Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01199g44944222190.0
Sklu_2433.1944944220810.0
Kwal_47.1918044944220480.0
AFR243C44944220360.0
Scas_687.2144944220340.0
YER043C (SAH1)44944220300.0
CAGL0C02189g44944219860.0
YKL060C (FBA1)35974760.23
KLLA0E19723g2141174682.7
CAGL0M12837g46691664.0
YAL060W (BDH1)38294655.4
Sklu_2427.638535656.0
Scas_701.20469122646.9
YCR045C491167647.8
Sklu_2438.247093648.0
AFR675W353132638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01199g
         (442 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01199g 111159..112508 highly similar to sp|P39954 Saccharo...   859   0.0  
Sklu_2433.19 YER043C, Contig c2433 31749-33098                        806   0.0  
Kwal_47.19180                                                         793   0.0  
AFR243C [3435] [Homologous to ScYER043C (SAH1) - SH] (876308..87...   788   0.0  
Scas_687.21                                                           788   0.0  
YER043C (SAH1) [1469] chr5 complement(235769..237118) Adenosylho...   786   0.0  
CAGL0C02189g 222418..223767 highly similar to sp|P39954 Saccharo...   769   0.0  
YKL060C (FBA1) [3199] chr11 complement(326053..327132) Fructose-...    34   0.23 
KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680 Saccha...    31   2.7  
CAGL0M12837g 1265948..1267348 highly similar to sp|P40510 Saccha...    30   4.0  
YAL060W (BDH1) [10] chr1 (35156..36304) Stereospecific (2R, 3R)-...    30   5.4  
Sklu_2427.6 YAL061W, Contig c2427 11975-13132 reverse complement       30   6.0  
Scas_701.20                                                            29   6.9  
YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member o...    29   7.8  
Sklu_2438.2 YER081W, Contig c2438 2568-3980                            29   8.0  
AFR675W [3868] [Homologous to ScYNL274C - SH] complement(1683504...    29   8.6  

>KLLA0A01199g 111159..112508 highly similar to sp|P39954
           Saccharomyces cerevisiae YER043c SAH1
           S-adenosyl-L-homocysteine hydrolase singleton, start by
           similarity
          Length = 449

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/442 (94%), Positives = 419/442 (94%)

Query: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60
           MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180
           AF                TSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA
Sbjct: 121 AFKDDKKLNLILDDGGDLTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240
           INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420
           MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG
Sbjct: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420

Query: 421 VKLTKLSDVQSEYLGIPEEGPY 442
           VKLTKLSDVQSEYLGIPEEGPY
Sbjct: 421 VKLTKLSDVQSEYLGIPEEGPY 442

>Sklu_2433.19 YER043C, Contig c2433 31749-33098
          Length = 449

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/442 (88%), Positives = 402/442 (90%)

Query: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60
           MSAPA NYK+ADISLAAFGRKEIELAEHEMPGL+AIREAY   QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIREAYAEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180
           AF                TSLVH+K+P+ML DCFG+SEETTTGVHHLYRMVKE KLKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTSLVHEKHPEMLEDCFGISEETTTGVHHLYRMVKEAKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240
           INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRG GA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300
           RV+VTEIDPINALQAAMEGYQVIPMEEA S GQVFVTTTGCRDIIT EHFL MPEDAIVC
Sbjct: 241 RVVVTEIDPINALQAAMEGYQVIPMEEAASFGQVFVTTTGCRDIITSEHFLSMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E INIKPQVDRYLL SGKHVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420
           MSCSFSNQVLAQIALFKA DK FREKYIEFQKTGPF++GVHVLPKILDEAVAKFHLD LG
Sbjct: 361 MSCSFSNQVLAQIALFKANDKEFREKYIEFQKTGPFELGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTKLSDVQSEYLGIPEEGPY 442
           VKLT+LSDVQSEYLGIP+EGPY
Sbjct: 421 VKLTQLSDVQSEYLGIPQEGPY 442

>Kwal_47.19180
          Length = 449

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/442 (86%), Positives = 401/442 (90%)

Query: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60
           MS+PA N KVADISLAAFGRKEIELAEHEMPGL+AIREAYG  QPLKGARIAGCLHMTIQ
Sbjct: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180
           AF                T+LVH+K+P+ML DCFGLSEETTTGVHHLYRMVK+ KLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTTLVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240
           INVND+VTKSKFDNLYGCRESLIDGIKRATDVMLAGKV+VVAGYGDVGKGCAAALRG G+
Sbjct: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240

Query: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQV PMEEAVS GQVFVTTTGCRDIIT EHF+ MPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E +NIKPQVDR+LLPSGKHVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420
           MSCSFSNQVLAQIALFKA D  FR+KYIEFQKTGPF+IGVHVLPKILDEAVAKFHL  LG
Sbjct: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420

