFQSLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFYARDDISNT
Sbjct: 61  SVSFQSLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFYARDDISNT 120

Query: 121 TDGDGDVDMRKSVMTEEDFLGSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           TDGDGDVDMRKSVMTEEDFLGSM                                     
Sbjct: 121 TDGDGDVDMRKSVMTEEDFLGSMLPDSEADEEDDEIDDDNDLEDDDDDEDGNDPEDDDDD 180

Query: 181 XXXXXXXXXXXXXXXXXHPRRLNESTVQIEQSRGSTTGFENPIGTSDAENIENAEVDRSK 240
                            HPRRLNESTVQIEQSRGSTTGFENPIGTSDAENIENAEVDRSK
Sbjct: 181 ELDDEDEDENDEQDSPDHPRRLNESTVQIEQSRGSTTGFENPIGTSDAENIENAEVDRSK 240

Query: 241 HKHKIVYYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKWLLQSDNSILLSQDGCAVLR 300
           HKHKIVYYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKWLLQSDNSILLSQDGCAVLR
Sbjct: 241 HKHKIVYYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKWLLQSDNSILLSQDGCAVLR 300

Query: 301 VNPNWHALSSYGRASPIMNSRLRVNINSKKKQQWATTWANNGVNHTKCAIFYFEIRVLSV 360
           VNPNWHALSSYGRASPIMNSRLRVNINSKKKQQWATTWANNGVNHTKCAIFYFEIRVLSV
Sbjct: 301 VNPNWHALSSYGRASPIMNSRLRVNINSKKKQQWATTWANNGVNHTKCAIFYFEIRVLSV 360

Query: 361 TSSQAGRNSHVLVGFKNWAKINDKLSTSEQDTTESGSAPSSENFNMLRNVLDGNRNVLNS 420
           TSSQAGRNSHVLVGFKNWAKINDKLSTSEQDTTESGSAPSSENFNMLRNVLDGNRNVLNS
Sbjct: 361 TSSQAGRNSHVLVGFKNWAKINDKLSTSEQDTTESGSAPSSENFNMLRNVLDGNRNVLNS 420

Query: 421 PSSPSQTIHGDVETYSYSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNG 480
           PSSPSQTIHGDVETYSYSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNG
Sbjct: 421 PSSPSQTIHGDVETYSYSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNG 480

Query: 481 IFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAV 540
           IFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAV
Sbjct: 481 IFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAV 540

Query: 541 DYDSGLNLVSDESDNEDLGKLGDEINDTLEPEFQEVASEENDLATDGFEDDQPDGFLLTR 600
           DYDSGLNLVSDESDNEDLGKLGDEINDTLEPEFQEVASEENDLATDGFEDDQPDGFLLTR
Sbjct: 541 DYDSGLNLVSDESDNEDLGKLGDEINDTLEPEFQEVASEENDLATDGFEDDQPDGFLLTR 600

Query: 601 DRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCI 660
           DRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCI
Sbjct: 601 DRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCI 660

Query: 661 PNNSDERARFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYL 720
           PNNSDERARFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYL
Sbjct: 661 PNNSDERARFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYL 720

Query: 721 ELTFEMKCADYLLCLSQQSPENDMIDSILSKGQDISEQFLQNRAISDDTREIFKAKFDEI 780
           ELTFEMKCADYLLCLSQQSPENDMIDSILSKGQDISEQFLQNRAISDDTREIFKAKFDEI
Sbjct: 721 ELTFEMKCADYLLCLSQQSPENDMIDSILSKGQDISEQFLQNRAISDDTREIFKAKFDEI 780

Query: 781 SPLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAM 840
           SPLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAM
Sbjct: 781 SPLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAM 840

Query: 841 VTTLMENESYNPREKEPAY 859
           VTTLMENESYNPREKEPAY
Sbjct: 841 VTTLMENESYNPREKEPAY 859

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/611 (50%), Positives = 420/611 (68%), Gaps = 21/611 (3%)

Query: 246 VYYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKWLLQSDNSILLSQDGCAVLRVNPNW 305
            +YP   +SKH+ + K NP+  ++Y ++GYPLPH W  QS+NS+L+S DG   LR NPNW
Sbjct: 195 AFYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLVSTDGFTNLRPNPNW 254

Query: 306 HALSSYGRASPIMNSRLRVNINSKKKQQWATTWANNGVNHTKCAIFYFEIRVLSVTSSQA 365
              S Y   SPI+N+RLR ++N++K QQWA+TWAN  +NH K AIFY+EI+VLSVTS+Q+
Sbjct: 255 QLYSGYDN-SPIVNNRLRTSVNNQK-QQWASTWANACINHKKVAIFYYEIKVLSVTSAQS 312

Query: 366 GRNSHVLVGFKNWAKIND---KLSTSEQDTTESG--SAPSSENFNMLRNVLDGNRNVLNS 420
           G+  ++ +GFK+W+K+     + +TS+  + + G  SA + +  N+LR   +G+R     
Sbjct: 313 GQTCNINIGFKDWSKVASNAGEANTSDPPSRDPGEFSALNRQTSNILRGPFEGSR----- 367

Query: 421 PSSPSQTIHGDVETYSYSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNG 480
           P+S   +   DV  Y Y+G DG   D S  + YS+P+G DD++GCG+N+++G+IFFTKNG
Sbjct: 368 PTSQQSSTGKDV--YIYNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTIFFTKNG 425

Query: 481 IFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAV 540
           I LG AF+D   +DLVP+VS+K  NS+RTNFGL EEFLFDI  YQ  WK K Y +IF A+
Sbjct: 426 IHLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYHNIFTAI 485

Query: 541 D--YDSGLNLVSDESDNEDLGKLGD---EINDTLEPEFQEVASEENDLATDGFEDDQPDG 595
               +S      D+   E+ G   D   ++NDT     Q+     N       ++   DG
Sbjct: 486 SGGEESDFGFEDDDESEENAGDHLDADVQMNDTNAGVGQDYDDINNSTLERNQQESHTDG 545

Query: 596 FLLTRDRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDL 655
           FLL+ D RFSG +L+KP   K+NNI+  +DSIPC LN+MINDYLIH G IDVAKGFLKDL
Sbjct: 546 FLLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLNTMINDYLIHHGLIDVAKGFLKDL 605

Query: 656 QRDCIPNNSDERARFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGL 715
           Q+DCIPNN++ER R VIRH+ERQI +EE+NL++RQ IR  I DG+I +C+ YI+ +FPGL
Sbjct: 606 QKDCIPNNNEERTRSVIRHHERQIKREEENLKIRQDIRLLIKDGDIPRCIKYIDSKFPGL 665

Query: 716 LEKYLELTFEMKCADYLLCLSQQSPENDMIDSILSKGQDISEQFLQNRAISDDTREIFKA 775
           L K++EL FE K A+YLL + +   E   ID +L KG +IS +F+ N  +S + R+ FKA
Sbjct: 666 LTKHVELAFEFKVAEYLLAIMKL--EQVTIDYVLQKGLEISNEFIYNEKLSQELRQKFKA 723

Query: 776 KFDEISPLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIG 835
            F +IS LMAY NP  EC  + + +LTP+YLQ+RLFQ +N+ IL +L KKS+SSLE+MI 
Sbjct: 724 HFGDISALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILMFLKKKSESSLENMIS 783

Query: 836 YTRAMVTTLME 846
           YTRAMV TLME
Sbjct: 784 YTRAMVNTLME 794

 Score =  110 bits (276), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/108 (54%), Positives = 82/108 (75%), Gaps = 3/108 (2%)

Query: 6   MDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSGSVSFQ 65
           MD IDH+Y+ ++FP YLL+QP+ ++LWKLY+QHKKLF+KLK K  ++    + + +   +
Sbjct: 5   MDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHKKLFNKLKLKRRVI---PNYTENGETE 61

Query: 66  SLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFYA 113
             +   +L+ ATRK IWEKLSQLGVLG IPYDS +D+YL+QV+KYFY 
Sbjct: 62  LYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYT 109

>Kwal_47.19173
          Length = 836

 Score =  507 bits (1305), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 271/606 (44%), Positives = 381/606 (62%), Gaps = 34/606 (5%)

Query: 247 YYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKWLLQ-SDNSILLSQDGCAVLRVNPNW 305
           Y+    +     +L+ N V  E+YKTLGYPLPH W  Q ++N++++S DGC+ L+ NP  
Sbjct: 230 YFSPLTDGVQNAKLQKNYVSTELYKTLGYPLPHSWDSQFNNNNMVVSADGCSQLKPNPVL 289

