Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01133g27727314380.0
Sklu_2433.162992278061e-108
Scas_687.183132657477e-99
Kwal_47.191983002497215e-95
YFR041C2952476692e-87
CAGL0C02123g2972336693e-87
AFR246C2882415632e-71
YMR161W (HLJ1)224641122e-06
Kwal_14.2452607951125e-06
KLLA0E01628g231641096e-06
CAGL0F03729g361741098e-06
AFL190C235631061e-05
YNL064C (YDJ1)409701071e-05
Scas_692.34375671062e-05
CAGL0H04499g232641007e-05
Scas_669.2224631009e-05
CAGL0J09966g407581011e-04
CAGL0I09526g29680992e-04
KLLA0C07260g36867982e-04
CAGL0L00957g37386964e-04
YMR214W (SCJ1)37767955e-04
AER346W36767955e-04
Kwal_26.902437570956e-04
Scas_471.17937868e-04
KLLA0D13464g433114948e-04
Sklu_2174.639375930.001
KLLA0D04818g35448920.001
AER427W47085920.001
YJL073W (JEM1)64588920.002
Scas_709.3414156910.002
Scas_715.2938775900.002
AAL008W34951900.002
CAGL0J02750g38290900.002
KLLA0F19184g51277900.002
ADL257C41051890.003
CAGL0J01936g425110890.003
Scas_711.4063574890.004
Scas_542.228075870.004
AFR507W47466880.004
AAL103W669112880.005
YIR004W (DJP1)43285870.005
Scas_694.2041051870.005
Sklu_2422.1067877870.006
ADR015W436133860.006
ADR124C611102870.007
CAGL0H03707g34947860.007
Kwal_23.483041163850.009
Kwal_47.1813339390840.013
YER048C (CAJ1)39176840.014
Scas_564.1*45772830.016
KLLA0F03333g40954830.017
YJL162C48283830.018
Sklu_2257.6429108830.018
Kwal_0.20735363820.020
YGL128C (CWC23)28384820.021
KLLA0E07876g49569820.022
Kwal_55.2096542171820.022
KLLA0E04345g42854820.022
Scas_695.1432751800.041
Sklu_2442.134848790.047
Kwal_33.1345128789790.049
Kwal_56.2378241487790.054
CAGL0H02827g65671790.059
YNL007C (SIS1)35247780.061
YNL227C590130780.070
CAGL0I01320g500120780.071
AGR084C42770780.072
Scas_488.336747780.074
YNL077W (APJ1)52869770.089
KLLA0D06402g63173770.092
AFR659W27377750.14
Scas_532.261655750.20
CAGL0J07964g74517740.25
Scas_651.1749176740.25
CAGL0J10296g47954730.27
KLLA0C09823g669131730.31
ADL327W30556720.33
Kwal_26.887965666710.50
YHR009C52360710.55
Kwal_56.2415148071710.59
Kwal_23.306145869700.75
CAGL0I06226g45533700.78
Kwal_26.949542875690.79
CAGL0J07370g62367690.90
CAGL0F00715g310121680.97
Kwal_33.1386057854690.98
CAGL0L12276g45235691.0
Sklu_2109.465863691.0
Sklu_2292.443269681.2
YFL016C (MDJ1)51164681.2
AGL339C43044671.8
YGR285C (ZUO1)43336662.0
ABL194C55255662.0
Scas_707.1951971662.1
CAGL0G00154g43370662.3
KLLA0C02541g27083652.3
KLLA0D19602g62067652.7
Kwal_14.159164045652.8
Scas_720.8657636653.2
Scas_653.1466965644.1
YLR090W (XDJ1)45959634.4
KLLA0F03124g43336634.4
Kwal_23.442059267644.5
KLLA0B07271g65390635.3
CAGL0G07469g668117626.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01133g
         (273 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01133g 103746..104579 similar to sp|P43613 Saccharomyces c...   558   0.0  
Sklu_2433.16 YFR041C, Contig c2433 25259-26158                        315   e-108
Scas_687.18                                                           292   7e-99
Kwal_47.19198                                                         282   5e-95
YFR041C (YFR041C) [1723] chr6 complement(237355..238242) Protein...   262   2e-87
CAGL0C02123g 215564..216457 similar to sp|P43613 Saccharomyces c...   262   3e-87
AFR246C [3438] [Homologous to ScYFR041C - SH] (883075..883941) [...   221   2e-71
YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticul...    48   2e-06
Kwal_14.2452                                                           48   5e-06
KLLA0E01628g 155088..155783 weakly similar to sp|P48353 Saccharo...    47   6e-06
CAGL0F03729g complement(362972..364057) similar to sp|P25303 Sac...    47   8e-06
AFL190C [3005] [Homologous to ScYMR161W (HLJ1) - SH] (84145..848...    45   1e-05
YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein i...    46   1e-05