Query: 421 VKLTKLSDVQSEYLGIPEEGPY 442
           V+LTKLS+VQSEYLGIPEEGPY
Sbjct: 421 VRLTKLSEVQSEYLGIPEEGPY 442

>AFR243C [3435] [Homologous to ScYER043C (SAH1) - SH]
           (876308..877657) [1350 bp, 449 aa]
          Length = 449

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/442 (85%), Positives = 398/442 (90%)

Query: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60
           MS PA NYKVAD+SLAAFGRKEIEL+EHEMPGL+AIR+AYG  QPLKGARIAGCLHMTIQ
Sbjct: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180
           AF                T+LVH+KYP+ML DCFG+SEETTTGVHHLYRM+KE KLKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240
           INVNDSVTKSKFDNLYGCRESL+DG+KRATDVMLAGKVAVVAGYGDVGKGCAAALRG GA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQV  M++  S GQVFVTTTGCRDII KEHFL MPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E +NIKPQVDRYLL SG+HVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420
           MSCSFSNQVLAQIALFKA D+AFR+KYIEFQKTGPFDIGVHVLPKILDEAVAKFHLD LG
Sbjct: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTKLSDVQSEYLGIPEEGPY 442
           VKLTKLS  QSEYLGIPEEGP+
Sbjct: 421 VKLTKLSSTQSEYLGIPEEGPF 442

>Scas_687.21
          Length = 449

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/442 (85%), Positives = 398/442 (90%)

Query: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60
           MSAPA NYKVADISLAAFGRKEIELAEHEMPGL+AIR+AY   QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKVADISLAAFGRKEIELAEHEMPGLMAIRKAYAGVQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAASAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180
           AF                TSLVHDK+P+ML DCFGLSEETTTGVH+LY+MVKEN+LKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTSLVHDKHPEMLDDCFGLSEETTTGVHYLYKMVKENRLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240
           INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRG GA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300
           RVIVTE+DPINALQAAMEGYQV  ME A + GQ+FVTTTGCRDIIT  HF  MPEDAIVC
Sbjct: 241 RVIVTEVDPINALQAAMEGYQVDTMESASNIGQIFVTTTGCRDIITGAHFANMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E INIKPQVDRYLLP+G+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLPTGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420
           MSCSFSNQVLAQIALFKA DKAFREK+IEFQKTGPF +GVHVLPKILDEAVAKFHLD LG
Sbjct: 361 MSCSFSNQVLAQIALFKADDKAFREKHIEFQKTGPFTVGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTKLSDVQSEYLGIPEEGPY 442
           V+LTKLSD QSEYLG+P+EGPY
Sbjct: 421 VQLTKLSDTQSEYLGVPQEGPY 442

>YER043C (SAH1) [1469] chr5 complement(235769..237118)
           Adenosylhomocysteinase (S-adenosylhomocysteine
           hydrolase) [1350 bp, 449 aa]
          Length = 449

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/442 (85%), Positives = 400/442 (90%)

Query: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60
           MSAPA NYK+ADISLAAFGRKEIELAEHEMPGL+AIR+AYG  QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180
           AF                T+LVH+K+P+ML DCFGLSEETTTGVHHLYRMVKE KLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTTLVHEKHPEMLEDCFGLSEETTTGVHHLYRMVKEGKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240
           INVNDSVTKSKFDNLYGCRESL+DGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRG GA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300
           RV+VTEIDPINALQAAMEGYQV+ ME+A   GQVFVTTTGCRDII  EHF+ MPEDAIVC
Sbjct: 241 RVLVTEIDPINALQAAMEGYQVVTMEDASHIGQVFVTTTGCRDIINGEHFINMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E INIKPQVDRYLL SG+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420
           MSCSFSNQVLAQIALFK+ DK+FREK+IEFQKTGPF++GVHVLPKILDEAVAKFHL NLG
Sbjct: 361 MSCSFSNQVLAQIALFKSNDKSFREKHIEFQKTGPFEVGVHVLPKILDEAVAKFHLGNLG 420

Query: 421 VKLTKLSDVQSEYLGIPEEGPY 442
           V+LTKLS VQSEYLGIPEEGP+
Sbjct: 421 VRLTKLSKVQSEYLGIPEEGPF 442

>CAGL0C02189g 222418..223767 highly similar to sp|P39954
           Saccharomyces cerevisiae YER043c SAH1, start by
           similarity
          Length = 449

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/442 (82%), Positives = 396/442 (89%)

Query: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60
           MSAPA NYK+ADISLAAFGRKEIELAE+EMPGL+AIR+AY   QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYMWCIEQQLF 120