Query: 306 HALSSYGRASPIMNSRLRVNINS-KKKQQWATTWANNGVNHTKCAIFYFEIRVLSVTSSQ 364
             L    R   ++ S   V+ +S   K ++ +T ANN ++  K AIFY+EIR+LSVTSSQ
Sbjct: 290 EGLPR--RGDSVVGSGFSVSYSSYSAKFEYVSTKANNFISSKKMAIFYYEIRILSVTSSQ 347

Query: 365 AGRNSHVLVGFKNWAKINDKLSTSEQDTTESGSAPSSEN---FNMLRNVLDGNRNVLNSP 421
           +G N  + VGFK+ A+     S S   T    S P S N    NM+R   D + +  +  
Sbjct: 348 SGTNCSIKVGFKDVARFQAG-SASSSRTDLQRSDPVSINRQSANMMRAAGDSSSSSNSGK 406

Query: 422 SSPSQTIHGDVETYSYSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNGI 481
           S       G   ++ Y G DG   D +  + Y + +G +D++GCGVN+++G+IFFTKNG+
Sbjct: 407 SRGDGFDKG---SFGYCGQDGYITDGTQYKIYGKQYGRNDVIGCGVNYVDGTIFFTKNGL 463

Query: 482 FLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAVD 541
            LG AF D +D+DL PF+++K GN +RTNFGL EEF+FDI  YQ   K K Y HI+K+VD
Sbjct: 464 HLGTAFTDVYDVDLAPFIALKPGNMVRTNFGLHEEFVFDILSYQRMLKSKAYQHIYKSVD 523

Query: 542 YDSGLN-LVSDESDNEDLGKLGDEINDTLEPEFQEVASEENDLATDGFEDDQPDGFLLTR 600
              G N   S++ D  D                +E  S      T     D+  GF+L  
Sbjct: 524 GHDGCNDFDSNDHDEND----------------EECESSSGSDTTP----DKSAGFVLQS 563

Query: 601 DRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCI 660
           D RFSGDKL++P   KLNN++++N+S  C +N+MINDYLIHEG IDVAKGFLKDLQ+DCI
Sbjct: 564 DDRFSGDKLYRPEVEKLNNLSTDNESFSCTMNTMINDYLIHEGLIDVAKGFLKDLQKDCI 623

Query: 661 PNNSDERARFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYL 720
           P N  + +R VIRHNERQI+KEE NL+VRQ IRR+I++G+I +C+ +I+  +PGL EK +
Sbjct: 624 PGNDKDLSRMVIRHNERQIIKEENNLKVRQDIRRFINEGDITRCITFIDDLYPGLFEKNI 683

Query: 721 ELTFEMKCADYLLCLSQQSPENDMIDSILSKGQDISEQFLQNRAISDDTREIFKAKFDEI 780
           +L FE+K A+YLL        +  ID IL KGQ ++ +F+ +  +  D ++ F+    +I
Sbjct: 684 DLLFELKVAEYLLVFVNFKSHS--IDDILLKGQKLTAEFVYDSQVPQDYKQGFQNHLSDI 741

Query: 781 SPLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAM 840
           S L+AY NP  EC+ D +  LTPAYLQ+RLFQ +NS +L +L+KKS+SSLE+M+ YTR M
Sbjct: 742 SALLAYDNPLTECSEDLAELLTPAYLQDRLFQLVNSRVLSFLEKKSESSLENMVSYTRGM 801

Query: 841 VTTLME 846
           +  LME
Sbjct: 802 IDALME 807

 Score =  121 bits (303), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (71%), Gaps = 6/107 (5%)

Query: 6   MDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSGSVSFQ 65
           MD +D  Y+ ++FP YLL+QPIGH+LWK+Y  ++KLFHKLK K + + A+   SG    +
Sbjct: 5   MDRVDRAYVRALFPAYLLEQPIGHELWKIYLHNRKLFHKLKNKGQNV-ANVKESGIPKHK 63

Query: 66  SLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFY 112
           S      LS ATRKEIWEKL  +GVLGTIP+ +V DDYL+QV+ YFY
Sbjct: 64  S-----ELSYATRKEIWEKLMSMGVLGTIPFTAVEDDYLMQVYHYFY 105

>YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulates
           expression of genes that are involved in nitrogen
           metabolism [2877 bp, 958 aa]
          Length = 958

 Score =  432 bits (1110), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 248/629 (39%), Positives = 375/629 (59%), Gaps = 41/629 (6%)