Scas_692.34                                                            45   2e-05
CAGL0H04499g complement(427509..428207) similar to sp|P48353 Sac...    43   7e-05
Scas_669.2                                                             43   9e-05
CAGL0J09966g complement(976568..977791) highly similar to sp|P25...    44   1e-04
CAGL0I09526g 911127..912017 weakly similar to sp|P52868 Saccharo...    43   2e-04
KLLA0C07260g complement(632987..634093) similar to sp|P25303 Sac...    42   2e-04
CAGL0L00957g 110615..111736 similar to sp|P39101 Saccharomyces c...    42   4e-04
YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli ...    41   5e-04
AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH] complement(...    41   5e-04
Kwal_26.9024                                                           41   6e-04
Scas_471.1                                                             38   8e-04
KLLA0D13464g complement(1159251..1160552) similar to sp|P40564 S...    41   8e-04
Sklu_2174.6 YER048C, Contig c2174 7478-8659                            40   0.001
KLLA0D04818g complement(411615..412679) similar to sp|P25294 Sac...    40   0.001
AER427W [2927] [Homologous to ScYNL077W - SH] complement(1456998...    40   0.001
YJL073W (JEM1) [2839] chr10 (303097..305034) DnaJ-like protein r...    40   0.002
Scas_709.3                                                             40   0.002
Scas_715.29                                                            39   0.002
AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH] complement(3...    39   0.002
CAGL0J02750g complement(270406..271554) highly similar to sp|P39...    39   0.002
KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102 Saccha...    39   0.002
ADL257C [1484] [Homologous to ScYNL064C (YDJ1) - SH] (249514..25...    39   0.003
CAGL0J01936g complement(190181..191458) highly similar to sp|P40...    39   0.003
Scas_711.40                                                            39   0.004
Scas_542.2                                                             38   0.004
AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH] complement(...    39   0.004
AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH] complement(1...    39   0.005
YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for...    38   0.005
Scas_694.20                                                            38   0.005
Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement      38   0.006
ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH] complement(...    38   0.006
ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH] (926131..92...    38   0.007
CAGL0H03707g complement(341230..342279) highly similar to sp|P25...    38   0.007
Kwal_23.4830                                                           37   0.009
Kwal_47.18133                                                          37   0.013
YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of...    37   0.014
Scas_564.1*                                                            37   0.016
KLLA0F03333g complement(313991..315220) similar to sp|P25491 Sac...    37   0.017
YJL162C (YJL162C) [2759] chr10 complement(114176..115624) Protei...    37   0.018
Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement        37   0.018
Kwal_0.207                                                             36   0.020
YGL128C (CWC23) [1858] chr7 complement(269297..270148) Protein p...    36   0.021
KLLA0E07876g complement(709306..710793) weakly similar to sp|P53...    36   0.022
Kwal_55.20965                                                          36   0.022
KLLA0E04345g complement(400495..401781) similar to sp|P39101 Sac...    36   0.022
Scas_695.14                                                            35   0.041
Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement         35   0.047
Kwal_33.13451                                                          35   0.049
Kwal_56.23782                                                          35   0.054
CAGL0H02827g 261006..262976 similar to sp|P40358 Saccharomyces c...    35   0.059
YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein r...    35   0.061
YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member...    35   0.070
CAGL0I01320g complement(107768..109270) similar to sp|P21375 Sac...    35   0.071
AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH] (885026..88...    35   0.072
Scas_488.3                                                             35   0.074
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    34   0.089
KLLA0D06402g 547385..549280 weakly similar to sp|P40358 Saccharo...    34   0.092
AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH] complemen...    33   0.14 
Scas_532.2                                                             33   0.20 
CAGL0J07964g 777358..779595 similar to sp|P53847 Saccharomyces c...    33   0.25 
Scas_651.17                                                            33   0.25 
CAGL0J10296g complement(1004500..1005939) similar to sp|P53940 S...    33   0.27 
KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces c...    33   0.31 
ADL327W [1414] [Homologous to ScYPR061C - SH] complement(123853....    32   0.33 
Kwal_26.8879                                                           32   0.50 
YHR009C (YHR009C) [2295] chr8 complement(124103..125674) Cytopla...    32   0.55 
Kwal_56.24151                                                          32   0.59 
Kwal_23.3061                                                           32   0.75 
CAGL0I06226g 597520..598887 some similarities with sp|P46997 Sac...    32   0.78 
Kwal_26.9495                                                           31   0.79 
CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces c...    31   0.90 
CAGL0F00715g complement(80864..81796) similar to sp|P10962 Sacch...    31   0.97 
Kwal_33.13860                                                          31   0.98 
CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces...    31   1.0  
Sklu_2109.4 YOR254C, Contig c2109 4786-6762                            31   1.0  
Sklu_2292.4 YGR285C, Contig c2292 5220-6518                            31   1.2  
YFL016C (MDJ1) [1667] chr6 complement(104695..106230) Protein in...    31   1.2  
AGL339C [3973] [Homologous to ScYGR285C (ZUO1) - SH] (77330..786...    30   1.8  
YGR285C (ZUO1) [2230] chr7 complement(1061857..1063158) Zuotin (...    30   2.0  
ABL194C [398] [Homologous to ScYNL227C - SH] (42210..43868) [165...    30   2.0  
Scas_707.19                                                            30   2.1  
CAGL0G00154g 14591..15892 highly similar to sp|P32527 Saccharomy...    30   2.3  
KLLA0C02541g complement(226721..227533) weakly similar to sp|P52...    30   2.3  
KLLA0D19602g 1653096..1654958 similar to sp|P53863 Saccharomyces...    30   2.7  
Kwal_14.1591                                                           30   2.8  
Scas_720.86                                                            30   3.2  
Scas_653.14                                                            29   4.1  
YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli ...    29   4.4  
KLLA0F03124g complement(289514..290815) similar to sp|P32527 Sac...    29   4.4  
Kwal_23.4420                                                           29   4.5  
KLLA0B07271g complement(633724..635685) some similarities with s...    29   5.3  
CAGL0G07469g complement(708261..710267) similar to sp|P14906 Sac...    28   6.3  