Query: 121 AFXXXXXXXXXXXXXXXXTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180
           AF                TS VH+KYP+ML DCFGLSEETTTGVHHLYRM++E KLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180

Query: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240
           INVND+VTKSKFDNLYGCRESL+DGIKRATDVMLAGKVAVVAG+GDVGKGCAA+LRG GA
Sbjct: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300
           RV+VTEIDPINALQAAMEGY+V  ME+A S GQVFVTTTGCRDII  EHF +MPEDAIVC
Sbjct: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NA E INIKPQVDRYLL SG+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420
           MSCSFSNQVLAQIALFK+ DKAFR K++EF+KTGPF++GVHVLPKILDEAVAKFHL+ LG
Sbjct: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420

Query: 421 VKLTKLSDVQSEYLGIPEEGPY 442
           VKLT LSDVQSEYLGIP++GP+
Sbjct: 421 VKLTTLSDVQSEYLGIPQQGPF 442

>YKL060C (FBA1) [3199] chr11 complement(326053..327132)
           Fructose-bisphosphate aldolase II, catalyzes cleavage or
           condensation of fructose-1,6-bisphosphate into
           dihydroxyacetonephosphate and glyceraldehyde-3-phosphate
           at the sixth step in glycolysis [1080 bp, 359 aa]
          Length = 359

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 164 VHHLYRMVKENKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAG 223
           VH+L+   KE+K  +PAINV  S T      L   R+S    I + ++    G  A  AG
Sbjct: 19  VHNLFTYAKEHKFAIPAINVTSSST--AVAALEAARDSKSPIILQTSN----GGAAYFAG 72

Query: 224 YGDVGKGCAAALRG 237
            G   +G  A+++G
Sbjct: 73  KGISNEGQNASIKG 86

>KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680
            Saccharomyces cerevisiae YDL171c GLT1 glutamate synthase
            (NAPDPH) (GOGAT) singleton, start by similarity
          Length = 2141

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 72/174 (41%), Gaps = 41/174 (23%)

Query: 216  GKVAVVAGYGDVGKGCAAALRGFGARVIVTE-IDPINALQAAMEGYQVIPMEEAV----- 269
            GK+  V G G  G  CA  L   G  V+V E  D    L   M G   + +++++     
Sbjct: 1781 GKIVAVIGSGPAGMACADQLNRAGHSVVVYERADRCGGL--LMYGIPNMKLDKSIVQRRL 1838

Query: 270  ----SSGQVFVTTTGC-RDIITKEHFLQMPEDAIVCNIGHF-------------DIEIDV 311
                + G  F+T T   +DI  +E  L+   DAIV  +G               +I+  +
Sbjct: 1839 DLLAAEGVQFITNTEVGKDISVEE--LKSKFDAIVYTVGSTIPRDLRIPGRELKNIDFAM 1896

Query: 312  AWLKANATEVIN-----IKPQVDRYLLPSGKHVILLADGRLVN--LGCATGHSS 358
              LK+N   +++     IK Q+       GK VI++  G   N  LG +  H +
Sbjct: 1897 TLLKSNTQALLDRDLETIKKQI------KGKKVIVIGGGDTGNDCLGTSVRHGA 1944

>CAGL0M12837g 1265948..1267348 highly similar to sp|P40510
           Saccharomyces cerevisiae YIL074c SER33
           3-phosphoglycerate dehydrogenase, hypothetical start
          Length = 466

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 9/91 (9%)

Query: 216 GKVAVVAGYGDVGKGCAAALRGFGARVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVF 275
           GK   V GYG +G   +      G  V+  +I  I AL  A    QV  ++E ++    F
Sbjct: 195 GKTLGVVGYGHIGSQLSVLAESMGMHVLYYDIVTIMALGTAK---QVSTLDELLNKSD-F 250

Query: 276 VT-----TTGCRDIITKEHFLQMPEDAIVCN 301
           VT     T   +++++   F  M + A V N
Sbjct: 251 VTLHVPETPETKNLLSAPQFAAMKDGAYVIN 281

>YAL060W (BDH1) [10] chr1 (35156..36304) Stereospecific (2R,
           3R)-2,3-butanediol dehydrogenase with similarity to
           alcohol/sorbitol dehydrogenases, member of the
           zinc-containing alcohol dehydrogenase family [1149 bp,
           382 aa]
          Length = 382

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 17/94 (18%)

Query: 155 GLSEETTTGVHHLYRMVKENKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVML 214
           G +E+     HH+  + KE  L V A+    SVT              I G K+      
Sbjct: 145 GFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVK---------ISGFKK------ 189

Query: 215 AGKVAVVAGYGDVGKGCAAALRGFGA-RVIVTEI 247
            G  A+V G G +G      L+G GA +++V+EI
Sbjct: 190 -GSSALVLGAGPIGLCTILVLKGMGASKIVVSEI 222

