Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01155g99397843710.0
AFR245W89969021180.0
Kwal_47.1919179064221000.0
Sklu_2433.1791470520730.0
YFR040W (SAP155)100266519400.0
CAGL0C02145g77765918990.0
Scas_687.1995668216930.0
Scas_712.2182863516390.0
YGL229C (SAP4)81863513181e-168
KLLA0F14124g11007009721e-114
CAGL0L03586g11235899561e-112
AFR089W10315979281e-109
Scas_711.22*10186088831e-102
YJL098W (SAP185)10586398811e-102
YKR028W (SAP190)10985878467e-97
Kwal_26.73467474937961e-92
Scas_675.365573394123e-42
Kwal_26.7343282731051e-04
CAGL0K12650g452149780.35
ACR225C449149780.39
Scas_656.21*473200770.54
YFL037W (TUB2)457149760.73
KLLA0C05566g477159741.1
Sklu_2144.1333149731.5
YER014W (HEM14)53980703.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01155g
         (978 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01155g complement(104687..107668) some similarities with s...  1688   0.0  
AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C...   820   0.0  
Kwal_47.19191                                                         813   0.0  
Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement     803   0.0  
YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated p...   751   0.0  
CAGL0C02145g complement(216905..219238) similar to sp|P43612 Sac...   736   0.0  
Scas_687.19                                                           656   0.0  
Scas_712.21                                                           635   0.0  
YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of th...   512   e-168
KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces...   379   e-114
CAGL0L03586g complement(408095..411466) similar to sp|P40856 Sac...   372   e-112
AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W...   362   e-109
Scas_711.22*                                                          344   e-102
YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that asso...   343   e-102
YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that asso...   330   7e-97
Kwal_26.7346                                                          311   1e-92
Scas_675.36                                                           163   3e-42
Kwal_26.7343                                                           45   1e-04
CAGL0K12650g complement(1251907..1253265) highly similar to sp|P...    35   0.35 
ACR225C [1272] [Homologous to ScYFL037W (TUB2) - SH] (751367..75...    35   0.39 
Scas_656.21*                                                           34   0.54 
YFL037W (TUB2) [1646] chr6 (56335..57708) Tubulin beta chain, re...    34   0.73 
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    33   1.1  
Sklu_2144.1 YFL037W, Contig c2144 366-1367 reverse complement          33   1.5  
YER014W (HEM14) [1437] chr5 (182599..184218) Protoporphyrinogen ...    32   3.4  

>KLLA0A01155g complement(104687..107668) some similarities with
           sp|P43612 Saccharomyces cerevisiae YFR040w SAP155
           SIT4P-associated protein, hypothetical start
          Length = 993

 Score = 1688 bits (4371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 851/978 (87%), Positives = 851/978 (87%)

Query: 1   MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSKSNNSSXXXXXXXXXXXXXXX 60
           MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSKSNNSS               
Sbjct: 1   MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSKSNNSSTVGTLGATAGAAAPV 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXKRINDNHXXXXXXXXXXRQGFAMGFEDRDKDSDVIIGD 120
                                 KRINDNH          RQGFAMGFEDRDKDSDVIIGD
Sbjct: 61  AVTDDNDLNETKTTTTTYNNDTKRINDNHEKKENAKKKKRQGFAMGFEDRDKDSDVIIGD 120

Query: 121 SNDSDRLEHNVDSHTTDFIDSSKNTIDTSPGSSQHNPRPSLIPTPRRFNGTSDIESTPLK 180
           SNDSDRLEHNVDSHTTDFIDSSKNTIDTSPGSSQHNPRPSLIPTPRRFNGTSDIESTPLK
Sbjct: 121 SNDSDRLEHNVDSHTTDFIDSSKNTIDTSPGSSQHNPRPSLIPTPRRFNGTSDIESTPLK 180

Query: 181 SAAXXXXXXXXXXXXXXXXXXXXXXEEGPIPLQALSHKFMDXXXXXXXXXXXXXXXXXXX 240
           SAA                      EEGPIPLQALSHKFMD                   
Sbjct: 181 SAASSHPDSLSTTTTSSSSASHLSDEEGPIPLQALSHKFMDEILEETELLNELTRQNNTL 240

Query: 241 XDFVCFGYFYTETGDKVENIAYXXXXXXXXXXXXXXXXXXXXXXTVGGXXXXXXXXXXXX 300
            DFVCFGYFYTETGDKVENIAY                      TVGG            
Sbjct: 241 LDFVCFGYFYTETGDKVENIAYLIDRLLDCIDKIDDDNDSANLDTVGGNDNVNELDDDDN 300

Query: 301 XXXXHRIENRDGSINDEGNNNAVQNIRESATIGSNDSGRGETHNQGDDNEDEDIDTFGNS 360
               HRIENRDGSINDEGNNNAVQNIRESATIGSNDSGRGETHNQGDDNEDEDIDTFGNS
Sbjct: 301 INEEHRIENRDGSINDEGNNNAVQNIRESATIGSNDSGRGETHNQGDDNEDEDIDTFGNS 360

Query: 361 KGSFENPHEFTSSPHDDSIIPMLDSKLKKKSTFLNKANIISEIFALDIWLISESLVKNTE 420
           KGSFENPHEFTSSPHDDSIIPMLDSKLKKKSTFLNKANIISEIFALDIWLISESLVKNTE
Sbjct: 361 KGSFENPHEFTSSPHDDSIIPMLDSKLKKKSTFLNKANIISEIFALDIWLISESLVKNTE 420

Query: 421 YLNKIWSILYHPKFTQEKSPLIPIFLKINQNLLLTRQDQYLNFIRTRDNLVIDMLKHIDI 480
           YLNKIWSILYHPKFTQEKSPLIPIFLKINQNLLLTRQDQYLNFIRTRDNLVIDMLKHIDI
Sbjct: 421 YLNKIWSILYHPKFTQEKSPLIPIFLKINQNLLLTRQDQYLNFIRTRDNLVIDMLKHIDI 480

Query: 481 SLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLFAFLVNEKYSADIQACAGDFIKSII 540
           SLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLFAFLVNEKYSADIQACAGDFIKSII
Sbjct: 481 SLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLFAFLVNEKYSADIQACAGDFIKSII 540

Query: 541 AVSANAPLDEMSIGPNALTREIASEKCIDYLLGCIINERGPALMTAVSITIELIRKNNSD 600
           AVSANAPLDEMSIGPNALTREIASEKCIDYLLGCIINERGPALMTAVSITIELIRKNNSD
Sbjct: 541 AVSANAPLDEMSIGPNALTREIASEKCIDYLLGCIINERGPALMTAVSITIELIRKNNSD 600

Query: 601 YDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLVNLKQILFDIENDASIPIIKNQMGE 660
           YDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLVNLKQILFDIENDASIPIIKNQMGE
Sbjct: 601 YDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLVNLKQILFDIENDASIPIIKNQMGE 660

Query: 661 SYKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKERDQVRTELVQQLEDALTDLNI 720
           SYKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKERDQVRTELVQQLEDALTDLNI
Sbjct: 661 SYKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKERDQVRTELVQQLEDALTDLNI 720

Query: 721 KSKLTADNHNSDSPTELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLL 780
           KSKLTADNHNSDSPTELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLL
Sbjct: 721 KSKLTADNHNSDSPTELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLL 780

Query: 781 PIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLD 840
           PIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLD
Sbjct: 781 PIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLD 840

Query: 841 DAPIDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLISPDI 900
           DAPIDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLISPDI
Sbjct: 841 DAPIDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLISPDI 900

Query: 901 HEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGGDIVMGNDQDPTSFSTQMD 960
           HEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGGDIVMGNDQDPTSFSTQMD
Sbjct: 901 HEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGGDIVMGNDQDPTSFSTQMD 960

Query: 961 LHDKLREKLIEKSRQEVD 978
           LHDKLREKLIEKSRQEVD
Sbjct: 961 LHDKLREKLIEKSRQEVD 978

>AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C
           (SAP4) - SH] complement(880258..882957) [2700 bp, 899
           aa]
          Length = 899

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/690 (61%), Positives = 515/690 (74%), Gaps = 51/690 (7%)

Query: 335 NDSGRGETHNQGDDNED-----------EDIDTFGNSKGSFENPHEFTSSPHDDSIIPML 383
           ND  R   H Q ++  D           E  D+    +  F  P    S   DD+I+P L
Sbjct: 197 NDETRTPGHEQENEQHDDFLPPQQAGFLEGQDSEFIKRAVFPEP---PSHEGDDAILPFL 253

Query: 384 DSKL-KKKSTFLNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLI 442
             +   ++S+ LN+ N ISEIFALDIWLISESLVK+  +L+KIWS+L H  F  EKSPL+
Sbjct: 254 HGRRDTRQSSLLNRVNTISEIFALDIWLISESLVKDPSHLSKIWSVLNHKDFKAEKSPLV 313

Query: 443 PIFLKINQNLLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGI 502
           PIFLKINQNLLLTRQDQ LNFIR R++LV + L+H++IS+LMDFFLKI++TDKQE+PTGI
Sbjct: 314 PIFLKINQNLLLTRQDQLLNFIRARESLVDEFLQHLEISVLMDFFLKIISTDKQESPTGI 373

Query: 503 IELVSEQKLIDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREI 562
           IELV +Q LI  + +FL N KYSADIQACAGD +K++I++S NAPLDE+SIGPNALTR++
Sbjct: 374 IELVYDQGLIPKMLSFLDNHKYSADIQACAGDLMKALISISTNAPLDELSIGPNALTRQL 433