Query: 261 KSNPVPGEIYKTLGYPLPHKWLLQSDNSILLSQDGCAVLRVNPNWHALSSYGRASPI--- 317
           K N +  +IYK LGY LP +W  Q +NS+ LSQDG   L+ NP++H+  +Y R+S     
Sbjct: 309 KKNSMIPDIYKILGYFLPSRWQAQPNNSLQLSQDGITHLQPNPDYHSYMTYERSSASSAS 368

Query: 318 MNSRLRVNINSKKKQQWATTWANNGVNHTKCAIFYFEIRVLSVTSSQAGRNSHVLVGFKN 377
             +RLR +  +  K  +A TWAN  +   K  IFY+EI+VLSVTS+++  NS++++G+K 
Sbjct: 369 TRNRLRTSFENSGKVDFAVTWANKSLPDNKLTIFYYEIKVLSVTSTESAENSNIVIGYK- 427

Query: 378 WAKINDKLSTSEQDTTESGSAPSSENFNMLRNVLDGNRNVLNS----------------P 421
               N+ +  + + +    S   S +     N +  NR    S                 
Sbjct: 428 -LVENELMEATTKKSVSRSSVAGSSSSLGGSNNMSSNRVPSTSFTMEGTQRRDYIYEGGV 486

Query: 422 SSPSQTIHG----------DVETYSYSGLDGNKFDAS-GSQKYSRPFGNDDIVGCGVNFI 470
           S+ S  + G          D+  + Y G DG   +++  S++Y++PFG DD++GCG+NFI
Sbjct: 487 SAMSLNVDGSINKCQKYGFDLNVFGYCGFDGLITNSTEQSKEYAKPFGRDDVIGCGINFI 546

Query: 471 EGSIFFTKNGIFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKY 530
           +GSIFFTKNGI LGNAF D  D++ VP+V+++ GNS++TNFGL E+F+FDI  YQ +WK 
Sbjct: 547 DGSIFFTKNGIHLGNAFTDLNDLEFVPYVALRPGNSIKTNFGLNEDFVFDIIGYQDKWKS 606

Query: 531 KTYSHIFKAVDYDSGLNLVSDESDNEDLGKLGDEIN-------DTLEPEFQEVASEENDL 583
             Y HI +    D  +     +   ED  + G E N       D ++ + ++ A+   D 
Sbjct: 607 LAYEHICRGRQMDVSIEEFDSDESEEDETENGPEENKSTNVNEDLMDIDQEDGAAGNKDT 666

Query: 584 ATDGFEDDQPDGFLLTRDRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEG 643
                E D    FLL  D RF   KL +P    +NN++ ++ S+P  LN MINDYLIHEG
Sbjct: 667 KKLNDEKDNNLKFLLGEDNRFIDGKLVRPDVNNINNLSVDDGSLPNTLNVMINDYLIHEG 726

Query: 644 YIDVAKGFLKDLQRDCI-PNNSDERARFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEIL 702
            +DVAKGFLKDLQ+D +  N     ++ VIRHNERQI+KEE+ +++RQ +R  I+ G+I 
Sbjct: 727 LVDVAKGFLKDLQKDAVNVNGQHSESKDVIRHNERQIMKEERMVKIRQELRYLINKGQIS 786

Query: 703 KCMNYIEQQFPGLLEKYLELTFEMKCADYLLCLSQQSP-ENDMIDSILSKGQDISEQFLQ 761
           KC+NYI+ + P LL+  LEL FE+K A+YL+ + + S  ++D I++++ KGQ++S +F+ 
Sbjct: 787 KCINYIDNEIPDLLKNNLELVFELKLANYLVMIKKSSSKDDDEIENLILKGQELSNEFIY 846

Query: 762 NRAISDDTREIFKAKFDEISPLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQY 821
           +  I    R+ F  +   +S L+AYSNP  E   + S +L+  YLQERLFQ  N+ IL +
Sbjct: 847 DTKIPQSLRDRFSGQLSNVSALLAYSNPLVEAPKEISGYLSDEYLQERLFQVSNNTILTF 906

Query: 822 LDKKSQSSLESMIGYTRAMVTTLMENESY 850
           L K S+ +LE++I  TRAM++TL+E  ++
Sbjct: 907 LHKDSECALENVISNTRAMLSTLLEYNAF 935

 Score =  123 bits (309), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 80/107 (74%), Gaps = 6/107 (5%)