>KLLA0A01133g 103746..104579 similar to sp|P43613 Saccharomyces
           cerevisiae YFR041c singleton, start by similarity
          Length = 277

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/273 (100%), Positives = 273/273 (100%)

Query: 1   MLSSSRPVTYALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQS 60
           MLSSSRPVTYALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQS
Sbjct: 1   MLSSSRPVTYALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQS 60

Query: 61  TSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDY 120
           TSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDY
Sbjct: 61  TSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDY 120

Query: 121 KKGGFFFNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSL 180
           KKGGFFFNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSL
Sbjct: 121 KKGGFFFNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSL 180

Query: 181 GESKLVFKESEDSEDKQLLVRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIW 240
           GESKLVFKESEDSEDKQLLVRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIW
Sbjct: 181 GESKLVFKESEDSEDKQLLVRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIW 240

Query: 241 NKTLGKFINIGTSKSQQPNKGSPNKNKRNSKIN 273
           NKTLGKFINIGTSKSQQPNKGSPNKNKRNSKIN
Sbjct: 241 NKTLGKFINIGTSKSQQPNKGSPNKNKRNSKIN 273

>Sklu_2433.16 YFR041C, Contig c2433 25259-26158
          Length = 299

 Score =  315 bits (806), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 142/227 (62%), Positives = 183/227 (80%), Gaps = 1/227 (0%)

Query: 23  CFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNP 82
           CFT +E+EIFQLQ+E++TKYG  +DFYQFLKLPKLK S S EI KNF++L+KKYHPDKN 
Sbjct: 22  CFTSEEVEIFQLQKEINTKYGEEIDFYQFLKLPKLKDSNSKEIVKNFRRLSKKYHPDKNR 81

Query: 83  KYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFFFNRVTPSVWFTFFFLY 142
           KY+KLYER+NL++++L+++  RKTYDYYLKNGFP YD+ KGGFFF RV P  WF   F+Y
Sbjct: 82  KYKKLYERLNLVSQILTNDSRRKTYDYYLKNGFPDYDFTKGGFFFKRVQPKTWFILAFIY 141

Query: 143 VLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSLGESKLVFKESEDSE-DKQLLVR 201
           V  G+IHLVLL+L NN NK RI++F+  V+EQD TN LGE +L+FK+S D E  K++LVR
Sbjct: 142 VACGLIHLVLLRLQNNGNKTRIKSFIRDVKEQDDTNGLGEKRLIFKQSADDEAGKEILVR 201

Query: 202 FGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGKFI 248
           FG+V+ +Q D S A IS +DI +PG+ D++LV+LP WIW  TLG+FI
Sbjct: 202 FGDVYAVQADGSEALISVNDIKEPGLRDSMLVRLPTWIWKCTLGRFI 248

>Scas_687.18
          Length = 313

 Score =  292 bits (747), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 183/265 (69%), Gaps = 14/265 (5%)

Query: 20  VAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPD 79
            AYCFT  EIEIFQLQ+EL  KYG  MDFY+FLKLPK   STS EI KN +KL++KYHPD
Sbjct: 24  AAYCFTTSEIEIFQLQKELENKYGKEMDFYKFLKLPKSMDSTSREIIKNLRKLSRKYHPD 83

Query: 80  KNPKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFFFNRVTPSVWFTFF 139
           KN K++KLYER+NL T+ L+++  RK+YDYYLKNGFP YD+ KGGFFF RV P  WF   
Sbjct: 84  KNKKFKKLYERLNLATQFLANDDMRKSYDYYLKNGFPDYDFSKGGFFFTRVQPKTWFILS 143

Query: 140 FLYVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSLGESKLVFKESEDSEDKQLL 199
           F+++  GVIH ++LK+  ++N++RIE FV + ++QD T  LGE +L FK+ E+ E K+L+
Sbjct: 144 FVFLFTGVIHYLILKVQASSNRRRIEGFVKQCKDQDDTQGLGEKRLSFKQHEEDEAKELI 203

Query: 200 VRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGKFINIGTSKS---- 255
           V+FG+V++I+ D     +S D I +P + D++L KLP W W +TLG+FI + T KS    
Sbjct: 204 VKFGQVYIIESDGMYTLVSPDSITEPTLYDSILFKLPLWFWKQTLGRFITLPTRKSVEKP 263

Query: 256 ----------QQPNKGSPNKNKRNS 270
                      +P K S N  KR +
Sbjct: 264 RPGEQVLGTASKPEKASKNDGKRTT 288

>Kwal_47.19198
          Length = 300

 Score =  282 bits (721), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 184/249 (73%), Gaps = 4/249 (1%)