Query: 563 ASEKCIDYLLGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPV 622
            SE+ ID  L  IIN+RG AL TAVS+ IELIRKNNSDYDQ+NLL T++K+HPPS RDP+
Sbjct: 434 CSEESIDCFLDAIINKRGHALTTAVSVVIELIRKNNSDYDQINLLCTSVKTHPPSTRDPI 493

Query: 623 YLGVMLRKFSENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHC 682
           YLG ML+KF+E L N K++L +IEND SI  I+NQ+G  YKPLGFERFK+VELIAELLHC
Sbjct: 494 YLGRMLKKFAEKLPNFKRVLLEIENDGSIKDIRNQLGIEYKPLGFERFKIVELIAELLHC 553

Query: 683 SNMGLMNSKKAERIVKERDQVRTELVQQLEDALTDLNIK-------------SKLTADNH 729
           SNMGLMNSKKAERIVKERD+VR  +V+QL+DALT+LN+              + L A N 
Sbjct: 554 SNMGLMNSKKAERIVKERDEVRNHMVKQLQDALTELNMNDGNDRTKGDEKGLTGLCATNT 613

Query: 730 NSDSPTEL---SLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLLPIIIQL 786
           +  + T     + D++IDESFE+PY+N NQN+KL  NPTIGDLFKI+LY++QLLP IIQL
Sbjct: 614 SMSTQTTAVNDNADEEIDESFEIPYLNMNQNSKLPHNPTIGDLFKIQLYDTQLLPKIIQL 673

Query: 787 FIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDDAP--- 843
           FI++PWNNFWHNV+FDIIQQIFNGRMDFSYNSFLVY+LF+NK+A +F  D   ++     
Sbjct: 674 FIEHPWNNFWHNVVFDIIQQIFNGRMDFSYNSFLVYSLFNNKDAGQFVIDVKPEENRAQD 733

Query: 844 -IDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLISPDIHE 902
             DF ITRDLVL GY+NSH FYE++NT LG+MGHLVLIAEEIVKFSKVYKV+LISPDIH 
Sbjct: 734 FTDFAITRDLVLQGYKNSHAFYEQYNTNLGYMGHLVLIAEEIVKFSKVYKVELISPDIHR 793

Query: 903 VLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGGDIV--------------MGN 948
           VL D DW FYS D LNDTR+MYSKILGG +Y+  G  NG                   G 
Sbjct: 794 VLQDPDWIFYSEDALNDTRMMYSKILGGSEYL--GEENGCTAAEMEQLTETGENLPEFGG 851

Query: 949 DQDPTSFSTQMDLHDKLREKLIEKSRQEVD 978
                SFSTQ DLH KL+EKLI++S++EVD
Sbjct: 852 KLSGYSFSTQADLHQKLKEKLIKRSQEEVD 881

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 29/40 (72%)

Query: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSK 40
          MSFWPFGQN N+SNIN IL++YF V+H LE      +G +
Sbjct: 1  MSFWPFGQNVNNSNINRILDDYFRVLHSLEEDGAGESGER 40

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%)

Query: 206 EEGPIPLQALSHKFMDXXXXXXXXXXXXXXXXXXXXDFVCFGYFYTETGDKVENIAY 262
           +E P+   +L++ F+D                    DFVCFG+FY   G+K++NI Y
Sbjct: 122 DEAPLTKFSLNYSFIDSILKESELLNELTRQNNTLLDFVCFGFFYDTDGNKIDNIEY 178

>Kwal_47.19191
          Length = 790

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/642 (63%), Positives = 498/642 (77%), Gaps = 29/642 (4%)

Query: 362 GSFENPHEFTSSPHDDSIIPMLDSKLKKKSTFLNKANIISEIFALDIWLISESLVKNTEY 421
           G+ E   E  SS    +    ++     +   LN+A IISEIFALDIWLISESLVKN  Y
Sbjct: 135 GAAEAGQEQNSSASTPAAEDSVEGTEDPQQPVLNRATIISEIFALDIWLISESLVKNASY 194

Query: 422 LNKIWSILYHPKFTQEKSPLIPIFLKINQNLLLTRQDQYLNFIRTRDNLVIDMLKHIDIS 481
           LNKIWSIL    F  EKS LIPIFLKINQNLL TRQDQYLNFIR++D LV D+L+HI IS
Sbjct: 195 LNKIWSILKQQNFASEKSALIPIFLKINQNLLATRQDQYLNFIRSKDTLVDDLLEHIQIS 254

Query: 482 LLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLFAFLVNEKYSADIQACAGDFIKSIIA 541
           +LMDF LKI++TDKQE+P+GIIELV EQ+L + L ++L N++Y  DIQACA D +K+I+A
Sbjct: 255 VLMDFLLKIISTDKQESPSGIIELVHEQRLPNKLLSYLDNDRYEPDIQACAADLLKAIVA 314

Query: 542 VSANAPLDEMSIGPNALTREIASEKCIDYLLGCIINERGPALMTAVSITIELIRKNNSDY 601
           +SANAPLD+MSIGPN+LTR +ASE C+ +LL  II++RG AL+ AVSI IELIRKNNSDY
Sbjct: 315 ISANAPLDDMSIGPNSLTRHLASEDCVSFLLDTIIDKRGNALINAVSIVIELIRKNNSDY 374

Query: 602 DQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLVNLKQILFDIENDASIPIIKNQMGES 661
           DQVNLLTTT+ SHPPSMRDP+YLGVML+ F+E L ++ QIL DIE D++   ++NQ+GE 
Sbjct: 375 DQVNLLTTTLTSHPPSMRDPIYLGVMLKLFTERLPSIFQILTDIELDSTTKELENQLGEK 434

Query: 662 YKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKERDQVRTELVQQLEDALTDLNIK 721
           YKPLGFERFKVVELIAELLHCSNMGL+NSKKAERIVKER+  R  +V+QL+DAL DL+++
Sbjct: 435 YKPLGFERFKVVELIAELLHCSNMGLLNSKKAERIVKERNNARGAVVKQLQDALADLDLQ 494

Query: 722 SKLTADNHNSDSPTELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLLP 781
               A N   ++  +   ++D+DESF++PYVN NQNAKLR NPTIGDLFKI LY++Q++P
Sbjct: 495 DNEYASNVVDNNGVD---EEDVDESFDIPYVNPNQNAKLRENPTIGDLFKITLYDNQIIP 551

Query: 782 IIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDD 841
            I+ LF++YPWNNFWHNV+FDIIQQ+FNGRMDFSYNSFL+Y+LF+N  A RF ++ T   
Sbjct: 552 RIVHLFLQYPWNNFWHNVVFDIIQQLFNGRMDFSYNSFLIYSLFNNHAASRFMSEATAKT 611

Query: 842 APIDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLISPDIH 901
              DFQITRDL+L GY+ S+ FYEKHNT LGFMGHLVLIAEEIVKFSKVYKV+LISPDI 
Sbjct: 612 VR-DFQITRDLILKGYKESYAFYEKHNTALGFMGHLVLIAEEIVKFSKVYKVELISPDIQ 670

Query: 902 EVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLN-------------------GG 942
            VL ++DW FYS D+LNDTRIMYSKILGG DY+EDGN N                   GG
Sbjct: 671 AVLQNDDWVFYSEDVLNDTRIMYSKILGGNDYLEDGNTNERDGDLIDDDTHNRENPQPGG 730

Query: 943 DIV----MGNDQDP--TSFSTQMDLHDKLREKLIEKSRQEVD 978
           +++    +  DQ    ++ ST  DLH KLR++LI++S+ EVD
Sbjct: 731 NLINLSELSQDQGQGLSNLSTTSDLHKKLRQRLIDQSQGEVD 772

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQ 34
          MSFWPFGQN   SNIN +LEEYF V+H LE + +
Sbjct: 1  MSFWPFGQN-EHSNINRVLEEYFQVLHSLEKREE 33

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 23/49 (46%)

Query: 214 ALSHKFMDXXXXXXXXXXXXXXXXXXXXDFVCFGYFYTETGDKVENIAY 262
           ALS K++D                    DFVCFGYFY   G KV+NI Y
Sbjct: 74  ALSSKYIDGILAESELLNELTRQNSTLLDFVCFGYFYGADGGKVQNIEY 122

>Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement
          Length = 914

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/705 (61%), Positives = 520/705 (73%), Gaps = 82/705 (11%)

Query: 344 NQGDDNEDEDIDTFGNSKGSFENPHEFTSSPHDDS---IIPMLDSKLKK-KSTFLNKANI 399
           N+ DDNE +D D     +   E+     + P+DDS     P +D++ +  +S++LNKA I
Sbjct: 188 NEHDDNEPDDKDL----QVEQEDGPSTQTQPNDDSNDISTPSVDNQEEDDQSSYLNKATI 243

Query: 400 ISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQNLLLTRQDQ 459
           ISEIF+LDIWLISESLVKN+ YL  IWSIL+HP F+ EKSPLIPIFLKINQNLLLTRQDQ
Sbjct: 244 ISEIFSLDIWLISESLVKNSTYLATIWSILHHPNFSSEKSPLIPIFLKINQNLLLTRQDQ 303

Query: 460 YLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLFAFL 519
           YLNFIRTR+NLV D LKHI IS+LMDFFLK+++TDKQE+PTGIIELV EQ LI  L  +L
Sbjct: 304 YLNFIRTRENLVGDFLKHIGISVLMDFFLKVISTDKQESPTGIIELVYEQGLISKLLNYL 363