Query: 6   MDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSGSVSFQ 65
           MD +D E++  +FP YLL+QP+ +DLW LY QH+KLFHKLK  + L++AD + +G    +
Sbjct: 5   MDDVDREFINCLFPSYLLQQPVAYDLWILYLQHRKLFHKLKNTN-LINADENPTGVGMGR 63

Query: 66  SLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFY 112
           +     +L+A TRKEIW KL  LGVLGTI +++V+DDYLIQV+KYFY
Sbjct: 64  T-----KLTALTRKEIWSKLMNLGVLGTISFEAVNDDYLIQVYKYFY 105

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score =  419 bits (1077), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 241/678 (35%), Positives = 376/678 (55%), Gaps = 79/678 (11%)

Query: 216 TTGFENPIGTSDAENIENAEVDRSKHKHKIV-----YYPESKESKHTVQLKSNPVPGEIY 270
           TT   + IG+SD        + R  H +         YP     K+  + K+N     +Y
Sbjct: 252 TTSARDSIGSSD-------RLSRRAHSYSAKDNASRLYPALNTQKYMSKKKNNSTTPNVY 304

Query: 271 KTLGYPLPHKWLLQSDNSILLSQDGCAVLRVNPNWHALSSYGRASPIMNSRLRVNINSKK 330
             +GY LP +W+ + +NSIL+S DG   LR NPNW    S  R      +RLR  + S +
Sbjct: 305 NLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQPFISNDRGDIFARNRLRNALTSSQ 364

Query: 331 KQQWATTWANNGVNHTKCAIFYFEIRVLSVTSSQAGRNSHVLVGFKNWAKINDKLSTSEQ 390
           K ++ TT+A+  V++ K AIFY+E+RVL VTSS++  NS+++VG+K     +D++   + 
Sbjct: 365 KTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSAHNSNIVVGYKIANDSDDEIDLEKI 424

Query: 391 DTTESGSAPSSENFNMLRNVLDGNRNVLNSPSSPSQTIHGDVETYS-------------- 436
           D              +++N   G+ N L   +    T+ G  ++ +              
Sbjct: 425 DEKAL--------LELVKNFGAGDNNELGGLADIGGTLMGRADSTATDPAPGLAKKNTLD 476

Query: 437 -----YSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNGIFLGNAFEDCF 491
                Y GL GN    S  + YS+P+G DD++GCG+N++ GS+FFTKNG+FLG A     
Sbjct: 477 ETFVGYCGLSGNISITSKEKPYSKPYGRDDVIGCGINYVNGSVFFTKNGVFLGEAVSSLM 536

Query: 492 DIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAV----DYDSGLN 547
           +++ +P++++KSGNS+RTNFGL EEF+FDI+QYQ  WK   Y +IFKA      +    N
Sbjct: 537 NVNAIPYIALKSGNSVRTNFGLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKN 596

Query: 548 LVSDESDNEDLGKLGDEINDTLEPEFQEVASEENDLATDGFEDDQPDGFLLTRDRRFSGD 607
            + DES  E    + D+ +++     Q+                   G +L +D R S +
Sbjct: 597 TLIDESQME----IDDDADESQLSLLQK-------------------GLILGKDNRISEN 633

Query: 608 KLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCIPNNSDER 667
            + KP    LN +N+ + S+   LN MINDYLIHEG IDVAKGFLKDLQ+  + N  D +
Sbjct: 634 MVLKPDDLLLNTLNTQDGSMISNLNVMINDYLIHEGLIDVAKGFLKDLQKFSLTNPYDNQ 693

Query: 668 A----RFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYLELT 723
                R +I+HNE QI++EE  L++RQ +R+ I+  EI KC+ ++  + P LL   +EL 
Sbjct: 694 IQIEEREIIKHNESQIIREENVLRIRQELRKLINQREIEKCITFLNDKIPDLLGNNVELH 753

Query: 724 FEMKCADYLLCLSQQSPENDMIDS--ILSKGQDISEQFLQNRAISDDTREIFKAKFDEIS 781
           FE++   YL+ LS  SP+   IDS  ++  GQ++S +F+ N  I  + R+ F+ +   +S
Sbjct: 754 FELRVVQYLIQLS-NSPK---IDSNILIEAGQNLSREFVFNNTIPQELRDKFQDQLSNVS 809