>Sklu_2427.6 YAL061W, Contig c2427 11975-13132 reverse complement
          Length = 385

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 213 MLAGKVAVVAGYGDVGKGCAAALRGFGA-RVIVTE 246
           + AGK A+V G G +G G   AL+ +GA +++V+E
Sbjct: 187 LTAGKSALVVGGGPIGLGTILALQAYGASKIVVSE 221

>Scas_701.20
          Length = 469

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 14/122 (11%)

Query: 216 GKVAVVAGYGDVGKGCAAALRGFGARVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVF 275
           GK   + GYG +G   +      G  VI  +I  + AL  +    QV  ++E ++    F
Sbjct: 198 GKTLGIIGYGHIGSQVSVLAEAMGMHVIYYDIVTVMALGTSK---QVPTLDELLNKAD-F 253

Query: 276 VT-----TTGCRDIITKEHFLQMPEDAIVCNIGH---FDIEIDVAWLKAN--ATEVINIK 325
           VT     T   +++++   F  M + A V N+      DI   +  +K N  A   I++ 
Sbjct: 254 VTLHVPETPETKNMLSAPQFAAMKDGAYVINLSRGTVVDIPSLIQAMKVNKIAGAAIDVY 313

Query: 326 PQ 327
           P 
Sbjct: 314 PN 315

>YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member of
           the subtilase family of serine proteases, has moderate
           similarity to S. pombe Isp6p, which is a putative
           subtilase-type proteinase involved in sexual
           differentiation [1476 bp, 491 aa]
          Length = 491

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 72/167 (43%), Gaps = 24/167 (14%)

Query: 265 MEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDA-IVCNIGHFDIEIDVAWLKANATEVIN 323
           +E A+  G VFV   G  ++   + +   P  A  V  +G FD  ID     +N    +N
Sbjct: 283 VEGAIEEGIVFVAAAGNFNL---DAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVN 339

Query: 324 I-KPQVDRYLLPSGKHV----ILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKA 378
           I  P V+   + S  H+     L+  G  ++    TG ++ ++S     +++AQ   + +
Sbjct: 340 IFAPGVE---IESLSHLNYNDTLILSGTSMSTPIVTGVAAILLSKGIEPEMIAQEIEYLS 396

Query: 379 QDKAFREKYIEFQKTGPFDI---GVHVL---------PKILDEAVAK 413
               F  + + F+ + P  I   GV  L         P++  EA+AK
Sbjct: 397 TRNVFHRRTLFFKPSTPNQILYNGVDKLDDPYDDETFPRLNIEAIAK 443

>Sklu_2438.2 YER081W, Contig c2438 2568-3980
          Length = 470

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 214 LAGKVAVVAGYGDVGKGCAAALRGFGARVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQ 273
           + GK   + GYG +G   +     FG  V+  +I  I AL  A    QV  ++E ++   
Sbjct: 197 IRGKTLGIIGYGHIGAQLSVLAEAFGMHVLYYDIVTIMALGTAK---QVSTLDELLNKSD 253

Query: 274 VFVT-----TTGCRDIITKEHFLQMPEDAIVCN 301
            FV+     T   +++++   F  M + + V N
Sbjct: 254 -FVSCHVPATPETKNLLSAPQFAAMKDGSYVIN 285

>AFR675W [3868] [Homologous to ScYNL274C - SH]
           complement(1683504..1684565) [1062 bp, 353 aa]
          Length = 353

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 55/132 (41%), Gaps = 15/132 (11%)

Query: 215 AGKVAVVAGYGDVGKGCAAALRGFGARVIVTEIDPINALQAAME-GYQVIPMEEAVSSGQ 273
           AGK   V G G +G+     LR FG   I+      N L + +E   + +  EE ++   
Sbjct: 160 AGKTVGVLGMGGIGRAVVQRLRPFGFERIIYHNR--NRLSSELECSCEYVSFEELLAQSD 217

Query: 274 VFVT----TTGCRDIITKEHFLQMPEDAIVCNIGH---FDIEIDVAWLK-----ANATEV 321
           +       ++  R ++  +   +M +  +V N      FD +  +A L+     A   +V
Sbjct: 218 ILSVNVPLSSATRHMLDADAIARMKDGVLVVNTARGPIFDEQALIAALQSGKISAAGLDV 277

Query: 322 INIKPQVDRYLL 333
              +P V + LL
Sbjct: 278 YENEPHVPQALL 289

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,672,652
Number of extensions: 488281
Number of successful extensions: 1095
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1100
Number of HSP's successfully gapped: 20
Length of query: 442
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 337
Effective length of database: 12,961,219
Effective search space: 4367930803
Effective search space used: 4367930803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)