Query: 520 VNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYLLGCIINER 579
            N  Y ADIQACAGDFIK++IA+SANAPLD+MSIGPN+LTR++ SE+CID LL  I+N+R
Sbjct: 364 DN-GYHADIQACAGDFIKALIAISANAPLDDMSIGPNSLTRQLCSEQCIDLLLNAIVNKR 422

Query: 580 GPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLVNLK 639
           G AL TAVSI IELIRKNNSDYDQVNLLTTT+K+HPPS+RDP+YLGVML+KF+ NL    
Sbjct: 423 GAALTTAVSIVIELIRKNNSDYDQVNLLTTTVKTHPPSIRDPIYLGVMLKKFAVNLPEFY 482

Query: 640 QILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKE 699
           +IL D+END  IP++KNQ+ + YKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKE
Sbjct: 483 RILLDVENDDRIPLVKNQLNQEYKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKE 542

Query: 700 RDQVRTELVQQLEDALTDLNIKSK--------------------------LTADNHNSD- 732
           RD+VR  L +QLEDAL +L++  +                          +T  N N+D 
Sbjct: 543 RDEVRQGLTKQLEDALAELDMGEENDNINDANNNNSTTTTNNTITDNNDTVTTSNENNDE 602

Query: 733 ------------SPTELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLL 780
                       SP + + +++IDESFE+PYVN +QNAKLR NPT GDLFKI LY++Q+L
Sbjct: 603 VYEKVNEQNNKESPDDANDEEEIDESFEIPYVNPSQNAKLRLNPTTGDLFKINLYDTQIL 662

Query: 781 PIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLD 840
           P II+LF++YPWNNFWHNV+FDIIQQIF+GRMDFSYNSFLVY+LF+NK + +F     L 
Sbjct: 663 PKIIELFLRYPWNNFWHNVLFDIIQQIFSGRMDFSYNSFLVYSLFNNKGSAQFM----LT 718

Query: 841 DAPI---DFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLIS 897
             P    DF+IT DL+L GYR+SH FYE H T LG+MGHLVLIAEEIVKFSKVYKV+LIS
Sbjct: 719 AKPTHVRDFRITADLILQGYRDSHDFYEVHETNLGYMGHLVLIAEEIVKFSKVYKVELIS 778

Query: 898 PDIHEVLLDEDWDFYSNDILNDTRIMYSKIL------------------------GGGDY 933
           PDI+EVL DE W FYS D+LNDTR+MYSKIL                         GGD 
Sbjct: 779 PDIYEVLQDEAWIFYSEDVLNDTRVMYSKILGGGDYMDDGGENAIHDLASPSSSESGGDL 838

Query: 934 IEDGNLNGGDIVMGNDQDPTSFSTQMDLHDKLREKLIEKSRQEVD 978
           I   N   G  +  + Q   +FSTQ DLH KL+EKLI++S+ EVD
Sbjct: 839 INVSNY--GQELQQHTQ-ANAFSTQSDLHKKLKEKLIKESQSEVD 880

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 32/43 (74%)

Query: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSKSNN 43
          MSFWPFGQN N+SNIN +L++YFHV+  LE Q++   G   +N
Sbjct: 1  MSFWPFGQNINNSNINKLLDDYFHVLRDLEAQSKDSTGGVDDN 43

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%)

Query: 207 EGPIPLQALSHKFMDXXXXXXXXXXXXXXXXXXXXDFVCFGYFYTETGDKVENIAY 262
           E P+ LQ+L++ F+D                    DF+CFGYFY   G KVENI Y
Sbjct: 120 ESPMTLQSLNNSFIDNLLQETELLNELTRQNNTLLDFICFGYFYDAYGTKVENIEY 175

>YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated
           protein [3009 bp, 1002 aa]
          Length = 1002

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/665 (57%), Positives = 483/665 (72%), Gaps = 78/665 (11%)

Query: 390 KSTFLNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKIN 449
           +S +L KA IISEIF+LDIWLISESLVKN  YLNKIWSI+  P F  E SPL+PIFLKIN
Sbjct: 275 ESAYLTKATIISEIFSLDIWLISESLVKNQSYLNKIWSIINQPNFNSENSPLVPIFLKIN 334

Query: 450 QNLLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQ 509
           QNLLLTRQDQYLNFIRT  + V DMLKH+DISLLMDFFLKI++TDK E+PTGIIELV +Q
Sbjct: 335 QNLLLTRQDQYLNFIRTERSFVDDMLKHVDISLLMDFFLKIISTDKIESPTGIIELVYDQ 394

Query: 510 KLIDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCID 569
            LI    +FL N++  ADIQAC GDF+K++IA+SANAPLD++SIGPN+LTR++AS + I 
Sbjct: 395 NLISKCLSFLNNKESPADIQACVGDFLKALIAISANAPLDDISIGPNSLTRQLASPESIA 454

Query: 570 YLLGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLR 629
            L+  +IN+RG AL T VSI IELIRKNNSDYDQVNLLTTTIK+HPPS RDP+YLG +LR
Sbjct: 455 KLVDIMINQRGAALNTTVSIVIELIRKNNSDYDQVNLLTTTIKTHPPSNRDPIYLGYLLR 514

Query: 630 KFSENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMN 689
           KFS +L +  QI+ DIENDA+IP+ +NQ+ E +KPLGFERFKVVELIAELLHCSNMGLMN
Sbjct: 515 KFSNHLSDFFQIILDIENDANIPLHENQLHEKFKPLGFERFKVVELIAELLHCSNMGLMN 574

Query: 690 SKKAERIVKERDQVRTELVQQLEDALTDLNIKSKLTADNHNSDSPT-------------- 735
           SK+AERI + RD+VR++L   L+DAL DL+I+ K      +  SPT              
Sbjct: 575 SKRAERIARRRDKVRSQLSHHLQDALNDLSIEEKEQLKTKH--SPTRDTDHDLKNNNGKI 632

Query: 736 ---------ELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLLPIIIQL 786
                    E    D+IDESFE+PY+N  Q  KLR++PT+GDLFKI+LY+++++  I++L
Sbjct: 633 DNDNNDNDDESDYGDEIDESFEIPYINMKQTIKLRTDPTVGDLFKIKLYDTRIVSKIMEL 692

Query: 787 FIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDD----- 841
           F+ +PWNNFWHNVIFDIIQQIFNGRMDFSYNSFLV +LF+ K++ +F TD  + D     
Sbjct: 693 FLTHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVLSLFNLKSSYQFMTDIVISDEKGTD 752

Query: 842 ----API------DFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVY 891
               +P+      DF+IT D +L GY++S+KFYE     LG+MGH+VLIAEE+VKFSK+Y
Sbjct: 753 VSRFSPVIRDPNFDFKITTDFILRGYQDSYKFYELRKMNLGYMGHIVLIAEEVVKFSKLY 812

Query: 892 KVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLN----------- 940
           KV+LISPDI  +L  E+W +YS ++LN+TR+MYSKILGGG YI+DGN N           
Sbjct: 813 KVELISPDIQVILQTEEWQYYSEEVLNETRMMYSKILGGGSYIDDGNGNIIPQLPDNTTV 872

Query: 941 ---GGDIVMGND------------------------QDPTSFSTQMDLHDKLREKLIEKS 973
               GD    N+                        ++  S ST+ DLH+KLRE LI ++
Sbjct: 873 LTPNGDASNNNEILDSDTGSSNGTSGGGQLINVESLEEQLSLSTESDLHNKLREMLINRA 932

Query: 974 RQEVD 978
           +++VD
Sbjct: 933 QEDVD 937

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (86%)

Query: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGLE 30
          MSFWPFGQN N SNIN IL+EYFHV+H LE
Sbjct: 1  MSFWPFGQNLNHSNINKILDEYFHVLHELE 30

>CAGL0C02145g complement(216905..219238) similar to sp|P43612
           Saccharomyces cerevisiae YFR040w SAP155 SIT4P-associated
           protein, hypothetical start
          Length = 777

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/659 (56%), Positives = 498/659 (75%), Gaps = 52/659 (7%)

Query: 372 SSPHDDSII----PMLDSKLKKKSTFLNKANIISEIFALDIWLISESLVKNTEYLNKIWS 427
           +SP D+ I      +++   + +  +L++AN+I+EIF+LDIWLI+ESLVKN E+L+KIW+
Sbjct: 98  NSPADEGIEMDFNKVIEDNAEDEDEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWN 157

Query: 428 ILYHPKFTQEKSPLIPIFLKINQNLLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFF 487
           +L++P F  E+SPLIPIFLK+NQNLL+TRQDQYLNFIR++ +LV DML HIDI+LLMDFF
Sbjct: 158 LLHNPNFKFERSPLIPIFLKMNQNLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFF 217

Query: 488 LKIVATDKQEAPTGIIELVSEQKLIDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAP 547
           LK+++TDK E+PTG+IELVS+QKLID L  FL N  YSADIQAC  DF+K++I +SANAP
Sbjct: 218 LKLISTDKIESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAP 277

Query: 548 LDEMSIGPNALTREIASEKCIDYLLGCIINERGPALMTAVSITIELIRKNNSDYDQVNLL 607
           LDE+SIGPN+LTR +AS K ID ++  ++NERG AL + +SI IELIRKNNSDYDQVNLL
Sbjct: 278 LDELSIGPNSLTRRLASPKSIDKMIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLL 337