Query: 782 PLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAMV 841
            L+ Y +P  E  ++ S++ +P YLQ+RLFQ  NS IL+++ K S+ +L++++ Y+RAM 
Sbjct: 810 SLLVYEDPLTEAPDELSYYFSPEYLQDRLFQLTNSTILKHMKKSSECALDNIVSYSRAMS 869

Query: 842 TTLMENESYNPREKEPAY 859
            TL+   + N + K   Y
Sbjct: 870 LTLL---NLNAKGKATVY 884

 Score = 98.6 bits (244), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%), Gaps = 4/108 (3%)

Query: 6   MDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSGSVSFQ 65
           +D +D E++ S+FP+YLL+QP+ +DL  +Y ++KK+F   KT     S D D +G ++  
Sbjct: 5   LDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIF--CKTPYFHHSKDEDRNGLLTSS 62

Query: 66  SLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFYA 113
            L  P +LS  T+KEIW+KL  LGVLGT+ +D+ +D+YL+Q +KYFY+
Sbjct: 63  IL--PPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYS 108

>Scas_712.23
          Length = 973

 Score =  337 bits (864), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/421 (42%), Positives = 257/421 (61%), Gaps = 46/421 (10%)

Query: 435 YSYSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNGIFLGNAFEDCFDID 494
           + Y G DG     + S+KYS+ FG DDI+GCG+N+I+G+IFFTKNG+FLG AF + +D++
Sbjct: 558 FGYCGDDGFICVGTESKKYSQMFGRDDIIGCGINYIDGTIFFTKNGVFLGTAFTNVYDLN 617

Query: 495 LVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAVDYDSGLNLVSDESD 554
           +VP +++K GNS+RTNFG+ EEF+FDI  YQ  WK K+ + IFK++DYD          D
Sbjct: 618 VVPSIALKPGNSVRTNFGIYEEFVFDIGNYQNNWKNKSLNKIFKSLDYDF---------D 668

Query: 555 NEDLGKLGDEINDTLEPEFQEVASEENDLATDGFEDDQPDGFLLTRDRRFSGDKLWKPTT 614
            +D                            +  E++Q   FLL +D R     + KP +
Sbjct: 669 CKD---------------------------GNTTENNQKASFLLGKDDRIDDMNIKKPNS 701

Query: 615 PKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCIPNNSDERA------ 668
            +LN++N NNDSIP  LN MINDYL+HEG +D+AK FLKDL+ DCI ++  +        
Sbjct: 702 IRLNDLNVNNDSIPNTLNVMINDYLLHEGMVDLAKSFLKDLRNDCIEDDIGDNVGNANMN 761

Query: 669 --RFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYLELTFEM 726
             + VI +N++QI KEE  + +RQ IRR + +  I +C+ +I  Q PGLLE  +EL FEM
Sbjct: 762 DMKQVIDYNDKQIQKEETLVYIRQEIRRLVLERNIEECIKWINLQLPGLLESDMELLFEM 821

Query: 727 KCADYLLCLSQQSPEND--MIDSILSKGQDISEQFLQNRAISDDTREIFKAKFDEISPLM 784
           K   YL+ + + S   D   I+ +L  GQ +  QF+ N  I    RE F+ + + +S L+
Sbjct: 822 KLCQYLITIIESSKTKDDKCINDLLRTGQGLYNQFVYNEQIDGALRESFQFQLNNVSSLL 881

Query: 785 AYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAMVTTL 844
           AY +P  E   D S +++  YL+ RLFQ INS +LQ+L+K+S  SLE M+ YTRAM++T+
Sbjct: 882 AYDDPINEVTGDLSIYVSNEYLEGRLFQIINSKVLQFLNKRSDCSLEDMVVYTRAMLSTM 941

Query: 845 M 845
           M
Sbjct: 942 M 942

 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 75/121 (61%), Gaps = 15/121 (12%)

Query: 7   DLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSG------ 60
           D ID +++ S++P+YLL QPI ++L  LY QH+KLF KL   + L  ++   SG      
Sbjct: 6   DQIDRQFIKSLYPEYLLHQPIAYELKALYNQHRKLFSKLSESEHLDPSNRPKSGLSKGAE 65

Query: 61  -------SVSFQSLKTP--NRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYF 111
                  +VS +S  T   ++L    +KEIW KL +LGVLGTI ++S +D+YLIQV+K F
Sbjct: 66  HFDETYRNVSIESSNTSGGDKLPFHIKKEIWHKLMELGVLGTISFESANDNYLIQVYKLF 125