Query: 608 TTTIKSHPPSMRDPVYLGVMLRKFSENLVNLKQILFDIENDASI---PIIKNQMGESYKP 664
            TT+++HPPS RDP++LG +LR+F+ NL  L +I+ DI ++       ++ NQM E + P
Sbjct: 338 DTTLETHPPSDRDPIFLGYLLRRFAANLPKLFEIIDDIYDNNDTNDDMLLTNQMNEKFIP 397

Query: 665 LGFERFKVVELIAELLHCSNMGLMNSKKAERIVKERDQVRTELVQQLEDALTDLNI---- 720
           +GFERFK+VELIAELLHCSNMGL+N+K+AERI + RD+VR ++  QL+DAL DL I    
Sbjct: 398 IGFERFKIVELIAELLHCSNMGLLNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSV 457

Query: 721 --KSK---------------LTADNHNSDSPTELSLD--DDIDESFEVPYVNDNQNAKLR 761
             K K               + ++N + D    ++ D  D+IDE+FE+PY+N+NQN+KLR
Sbjct: 458 DNKRKSDTAQQNDKHDAFDGIQSENESHDEFEHINQDENDEIDETFEIPYINENQNSKLR 517

Query: 762 SNPTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLV 821
           +NPTIGDLFKI+LY+ Q++P I++LF+ +PWNNFWHNVIFDIIQQIFNGRMDFSYNSFLV
Sbjct: 518 TNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLV 577

Query: 822 YALFSNKNAERFATDKTLDDAPI-DFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLI 880
           ++LF+ + + ++   +   DA + DF IT+D +L GY  S+KFYE+ NT LGFMGHLVLI
Sbjct: 578 FSLFNLEGSFQYMDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLI 637

Query: 881 AEEIVKFSKVYKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLN 940
           AEE+VKFSK+YKV+LIS DI + L ++DW +YS ++LN TR+MYSKILGGG+++ED N N
Sbjct: 638 AEEVVKFSKLYKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGN 697

Query: 941 --------------------GGDIV-MGNDQDPTSFSTQMDLHDKLREKLIEKSRQEVD 978
                               GG ++ + N ++  S ST+ DLH KLR+ L+ K++QEVD
Sbjct: 698 IVPQMNDGNYLDYDDENDVSGGKLINVENLEEQLSLSTESDLHLKLRDMLVVKAQQEVD 756

>Scas_687.19
          Length = 956

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/682 (51%), Positives = 464/682 (68%), Gaps = 102/682 (14%)

Query: 392 TFLNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQN 451
           T L+KA IISE  ALD+W+++++L+KN  YL+K+WSI+ H     E S L+ IFLKINQN
Sbjct: 235 TSLSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQN 294

Query: 452 LLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKL 511
           LL +R + Y+ FI T  NLV ++L HID+S++MDFFLKI+ATD+ E+PTG+I+LV +QKL
Sbjct: 295 LLFSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKL 354

Query: 512 IDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYL 571
           I     FL N KYS+D+Q+C+GDF+K++I +SANAP+D+++IGPN+LTRE+AS + ID L
Sbjct: 355 IYKSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDIL 414

Query: 572 LGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKF 631
           +  I+N+RG AL TAVSI IELIRKNNSDYDQVNLL TTI  +PP  RDP+YLG +L+KF
Sbjct: 415 IDIILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTIIDNPPIDRDPIYLGYLLKKF 474

Query: 632 SENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSK 691
           S NL N  +I+ DIE D SIP+ +NQ+ E +KPLGFERFK+VELIAELLHCSNMGLMNS+
Sbjct: 475 SINLPNFLKIIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSR 534

Query: 692 KAERIVKERDQVRTEL-VQQLEDALTDLNIKSK-----LTADNHN--------------- 730
           KAE+I  +RD+ R       +   L++L+I+ K     LT  + N               
Sbjct: 535 KAEKIALKRDKYRKRANSYDVHHTLSNLSIRDKNSITTLTGSDSNDLKSNNDNSNDFNEN 594

Query: 731 ---------------------------------SDSPTELSLDDDIDESFEVPYVNDNQN 757
                                            SDS  E     +IDESFE+PY+N++QN
Sbjct: 595 DDTKAVKKPKTNNDPNINTSINASEEQEEVNEESDSSIE-----EIDESFEIPYINESQN 649

Query: 758 AKLRSNPTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYN 817
            KLR  PT+GDLFKI LY++Q++P I++LF+ +PWNNFWHNVIFDIIQQIFNGRMDFSYN
Sbjct: 650 MKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQIFNGRMDFSYN 709

Query: 818 SFLVYALFSNKNAERF------ATDKTLDDAPIDFQITRDLVLLGYRNSHKFYEKHNTTL 871
           SFLVY+LF+ K + ++      A  + ++D  ++F IT D +L GY +S KFYE   T L
Sbjct: 710 SFLVYSLFNLKGSLQYMPPDVIAGIENIED--VNFAITTDFILKGYHDSFKFYETRKTNL 767

Query: 872 GFMGHLVLIAEEIVKFSKVYKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGG 931
           G+MGHLVL+AEEI+KFS++YKV+LISPDI E  +D+DW +YSND+LN+TRIMYSKILGGG
Sbjct: 768 GYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIMYSKILGGG 827

Query: 932 DYIEDGNLN----------------------------------GGDIV-MGNDQDPTSFS 956
            Y++DGN N                                  GG+++ +   ++    S
Sbjct: 828 TYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEALEEQLMLS 887

Query: 957 TQMDLHDKLREKLIEKSRQEVD 978
           T+ DLH+KLRE L  + +++VD
Sbjct: 888 TESDLHNKLREMLASQGQKQVD 909

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/32 (65%), Positives = 26/32 (81%)

Query: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGLENQ 32
          MSFWPFGQN N S+IN IL+EYF ++H LE +
Sbjct: 1  MSFWPFGQNLNHSDINKILDEYFQILHTLEKE 32

>Scas_712.21
          Length = 828

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/635 (52%), Positives = 450/635 (70%), Gaps = 65/635 (10%)

Query: 393 FLNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQNL 452
           FL+KA IIS I + D WLISESL+KN  YLN+IWS+L + K   E SPL+PIFLK+N++L
Sbjct: 186 FLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLKVNESL 245

Query: 453 LLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLI 512
           LL+R+DQYLNFIRTR  LV +  KH++I +L+DF LK++ATDK + PTGIIEL+ +Q++I
Sbjct: 246 LLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVI 305

Query: 513 DHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYLL 572
                F  N++YSAD+QACA DF+K++I +SAN PLDEMS+GPN L+R +AS   +D+L+
Sbjct: 306 QKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDVVDHLI 365

Query: 573 GCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFS 632
             I+NE G AL   +S+ IELIRKNNSDYD++NLL TT +SH PS RDP+YLG +L+KFS
Sbjct: 366 NIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKFS 425

Query: 633 ENLVNLKQILFDIENDASIPIIK-NQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSK 691
           + + N+  ++ D+ +   +  I+ NQ+ + ++PLGFER K+VELIAELLHCSNMGLMNSK
Sbjct: 426 DKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMGLMNSK 485

Query: 692 KAERIVKERDQVRTELVQQLEDALTDLNIK----SKLTADNH--NSDSPTELSLDDD--- 742
           +AE I  +RD +R +L  QL+DAL DL I     S + +DN+  N+D  T    D+D   
Sbjct: 486 RAEHIALKRDHLRLQLPHQLQDALQDLEINKTEHSDIISDNNSINNDLTTGSVTDEDEDV 545

Query: 743 -----------------------------IDESFEVPYVNDNQNAKLRSNPTIGDLFKIE 773
                                        ID+SFE+PY+N+ QN+KLR+ PTIGD FKI 
Sbjct: 546 LIENVSEHPERSFIDSDSDDDLDTIDVAEIDDSFEIPYINEKQNSKLRNGPTIGDRFKIN 605

Query: 774 LYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERF 833
           LY++Q++  I+ LF+K PWNNFWHNVIFDIIQQ+FNGRMDFSYNSF+VY+LF+ + A +F
Sbjct: 606 LYDNQIIIKILILFLKNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLEKASQF 665

Query: 834 ATDKTLDDAPI-------DFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVK 886
              KT  +A         +F IT+D +LLGY+ S++FYEK  T LG+MGHLVLIAEE+VK
Sbjct: 666 K--KTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEEVVK 723

Query: 887 FSKVYKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGGDIV- 945
           FSK+YKV+LISPDI ++L +++W FY +++L+ TRIMYSKILGGG +++DGN   G++V 
Sbjct: 724 FSKLYKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILGGGSFVDDGN---GNVVP 780

Query: 946 -------------MGNDQDPTSFSTQMDLHDKLRE 967
                          ND+   S  T++D+H K+ E
Sbjct: 781 QFIESSDPYEEHLETNDETSESLLTELDIHLKVGE 815

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 24/29 (82%), Gaps = 1/29 (3%)

Query: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGL 29
          MSFWPF Q+ ++SN++ IL+EYF +++ L
Sbjct: 1  MSFWPFPQD-STSNVSKILDEYFDILNSL 28

>YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of the
           SAP family of proteins that associate with Sit4p [2457
           bp, 818 aa]
          Length = 818

 Score =  512 bits (1318), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 282/635 (44%), Positives = 388/635 (61%), Gaps = 64/635 (10%)

Query: 397 ANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQNLLLTR 456
            NIIS IF      I E+LV+NT +L+ ++ +        E  P++ +FLKIN+ LL  +
Sbjct: 155 VNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAVFLKINETLLFEQ 214

Query: 457 QDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLF 516
              YL F +++ N+V   L HI++S L++F +KI+ TD+ E+PT II+ +  Q LI    
Sbjct: 215 TSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCL 274

Query: 517 AFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYLLGCII 576
             L N KYS  IQ  +G+ +K++I++S N  LD + IGPN LTR++AS + +D L+  I+
Sbjct: 275 NLLENSKYSPGIQNSSGELLKALISISTNFKLDTLWIGPNRLTRQLASPQYVDQLINIIL 334

Query: 577 NERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLV 636
            +RG A+  AVSI IELIRKNNSDYD+V+LL+TTI  +PPS RDPVYLG +L + + ++ 
Sbjct: 335 FQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHME 394

Query: 637 NLKQILFDIEN---------DASIPIIK-----NQMGESYKPLGFERFKVVELIAELLHC 682
           +   +L  +EN           ++P +K     NQ+ ES++PLGFER K+ ELI+E+LHC
Sbjct: 395 DFYALLIKLENDDDDDHDTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLHC 454

Query: 683 SNMGLMNSKKAERIVKERDQVRTELVQ-QLEDALTDLNIKSKLTADNHNSDSPTELSL-- 739
           SNMGLMNSK+ E+I + RD+ R  L Q  LE A+ +LNI       N   D         
Sbjct: 455 SNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNINDNTITSNTLEDKCNNNDSND 514

Query: 740 ----------------DDDI---------------DESFEVPYVNDNQNAKLRSNPTIGD 768
                           D+++               D SFE+PYV++ QN K+R NPTIGD
Sbjct: 515 SNDNQKQKKNIKKKFHDNELYSTFDTSDDNIDDDDDMSFEIPYVSETQNLKIRKNPTIGD 574

Query: 769 LFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNK 828
           LFKI+L++    P  +QLF++YPWNNFWHN++FDIIQQIFNGRMDFSYNSFLVY+LF  K
Sbjct: 575 LFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFK 634

Query: 829 NAERFATDKTL---DDAPI-DFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEI 884
            + RF            P+ DF I  D +L G+++S +FYEK  T LG+MG LVLIAEEI
Sbjct: 635 KSTRFIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEI 694

Query: 885 VKFSKVYKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGG-D 943
            K+SK+YK DLI+PDI+  L DE W  YS+DILN+TR M S ILGGG +  + + N   D
Sbjct: 695 AKYSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILGGGQFCAESDENTNQD 754

Query: 944 IVMGNDQDPTSFSTQMD-----------LHDKLRE 967
            +   D    +  + MD           LHDK+ E
Sbjct: 755 FLEKADMSKPAHPSTMDENEIVHEEDVKLHDKVAE 789

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSKSNNSS 45
          MS WPFG+  + S I+ ILEEY+ +   LE         K N  S
Sbjct: 1  MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTDDKKNEPS 45

>KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces
           cerevisiae YKR028w SAP190 SIT4P-associated protein,
           start by similarity
          Length = 1100

 Score =  379 bits (972), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 251/700 (35%), Positives = 373/700 (53%), Gaps = 91/700 (13%)

Query: 305 HRIENRDGSINDEGNNNAVQNIRESATIGSNDSGR-GETHNQGDDNED-EDIDTFGNSKG 362
           H +E  D S+ DE           S      D G+ G    + D  +D E+ +   N++ 
Sbjct: 189 HVLEPADDSMVDEEQQEGENGSDSSDNDAEEDQGKQGSPEAEADSGDDLENSEDENNTQS 248

Query: 363 SFEN-----PHEFTSSPHDDSIIPMLDSKLKKKSTFLNKANIISEIFALDIWLISESLVK 417
            ++N     P   + S  + SI    +S+ + +S    +A I +EI + D+W IS + + 
Sbjct: 249 QYQNTLDVVPDNASESSAETSITLPPESEEQVES---RRARIAAEILSADVWTISSAFMD 305

Query: 418 NTEYLNKIWSILYHPKFTQEKSPLIPI----FLKINQNLLLTRQDQYLNFIRTRDNLVID 473
           N + L K+WS L HP      +PL  I    F+KIN+ LL       +NFI  ++N+V  
Sbjct: 306 NEDLLVKLWSTLEHP------APLSIIASTYFMKINERLLDMDISGMINFILKQENIVDR 359

Query: 474 MLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLFAFLVNEKYSADIQACAG 533
            + HID   LMDF LK+++TDK +APTGII L+ +Q LI  L  +L  E + + IQ+ AG
Sbjct: 360 FIAHIDNPPLMDFLLKVISTDKPDAPTGIIALLKKQHLISKLLDYLSIE-HDSSIQSAAG 418

Query: 534 DFIKSIIAVSANAPLDEMS-IGPNALTREIASEKCIDYLLGCIINERGPALMTAVSITIE 592
           DF+K++I +SAN+  +  S IGPN LTRE+ S + +  L+  ++ + G +L   V I IE
Sbjct: 419 DFLKALITISANSNNEIASAIGPNELTRELVSAEMVSKLVNIML-QCGTSLSNGVGIVIE 477

Query: 593 LIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLVNLKQILFDIENDASIP 652
           LIRKNNSDYD V ++ TT+++HPPS RDPVYLG ++R F+  +    +IL + + D    
Sbjct: 478 LIRKNNSDYDFVQVMYTTLETHPPSDRDPVYLGHLVRCFANKMDRFNKILLETKLDP--- 534

Query: 653 IIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKERDQVRTELVQQLE 712
            ++   G S +PLGFERFK+ EL+AELLHCSNMGL+     E IV ERD  R E+++++E
Sbjct: 535 -LETPFG-SIEPLGFERFKICELVAELLHCSNMGLLGEPSGEAIVLERDLKREEILKEME 592

Query: 713 DAL-----------------------------TDLNIKSKLTADNHNSDSPTEL------ 737
           + L                              DLNI + L  D+  +D   ++      
Sbjct: 593 EQLENENASDAETGYYDGEDDTAHANNLHRELQDLNINATLK-DSEATDEVEDVKDVGDA 651

Query: 738 -----SLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLLPIIIQLFIKYPW 792
                SL +  D   E    ++     LR NP +GDL KI L ++ ++  I+ +F ++PW
Sbjct: 652 GDVDASLAERTDIHSETSSDSEVTEKVLRENPVVGDLLKISLQDNNIITTILDMFFRFPW 711

Query: 793 NNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDDAPIDFQITRDL 852
           NNF HNV+FDI+QQIFNG +   YN FL+  LFS+                    IT D+
Sbjct: 712 NNFLHNVVFDIVQQIFNGPLKSGYNKFLLADLFSSA------------------HIT-DV 752

Query: 853 VLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYK---VDLISPDIHEVLLDEDW 909
           ++ G R   ++ ++    LG+MGHL LIAEE+ KF+   +   V   SP + E L +  W
Sbjct: 753 IMEGDRKCLEYEKETGIRLGYMGHLTLIAEEVAKFAAYIEEANVTFASPVVQEGLNEPKW 812

Query: 910 DFYSNDILNDTRIMYSKILGGGDYIEDGNLNGGDIVMGND 949
             Y + IL +TR  YS +LG   + E  N  G D +  +D
Sbjct: 813 KEYCDTILTETREKYSSLLGDDGFDEGENDEGDDEIYEDD 852

>CAGL0L03586g complement(408095..411466) similar to sp|P40856
           Saccharomyces cerevisiae YJL098w SAP185 or sp|P36123
           Saccharomyces cerevisiae YKR028w SAP190, start by
           similarity
          Length = 1123

 Score =  372 bits (956), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 227/589 (38%), Positives = 324/589 (55%), Gaps = 89/589 (15%)

Query: 394 LNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPI-----FLKI 448
           L +A + +E+ + D+W IS ++++N + L K+WSI+ +P      +PL PI     F+KI
Sbjct: 247 LRRARMAAEVLSADVWPISSAIIQNEDLLEKLWSIMQYP------APL-PIEISTYFMKI 299

Query: 449 NQNLLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSE 508
           N+ LL    +  L FI    NL+   L HID   LMDF LK+++TDK + PTGII+++ E
Sbjct: 300 NERLLDMDLNGILAFILNHPNLLDIFLTHIDNPPLMDFLLKVISTDKADTPTGIIKILKE 359

Query: 509 QKLIDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLD-EMSIGPNALTREIASEKC 567
           Q +I  L  FL  E Y    Q+ AGDFIK+++ +S N   +   SIGPN + RE+ S   
Sbjct: 360 QGMIPKLLDFLSPE-YDKSTQSAAGDFIKALVTISGNCNNEIASSIGPNEMIRELVSPPM 418

Query: 568 IDYLLGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVM 627
           ++ L+  ++ + G +L   V I IELIRKNNSDYD V L  TTIK+HPP+ RDP+YLG +
Sbjct: 419 VEKLISIML-KAGSSLSNGVGIVIELIRKNNSDYDFVQLAYTTIKTHPPNDRDPIYLGYL 477

Query: 628 LRKFSENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGL 687
           L+ F+ ++    Q+L  IE    +P ++   GE  +PLGFERFK+ ELIAELLHCSNM L
Sbjct: 478 LKAFAAHMAEFTQMLTSIE----LPPLQTPQGE-IEPLGFERFKICELIAELLHCSNMTL 532

Query: 688 MNSKKAERIVKERDQVRTELV----QQLEDA----------------------------- 714
           +N    E IVKERD+ R  ++    Q+L D                              
Sbjct: 533 LNDPNGESIVKERDEERERILKLENQKLNDESDNEIEDNNIPTTDLKSDTSQEDEKIANE 592

Query: 715 LTDLNIKSKLTADNHNSDSPTELSLDDDIDESFEVPYVNDNQ-----------NAKLRSN 763
           + DL + S+  AD+ +    +E +  D + + FE    N+ +             KLR N
Sbjct: 593 MNDLQLDSEGNADDTDG---SEQAKSDTVRDEFESKETNEEEYLENISDDSETEHKLREN 649

Query: 764 PTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYA 823
           PT+GD  KI L +++++ +I+++F  Y WNNF HNV+FDIIQQIFNG +   YN FL+  
Sbjct: 650 PTVGDQLKIALEDTRVIEVILEMFFHYVWNNFLHNVVFDIIQQIFNGPLMTGYNRFLLID 709

Query: 824 LFSNKNAERFATDKTLDDAPIDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEE 883
           L  N                    +T DL++ G   S  + EKH   LG+MGHL L+AEE
Sbjct: 710 LLKN------------------IHMT-DLIIKGNEQSGVYEEKHVLRLGYMGHLTLMAEE 750

Query: 884 IVKFSKV---YKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILG 929
           IVKF       K+   +  I   L +  W +Y+   L D R  Y+ ILG
Sbjct: 751 IVKFEAYLDEMKITFTTDTIPTCLSEAKWKYYAETELADLREKYNTILG 799

>AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W
           (SAP185) - SH] complement(590137..593232) [3096 bp, 1031
           aa]
          Length = 1031

 Score =  362 bits (928), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 229/597 (38%), Positives = 324/597 (54%), Gaps = 93/597 (15%)

Query: 396 KANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPI----FLKINQN 451
           +A + +EI + D+W IS + +++ E L K+WSIL HP      +PL  +    F+KIN+ 
Sbjct: 211 RARMAAEILSADVWPISSAFIEHDELLYKLWSILDHP------APLSIVASTYFMKINER 264

Query: 452 LLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKL 511
           LL       + FI  +DNLV   L HID   LMDF LK+++TDK + PT +I L+  QKL
Sbjct: 265 LLDMDIASMIRFILNQDNLVDRYLTHIDNPPLMDFLLKVISTDKPDTPTHVIGLLKYQKL 324

Query: 512 IDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMS-IGPNALTREIASEKCIDY 570
           I  L   L  E +S+ +Q+ AGDF+K++I +SAN+  +  S IGPN LTRE+ S   +  
Sbjct: 325 ISKLLDHLSPE-WSSSVQSAAGDFLKALITISANSNNEIASAIGPNELTRELVS-PAMAS 382

Query: 571 LLGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRK 630
            LG I+   G +L   V I IELIRKNNSDYD   ++ TT+K+HPP+ RDPVYLG +++ 
Sbjct: 383 KLGDIMLNGGTSLSNGVGIVIELIRKNNSDYDFFQVMYTTLKTHPPNDRDPVYLGHLVKS 442

Query: 631 FSENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNS 690
           F+  L     +L D +    +P ++   G + +PLGFERFK+ ELIAELLHCSNMGL+N 
Sbjct: 443 FANKLPEFNAMLLDTK----LPPLETPFG-TIEPLGFERFKICELIAELLHCSNMGLLNE 497

Query: 691 KKAERIVKERDQVRTELVQQLE--------------------------------DALTDL 718
            K E IV ERD +  E V +LE                                  +TD 
Sbjct: 498 PKGEEIVNERD-IDRECVLRLEGYGIPKNCHDEERSVSVSPIEEEDLAKKIRDLQLVTDK 556

Query: 719 NIKSKLTADNHNSDSP----------TELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGD 768
              S  + ++ NSDS           TE+  +D  D               LR  P +GD
Sbjct: 557 RPSSDNSVESLNSDSQQATTPIHQLGTEIHSEDSSDAEL--------SEQALREKPVVGD 608

Query: 769 LFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNK 828
             KI L +++++  I+ +F KYPWNNF HNV+FDI+QQIFNG +   YN FL+  LF++ 
Sbjct: 609 QLKIALQDNKIITTILGMFFKYPWNNFLHNVVFDIVQQIFNGPLKTGYNRFLLADLFASA 668

Query: 829 NAERFATDKTLDDAPIDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFS 888
           +                  IT + ++ G R  H++  +    LG+MGHL L+AEE+ KF+
Sbjct: 669 H------------------IT-EAIIEGDRKCHEYERETGLRLGYMGHLTLVAEEVTKFA 709

Query: 889 KV---YKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGG 942
                 K+   +P I E L D+ W  Y+  +L +TR  YS +L  GD  E+   N G
Sbjct: 710 SYIDEMKISFSNPVISESLNDQRWREYTELVLAETRGKYSTVL--GDLAEEEGRNVG 764

>Scas_711.22*
          Length = 1018

 Score =  344 bits (883), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 223/608 (36%), Positives = 328/608 (53%), Gaps = 90/608 (14%)

Query: 394 LNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHP-KFTQEKSPLIPIFLKINQNL 452
           + +A++ SEI + ++W IS ++++N E L K+WSIL HP   + E S     F+KIN+ L
Sbjct: 202 VRRAHMASEILSAEVWGISNAILENDELLTKLWSILDHPIPLSIETSTY---FMKINERL 258

Query: 453 LLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLI 512
           L T     + FI ++  LV   LKHID   L+DF LK++++DK +APT +I+ + EQ LI
Sbjct: 259 LDTDITGMVTFILSQSTLVARFLKHIDNPPLLDFLLKVISSDKPDAPTRVIQCLKEQGLI 318

Query: 513 DHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLD-EMSIGPNALTREIASEKCIDYL 571
             L   L +E Y    Q  A DF+K+ + +S N   +   SIGPN LTR++ S + ++ L
Sbjct: 319 PRLLDCLSHE-YDPSTQTAAADFLKAFVTISGNCNSEIASSIGPNELTRQLVSPEMMEKL 377

Query: 572 LGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKF 631
           +  ++   G +L   V I IELIRKNNSDYD V ++ TT+++HPP+ RDP+YLG ++  F
Sbjct: 378 IKIMLT-GGTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLVSLF 436

Query: 632 SENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSK 691
           ++ +    + L D  +     +++   G +  PLGFERFKV ELIAELLHCSNM L+N  
Sbjct: 437 AQYMPEFNKFLLDTNS----TMLRTSFG-NITPLGFERFKVCELIAELLHCSNMSLLNEP 491

Query: 692 KAERIVKERDQVR-----------------------------TELVQQL----EDALTDL 718
           K E IVKERD+ R                             TE +  L    E+ + +L
Sbjct: 492 KGEAIVKERDEERKRVLNFSHISDSEEANMNGDTTTIEGEEITERIDSLKLESEEEIREL 551

Query: 719 NIKSKLTADNHNSDSPTELSLDDDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQ 778
           N K   ++   +SD   E + +D I +S   P         +R    +GD+ K  LY++ 
Sbjct: 552 NEKEDESSVAESSD--VEAAPEDHISDS---PATE----KSIRDEKIVGDVLKTLLYDTG 602

Query: 779 LLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKT 838
           ++  I+++F ++PWNNF HNV+FDIIQQIFNG +   YN FL+  L +  +  +      
Sbjct: 603 IVVNIVKMFFQFPWNNFLHNVVFDIIQQIFNGPLKTGYNIFLLKDLLTRAHLTQ------ 656

Query: 839 LDDAPIDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVY---KVDL 895
                        L+L G   S ++ E+ +  LG+MGHL LI EEI+KF+      KV  
Sbjct: 657 -------------LLLDGDTRSREYEERTHFRLGYMGHLTLIGEEILKFAAYLEETKVVF 703

Query: 896 ISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGGD-----YIEDG---------NLNG 941
              DI + L D  W  Y++ IL DTR  Y   LG  +      IEDG         N+  
Sbjct: 704 TEDDIVDALQDSAWIEYADTILADTREKYETALGENEDDDQSLIEDGAETSRGSFDNVEI 763

Query: 942 GDIVMGND 949
           G  ++GND
Sbjct: 764 GPELLGND 771

>YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3177 bp, 1058 aa]
          Length = 1058

 Score =  343 bits (881), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 222/639 (34%), Positives = 337/639 (52%), Gaps = 106/639 (16%)

Query: 396 KANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLI----PIFLKINQN 451
           +A I +EI + D+W IS +L++N   L K+WSIL  P      SPL       F+KIN+ 
Sbjct: 208 RARIAAEILSADVWPISSALIENEGLLAKLWSILRLP------SPLSIEASTYFMKINER 261

Query: 452 LLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKL 511
           LL    D  + FI  ++++V D L HID   LMDF LK+++TDK E   G+I+L  +Q L
Sbjct: 262 LLDMNMDGIIEFILKKEHIVDDFLAHIDNPPLMDFLLKVISTDKPEISNGVIQLFKKQNL 321

Query: 512 IDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLD-EMSIGPNALTREIASEKCIDY 570
           +  L   L++  + +  Q+ AGDF+K+++ +S N P +   SIGPN LTR++ S   +  
Sbjct: 322 VPKLI-HLLDPVFDSCTQSAAGDFLKALVTISGNCPNEITSSIGPNELTRQLVSPNMMKQ 380

Query: 571 LLGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRK 630
           L+  ++ + G +L   V I IELIRKNNSDYD +    TTI+SHPP+ RDP+YLG +++ 
Sbjct: 381 LMDIML-KGGNSLNNGVGIIIELIRKNNSDYDTIQTNYTTIESHPPTDRDPIYLGYLVKM 439