Query: 112 Y 112
           Y
Sbjct: 126 Y 126

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 84/144 (58%), Gaps = 12/144 (8%)

Query: 245 IVYYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKWLLQSDNSILLSQDGCAVLRVNPN 304
           + +Y  S   +  ++LK N V  +IY+ +GY LP++W    +NS+ ++ DG   L  NPN
Sbjct: 284 VKFYSYSGSHEKPLKLKKNGVAPDIYRIIGYFLPNQWNPPPNNSLSVTSDGVMNLAPNPN 343

Query: 305 WHAL----SSYGRASP--IMNSRLRVNI------NSKKKQQWATTWANNGVNHTKCAIFY 352
           +       S+ G  +P  I+ +RLR  I       ++ K  + T  ANN +  +K +IFY
Sbjct: 344 YQKTVTEESTTGSGTPASIVRNRLRNTITGNLQSGNRSKSDYLTACANNVIPSSKVSIFY 403

Query: 353 FEIRVLSVTSSQAGRNSHVLVGFK 376
           +EIRVL+VTSS   +NS+++VGFK
Sbjct: 404 YEIRVLTVTSSLNAQNSNIIVGFK 427

>Scas_669.10
          Length = 585

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 62/150 (41%), Gaps = 32/150 (21%)

Query: 419 NSPS----SPSQTIHGDVET--YSYSGLDGN-----KFDASGSQKYSRPFGND------- 460
           NSP     SP++ I   + T  Y Y  L G       +D++G+++++  F  D       
Sbjct: 261 NSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNGARRFNDSFPLDPELANLF 320

Query: 461 ------DIVGCGVNFIEGSIFFTKNG-----IFLGNAFEDCFDIDLVPFVSIKSGNSLRT 509
                 DI+G G     G+ FFT+NG       +G   + C    L P V       +  
Sbjct: 321 PVCERGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHV 380

Query: 510 NFGLTEEFLFDIDQYQLQWKYKTYSHIFKA 539
           NFG T  F++ I+    +W Y   SH  K 
Sbjct: 381 NFG-TYGFVY-IEANVKKWGYAK-SHGLKV 407

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 461 DIVGCGVNFIEGSIFFTKNGIFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEFLFD 520
           D+VG G  +  G++F T NG  + +   +   IDL  FV I + N+  T     E  L D
Sbjct: 228 DVVGLGYRYRTGTVFITHNGKKMMDLTHN-IGIDL--FVGIGAMNAAYTRTYTKEGLLDD 284

Query: 521 IDQYQLQ 527
           ID  +L+
Sbjct: 285 IDNVELR 291

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 12/87 (13%)

Query: 445 FDASGSQKYSRPFGND---------DIVGCGVNFIEGSIFFTKNGIFLGNAFEDCFDIDL 495
           ++++G  + S PF  +         D+VG G  F  G+IF T NG  L +  E+   +DL
Sbjct: 267 YESTGKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENI-GVDL 325

Query: 496 VPFVSIKSGNSLRTNFGLTEEFLFDID 522
             F+ + + N+  T     E  L D D
Sbjct: 326 --FIGLGAMNACYTKSYTLEGLLADPD 350

>Kwal_33.13461
          Length = 2197

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 270 YKTLGYPLPHKWLLQSDNSILLSQDG 295
           Y+TL  PL H++ ++SDNSI    DG
Sbjct: 907 YQTLVDPLKHRYEIESDNSIFFEVDG 932

>Scas_712.5
          Length = 1122

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 620 INSNNDSIPCQL--NSMINDYLIHEG---YIDVAKGFLKDLQRDCIPNNSDERARFVIRH 674
           I+ N+ S  C    N+M   Y++ E    YI+ AK +L   +   + +NS+E +   +RH
Sbjct: 550 ISENDKSFSCTPYGNAMARHYILFETIKRYIN-AKNYLSLQEILTLLSNSNEFSEIKMRH 608

Query: 675 NERQIVKE 682
           NE+++ KE
Sbjct: 609 NEKRLFKE 616

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,507,107
Number of extensions: 1416813
Number of successful extensions: 5270
Number of sequences better than 10.0: 56
Number of HSP's gapped: 5454
Number of HSP's successfully gapped: 64
Length of query: 859
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 749
Effective length of database: 12,788,129
Effective search space: 9578308621
Effective search space used: 9578308621
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)