Query: 631 FSENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNS 690
           FSE++ +  +IL     +  IP+++   G + +PLGFERFK+ ELIAELLHCSNM L+N 
Sbjct: 440 FSEHMADFNKIL----TEKKIPLLQTSYG-TIEPLGFERFKICELIAELLHCSNMTLLNE 494

Query: 691 KKAERIVKERDQVRTEL---------------------------------VQQLE----- 712
             A  IV+ERD  R  +                                   Q+E     
Sbjct: 495 PSAYDIVRERDAERERIFNSQNYVDSNDRSELKENEDDNTGDADDEVEDDTNQVESANTS 554

Query: 713 -------DALTDLNIKSKLTADNHNSDSPTELSLD-------DDIDES-FEVPYVN---- 753
                  D L  L I++     N N++    L  D       D+ DE+ FE  Y +    
Sbjct: 555 IDGEEVIDKLNSLQIETNKVNQNMNNEEQHSLMPDFNNGDFKDEEDENPFEPQYSDVILD 614

Query: 754 -DNQNAKLRSNPTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRM 812
             +     R +P +GD  KI L +++++  ++++F  + WNNF HNV++D++QQIFNG +
Sbjct: 615 SSDIEKNFRVSPNVGDQLKISLQDTRVIDTMLEMFFHFQWNNFLHNVVYDVVQQIFNGPL 674

Query: 813 DFSYNSFLVYALFSNKNAERFATDKTLDDAPIDFQITRDLVLLGYRNSHKFYEKHNTTLG 872
              YN FL                  LDD  I+ ++T D+++ G     ++ + H+T LG
Sbjct: 675 KIGYNRFL------------------LDDLLINIRLT-DMIINGNNECIEYEKGHDTRLG 715

Query: 873 FMGHLVLIAEEIVKFSKVYK---VDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILG 929
           +MGHL LIAEE+ KF+   +   +   + ++   L +  W  Y+ D+L D +  Y+ ILG
Sbjct: 716 YMGHLTLIAEEVTKFTAYIEEMNITFENTEVMSSLFESKWIAYTEDVLEDLKEKYNAILG 775

Query: 930 G----GDYI----EDGNLNGGDIVMGNDQDPTSFSTQMD 960
                GD +    ED   + G+  MG   D  +   QMD
Sbjct: 776 DIAEEGDMLQDEEEDAVYDKGERTMGTVDDYINDIMQMD 814

>YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3297 bp, 1098 aa]
          Length = 1098

 Score =  330 bits (846), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 213/587 (36%), Positives = 322/587 (54%), Gaps = 88/587 (14%)

Query: 396 KANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPL-IPI---FLKINQN 451
           +A I +EI + D+W IS ++++N + L ++WSIL HP      +PL IP    F+KIN+ 
Sbjct: 215 RARIAAEILSADVWPISAAIMQNKDLLGRLWSILDHP------APLPIPASTYFMKINER 268

Query: 452 LLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKL 511
           LL       L FI +RD+LV   L H+D   LMDF LK+++TDK ++PTG+I+++  Q+L
Sbjct: 269 LLDMDITGMLEFILSRDSLVARFLTHVDNPSLMDFLLKVISTDKPDSPTGVIKILKSQEL 328

Query: 512 IDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMS-IGPNALTREIASEKCIDY 570
           I  L   L N +Y    Q+ AGDFIK+ + +S N+  +  S IGPN LTR++ SE+ I+ 
Sbjct: 329 IPKLLDHL-NPEYGISTQSAAGDFIKAFVTLSTNSSNELASGIGPNELTRQLVSEEMIEK 387

Query: 571 LLGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRK 630
           L+  ++ + G +L   V I IELIRKNNSDYD + L+ TT++SHPP+ RDP++L  +++ 
Sbjct: 388 LIKIML-KGGTSLSNGVGIIIELIRKNNSDYDFIQLVYTTLESHPPTDRDPIHLIHLVKL 446

Query: 631 FSENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNS 690
           F++++ +   +L    +   +P+++   G + +PLGFERFK+ ELIAELLHCSNM L+N 
Sbjct: 447 FAKHMPDFADML----DKTKLPLMEMPFG-NIEPLGFERFKICELIAELLHCSNMTLLNE 501

Query: 691 KKAERIVKERDQVRTELVQQLEDALTDLNIKS--------------------KLTADNHN 730
              E I +ERD    E  ++LE +    NI +                     L A   N
Sbjct: 502 PNGEMIAQERD---IERAKELETSTEKENITAIVDNKSSYYDKDCVEKDITENLGALQIN 558

Query: 731 SDSPTELSLDD--------DIDESFEV---------------PYVNDNQNAK--LRSNPT 765
           +    E  L+D        D+    +V                 ++D ++ +  LR  P 
Sbjct: 559 NQGSEEDELNDTGVSSVKLDVKSDAKVVEGLENDASGVELYDETLSDTESVRECLREKPL 618

Query: 766 IGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALF 825
           +GD  KI L ++++L  I+ +F ++PWNNF HNVIFDI QQIFNG +   YN FL     
Sbjct: 619 VGDRLKIALEDTKILISILDMFTEFPWNNFLHNVIFDIAQQIFNGPLKTGYNRFL----- 673

Query: 826 SNKNAERFATDKTLDDAPIDFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIV 885
                        L D  +D  +T+ +V    +    + +K     G+MGHL L+AEEI 
Sbjct: 674 -------------LKDYLVDAYLTKKIVDAD-KACQDYEKKTGLRYGYMGHLTLVAEEIS 719

Query: 886 KFSKV---YKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILG 929
           KF +     K+   +  + + L +  W  YS  IL DTR  Y+ +LG
Sbjct: 720 KFKEYIDEMKLTFCNTAVSDRLEEPFWKEYSETILADTREKYNTVLG 766

>Kwal_26.7346
          Length = 747

 Score =  311 bits (796), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 181/493 (36%), Positives = 280/493 (56%), Gaps = 50/493 (10%)

Query: 461 LNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLFAFLV 520
           L+FI  +DNLV   LKHID   LMD+ LK+++TDK +  TG+IE +  Q LI  L   L 
Sbjct: 2   LHFILAQDNLVDRFLKHIDNPPLMDYLLKVISTDKPDTTTGVIERLDSQDLIPKLLDHLA 61

Query: 521 NEKYSADIQACAGDFIKSIIAVSANAPLDEMS-IGPNALTREIASEKCIDYLLGCIINER 579
           +  +S   ++ AGDF+K++I +SAN+  +  S IGPN LTR++ S   ++ L+  +++  
Sbjct: 62  S-VHSPSTKSAAGDFLKALITISANSNNEIASAIGPNGLTRKLVSPSMVEKLMNIMLS-G 119

Query: 580 GPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENLVNLK 639
           G +L   V I IELIRKNNSDYD V ++ TT+++HPP+ RDP+YLG +++  +++L    
Sbjct: 120 GTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLIKCSAKHLPEFN 179

Query: 640 QILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKE 699
           +IL + E    +P ++   G S +PLGFERFK+ EL+AELLHCSNM L+N    E IV E
Sbjct: 180 KILVETE----LPPLETPFG-SIEPLGFERFKICELVAELLHCSNMTLLNEPNGEEIVSE 234

Query: 700 RDQVRTELVQQLE------------------DALTDLNIKSKLTADNHNSDSPTELSLDD 741
           RD VR + +   +                  D ++DL I +  ++ +   ++      DD
Sbjct: 235 RDAVREKSLHAEQTDNNEGTADTEDESEDVLDKMSDLRIATTTSSSSDEDNNSHMKEDDD 294

Query: 742 DIDESFEVPYVNDNQ--NAKLRSNPTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHNV 799
           ++          D++     LR NP +GD  KI L +++++  I+++F  +PWNNF HNV
Sbjct: 295 EVGGEIHSEGSADSEIPEKVLRENPVVGDQLKIALQDNRVITTILEMFFAFPWNNFLHNV 354

Query: 800 IFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDDAPIDFQITRDLVLLGYRN 859
           +FDI+QQIFNG +   +N FL+  LF+                    ++T  +++ G + 
Sbjct: 355 VFDIVQQIFNGPLKTGFNRFLIADLFTGA------------------KLTH-MIMEGDKK 395

Query: 860 SHKFYEKHNTTLGFMGHLVLIAEEIVKFSKV---YKVDLISPDIHEVLLDEDWDFYSNDI 916
              +  +    LG+MGHL LIAEE+ KF+      K+   +  I + L +  W  Y+  +
Sbjct: 396 CEDYENETGLRLGYMGHLTLIAEEVAKFAAYVEEMKISFSNQAITDSLDEPSWKEYTETV 455

Query: 917 LNDTRIMYSKILG 929
           L DTR  YS +LG
Sbjct: 456 LADTRENYSSVLG 468

>Scas_675.36
          Length = 557

 Score =  163 bits (412), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 118/339 (34%), Positives = 167/339 (49%), Gaps = 76/339 (22%)

Query: 665 LGFERFKVVELIAELLHCSNMGLMNSKKAERIVKERDQVRTELVQQLED----------- 713
           LGFE+FK+ ELIAELLHCSNM L+N    E IV ERD  R ++  Q ED           
Sbjct: 1   LGFEKFKICELIAELLHCSNMTLLNEPNGEAIVTERDLERVKMFSQEEDNDMNGTADLQE 60

Query: 714 -------------------ALTDLNIKSKLTADNHNSDSPTE--------LSLDDDID-- 744
                               L  L I+ +      N +  TE        ++ +D++D  
Sbjct: 61  EIEENSVAEKSSNGGEVTEKLNKLKIEPEQIISETNEEIETEHEDNDTDPVNTNDELDVA 120

Query: 745 ----ESFEV--PYVNDNQ--NAKLRSNPTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFW 796
               E+ E+    ++D++   A LR NP  GD  KI L  + ++  I+++F  + WNNF 
Sbjct: 121 NGEVETAEIYDETLSDSEATEALLRENPIPGDQLKISLRETGIIRTILEMFFHFEWNNFL 180

Query: 797 HNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDDAPIDFQITRDLVLLG 856
           HNV+FDI+QQIFNG +  +YN FL+  L +                    +I   LVL G
Sbjct: 181 HNVVFDIVQQIFNGPLRTTYNRFLLGDLLTGS------------------EIIH-LVLDG 221

Query: 857 YRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKV---YKVDLISPDIHEVLLDEDWDFYS 913
            +      EKH   +G+MGHL+LIAEEI KF +     K+   +P I E L +  W  Y 
Sbjct: 222 DKKCAAQQEKHGLRIGYMGHLMLIAEEIAKFIEYIEEMKISFSNPAIQECLNEPQWREYM 281

Query: 914 NDILNDTRIMYSKILGGGDYI-EDGNLNGGDIVMGNDQD 951
             IL DTR+ Y+ +L  GD++ EDG+   GD++   D D
Sbjct: 282 ATILADTRVKYNTVL--GDFVSEDGS---GDLIHNADLD 315

>Kwal_26.7343
          Length = 282

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 10/73 (13%)

Query: 396 KANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPI----FLKINQN 451
           +A + +EI + D+W IS + + + E L+++WS+L HP      +PL  +    F+KIN+ 
Sbjct: 213 RARMAAEILSADVWPISSAFMDHEELLSQLWSMLDHP------APLSIVASTYFMKINER 266

Query: 452 LLLTRQDQYLNFI 464
           LL       L+FI
Sbjct: 267 LLDMDIAGMLHFI 279

>CAGL0K12650g complement(1251907..1253265) highly similar to
           sp|P02557 Saccharomyces cerevisiae YFL037w TUB2, start
           by similarity
          Length = 452

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 65/149 (43%), Gaps = 14/149 (9%)

Query: 574 CIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSE 633
           CI NE   AL      T++L + + +D +  NL+++ +     S+R P  L   LRK + 
Sbjct: 201 CIDNE---ALYEICQTTLKLNQPSYNDLN--NLVSSVMSGVTTSLRYPGQLNSDLRKLAV 255

Query: 634 NLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKA 693
           NLV   ++ F +   A +  I +Q         F    V EL  ++    NM      + 
Sbjct: 256 NLVPFPRLHFFMVGYAPLTAIGSQ--------SFRSLTVPELTQQMFDSKNMMAAADPRN 307

Query: 694 ERIVKERDQVRTEL-VQQLEDALTDLNIK 721
            R +      R ++ V+++ED +  +  K
Sbjct: 308 GRYLTVAAFFRGKVSVKEVEDEMHKVQTK 336

>ACR225C [1272] [Homologous to ScYFL037W (TUB2) - SH]
           (751367..752704,752871..752882) [1350 bp, 449 aa]
          Length = 449

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 65/149 (43%), Gaps = 14/149 (9%)

Query: 574 CIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSE 633
           CI NE   AL      T++L + + SD +  NL+++ +     S+R P  L   LRK + 
Sbjct: 201 CIDNE---ALYDICQRTLKLPQPSYSDLN--NLVSSVMSGVTTSLRYPGQLNSDLRKLAV 255

Query: 634 NLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKA 693
           NLV   ++ F +   A +  I  Q         F    V EL  ++    NM   +  + 
Sbjct: 256 NLVPFPRLHFFMVGYAPLTSIGAQ--------SFRALTVPELTQQMFDARNMMAASDPRN 307

Query: 694 ERIVKERDQVRTEL-VQQLEDALTDLNIK 721
            R +      R ++ V+++ED +  +  +
Sbjct: 308 GRYLTVAAFFRGKVSVKEVEDEMHKVQTR 336

>Scas_656.21*
          Length = 473

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 83/200 (41%), Gaps = 23/200 (11%)

Query: 574 CIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSE 633
           CI NE   AL      T++L + + +D +Q  L+++ +     S+R P  L   LRK + 
Sbjct: 199 CIDNE---ALYNICQRTLKLTQPSYNDLNQ--LVSSVMSGVTTSLRYPGQLNSDLRKLAV 253

Query: 634 NLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKA 693
           NLV   ++ F +   A +  +  Q         F    V EL  ++    NM      + 
Sbjct: 254 NLVPFPRLHFFMIGYAPLTAMNAQ--------SFRSLSVPELTQQMFDSKNMMAAADPRN 305

Query: 694 ERIVKERDQVRTEL-VQQLEDALTDLNIKSKLTADNHNSDSPTELSLDDDIDESFEVPYV 752
            R +      R  + V+++ED +  + ++        NSD   E   ++       VP  
Sbjct: 306 GRYLTVAALFRGNVSVKEVEDEMYKVQLR--------NSDYFVEWIPNNVQTSVCSVPPK 357

Query: 753 NDNQNAKLRSNPT-IGDLFK 771
           N + +A    N T I +LF+
Sbjct: 358 NSDISATFIGNSTSIKELFQ 377

>YFL037W (TUB2) [1646] chr6 (56335..57708) Tubulin beta chain,
           required for mitosis and karyogamy [1374 bp, 457 aa]
          Length = 457

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 14/149 (9%)

Query: 574 CIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSE 633
           CI NE   AL      T++L + +  D +  NL+++ +     S+R P  L   LRK + 
Sbjct: 201 CIDNE---ALYDICQRTLKLNQPSYGDLN--NLVSSVMSGVTTSLRYPGQLNSDLRKLAV 255

Query: 634 NLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKA 693
           NLV   ++ F +   A +  I +Q         F    V EL  ++    NM      + 
Sbjct: 256 NLVPFPRLHFFMVGYAPLTAIGSQ--------SFRSLTVPELTQQMFDAKNMMAAADPRN 307

Query: 694 ERIVKERDQVRTEL-VQQLEDALTDLNIK 721
            R +      R ++ V+++ED +  +  K
Sbjct: 308 GRYLTVAAFFRGKVSVKEVEDEMHKVQSK 336

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 66/159 (41%), Gaps = 37/159 (23%)

Query: 757 NAKLRSNPTIGDL---FKIELYNSQLLPIII-------QLFIKYPWNNFWHNVIFDIIQQ 806
           N K R+   I DL   + +   +   +P+++        LF  Y WN+FW  +I+  + +
Sbjct: 201 NPKHRARADIADLTDDWIVRWQHRNYIPLMLFSAFILPALFCHYMWNDFWGGLIYGGVLR 260

Query: 807 IFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDD--APIDFQITRDLVLLG-------- 856
           +            +  A F   +   +  D+  DD   P D  IT  LV  G        
Sbjct: 261 V----------CAIQQATFCINSLAHYLGDQPFDDRRTPRDNWIT-ALVTFGEGYHNFHH 309

Query: 857 -----YRNSHKFYEKHNT-TLGFMGHLVLIAEEIVKFSK 889
                YRN+ K+Y+   T  L ++  L  ++ ++ KFS+
Sbjct: 310 EFPTDYRNAIKWYQYDPTKVLIYLTSLFGLSYDLKKFSQ 348

>Sklu_2144.1 YFL037W, Contig c2144 366-1367 reverse complement
          Length = 333

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 14/149 (9%)

Query: 574 CIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSE 633
           CI NE   AL      T++L + + SD +  +L+++ +     S+R P  L   LRK + 
Sbjct: 85  CIDNE---ALYDICQRTLKLTQPSYSDLN--HLVSSVMSGVTTSLRYPGQLNSDLRKLAV 139

Query: 634 NLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKA 693
           NLV   ++ F +   A +  I +Q         F    V EL  ++    NM   +  + 
Sbjct: 140 NLVPFPRLHFFMVGYAPLTSIGSQ--------SFRSLTVPELTQQMFDAKNMMAASDPRN 191

Query: 694 ERIVKERDQVRTEL-VQQLEDALTDLNIK 721
            R +      R ++ V+++ED +  +  +
Sbjct: 192 GRYLTVAAFFRGKVSVKEVEDEMHKVQTR 220

>YER014W (HEM14) [1437] chr5 (182599..184218) Protoporphyrinogen
           oxidase, converts protoporphyrinogen to protoporphyrin
           during heme biosynthesis [1620 bp, 539 aa]
          Length = 539

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 516 FAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYLLGCI 575
           F +LV  K + +     G    S+I  +     D++S  PNAL +     K    + GC+
Sbjct: 381 FGYLV-PKSNKNPGKLLGVIFDSVIERNFKPLFDKLSTNPNALNKYT---KVTAMIGGCM 436

Query: 576 INERGPALMTAVSITIELIR 595
           +NE G  ++ +  +TI  ++
Sbjct: 437 LNEHGVPVVPSREVTINAVK 456

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,410,863
Number of extensions: 1406421
Number of successful extensions: 7133
Number of sequences better than 10.0: 105
Number of HSP's gapped: 7246
Number of HSP's successfully gapped: 128
Length of query: 978
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 867
Effective length of database: 12,753,511
Effective search space: 11057294037
Effective search space used: 11057294037
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)