Query: 23  CFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNP 82
            FT +E++IFQLQQE+  KYG  +D Y+ LKLPKL++STS +I KNF+KL+KKYHPDKN 
Sbjct: 22  AFTPEEVQIFQLQQEVKNKYGDKVDLYKLLKLPKLRESTSQDIRKNFRKLSKKYHPDKNK 81

Query: 83  KYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFFFNRVTPSVWFTFFFLY 142
            Y+K+YE INL TK+LSD+  RKTYDYYLKNGFPKYD+KKGGF+F+RV P  WF   F+Y
Sbjct: 82  NYKKVYELINLATKILSDDSQRKTYDYYLKNGFPKYDFKKGGFYFSRVQPKTWFILAFIY 141

Query: 143 VLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSLGESKLVFKESEDSEDKQLLVRF 202
           V  G+IH VLLKL N+ANK RIE F+ +VR QD TN LGE +L+F++S + E K+++VR 
Sbjct: 142 VACGLIHYVLLKLQNDANKTRIERFLREVRAQDDTNGLGEKRLLFRQSIEDEGKEIIVRL 201

Query: 203 GEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGKFINIGTSKSQQPNKGS 262
           G+VF +QPD S A+I+T+ + +PG+ D+ LV LP W W KTLG+      S      K +
Sbjct: 202 GDVFAVQPDGSEAQITTEGLKNPGLADSALVSLPLWFWKKTLGRL----ASGKNDSKKSA 257

Query: 263 PNKNKRNSK 271
           P+ +K   K
Sbjct: 258 PSTDKGTKK 266

>YFR041C (YFR041C) [1723] chr6 complement(237355..238242) Protein
           with weak similarity to dnaJ proteins Sis1p, Mdj1p, and
           Scj1p [888 bp, 295 aa]
          Length = 295

 Score =  262 bits (669), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 175/247 (70%), Gaps = 2/247 (0%)

Query: 11  ALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFK 70
           AL +    +++Y FT  E EIFQLQ E+ TKYG +M+FY+FLKLPKL+ S++ EITKN +
Sbjct: 8   ALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLR 67

Query: 71  KLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFFFNRV 130
           KL+KKYHPDKNPKYRKLYER+NL T++LS+  +RK YDYYL+NGFP YD+ KGGF+F+R+
Sbjct: 68  KLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRM 127

Query: 131 TPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSLGESKLVFKES 190
            P  WF   F++++  +   ++  +   + + RIENF+++ ++QD TN LG  +L FK+ 
Sbjct: 128 KPKTWFLLAFIWIVVNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVKQLTFKQH 187

Query: 191 EDSEDKQLLVRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGKFINI 250
           E  E K L+VRF +V+V++PD S   IS D +  P + + L  ++P  +WN T GK  ++
Sbjct: 188 EKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGK--SV 245

Query: 251 GTSKSQQ 257
           G++  ++
Sbjct: 246 GSAGKEE 252

>CAGL0C02123g 215564..216457 similar to sp|P43613 Saccharomyces
           cerevisiae YFR041c, start by similarity
          Length = 297

 Score =  262 bits (669), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 125/233 (53%), Positives = 163/233 (69%), Gaps = 3/233 (1%)

Query: 22  YCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN 81
           YCFT +E+EIFQLQ+E+  KYG   DFY+FLKLP  K ST  +I KN +KLA+KYHPDKN
Sbjct: 19  YCFTAEEVEIFQLQKEIAKKYG---DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN 75

Query: 82  PKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFFFNRVTPSVWFTFFFL 141
           PK++KLY R+NL TK+L++   RKTYDYYLKNGFP YD+ KGGFFF R  P  WF   F+
Sbjct: 76  PKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFV 135

Query: 142 YVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSLGESKLVFKESEDSEDKQLLVR 201
            ++A   H ++LKL  N+N++RI  F+   +EQDTT+ LGE  L FK+ ED   K+L++R
Sbjct: 136 LLVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLFFKQHEDDPGKELVLR 195

Query: 202 FGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGKFINIGTSK 254
           FG+VFVI+ D S + IS D I +P + D LL K    + N+T+GK     T K
Sbjct: 196 FGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGKLFKSTTKK 248

>AFR246C [3438] [Homologous to ScYFR041C - SH] (883075..883941) [867
           bp, 288 aa]
          Length = 288

 Score =  221 bits (563), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 154/241 (63%), Gaps = 5/241 (2%)

Query: 11  ALFLSLFAA----VAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEIT 66
           A F+ L AA    +   FT DE EIF LQ+ L  KYG +M+ Y+FLKL KL++S   EIT
Sbjct: 3   ARFVWLIAAGLLAIVNGFTADEAEIFNLQKVLTDKYGKDMNLYRFLKLEKLEKSDGREIT 62

Query: 67  KNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFF 126
           +  + LAKKYHPDKNPKY+KLYER++L  ++L+D   RKTYDYYL  GFP+Y   K GF 
Sbjct: 63  RQMRALAKKYHPDKNPKYKKLYERLHLAAQILTDGEKRKTYDYYLDYGFPEYRVDKRGFV 122

Query: 127 FNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSLGESKLV 186
           F RV P  W    F+ V    IH  +LKL + +  +R+E F+ +V+EQD T  LGE +L 
Sbjct: 123 FQRVQPKTWVVLAFVLVATSAIHWTVLKLQHRSRVRRVEGFLREVKEQDDTLGLGEKRLQ 182

Query: 187 FKESEDSEDKQLLVRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGK 246
            +   DS+ ++++VRFG+VFV+Q + +  +I  +++  PG+ DTL+  LP W   +    
Sbjct: 183 LQLG-DSDPQEVVVRFGDVFVVQENNTETRICAEELRAPGLLDTLMFALPMWAVGRVRAP 241

Query: 247 F 247
           F
Sbjct: 242 F 242

>YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticulum
           membrane protein, member of the DnaJ family of putative
           protein chaperones [675 bp, 224 aa]
          Length = 224

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN--PKYRKLYERINLITKLLSDEGHR 104
           +FY+ LK+ +  ++T +EI K ++KLA K HPDKN  PK  + ++ IN   ++LS+E  R
Sbjct: 21  EFYEILKVDR--KATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKR 78

Query: 105 KTYD 108
             YD
Sbjct: 79  SIYD 82

>Kwal_14.2452
          Length = 607

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 13/95 (13%)

Query: 44  SNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNP--------KYRKLYERINLIT 95
           S  ++Y+ L +P+  Q+T  +I K++  + +KYHPDK          K ++    IN   
Sbjct: 502 SKKNYYKVLGVPQ--QATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAY 559

Query: 96  KLLSDEGHRKTYDYYLKNGFPKYD---YKKGGFFF 127
           ++LSDEG RK YD       P+     + +GGF F
Sbjct: 560 EILSDEGKRKEYDDQRSGRAPQGQGSPFGQGGFPF 594

>KLLA0E01628g 155088..155783 weakly similar to sp|P48353
           Saccharomyces cerevisiae YMR161w HLJ1, start by
           similarity
          Length = 231

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 43/64 (67%), Gaps = 4/64 (6%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN--PKYRKLYERINLITKLLSDEGHR 104
           +FY+ LK+   K ++ ++I K ++KLA K HPDKN  P+  + +++IN   ++LSD+  R
Sbjct: 22  EFYEMLKV--GKSASESDIKKAYRKLAIKLHPDKNRHPRASEAFKKINRAFEVLSDDSKR 79

Query: 105 KTYD 108
           + +D
Sbjct: 80  RIFD 83

>CAGL0F03729g complement(362972..364057) similar to sp|P25303
           Saccharomyces cerevisiae YMR214w SCJ1, hypothetical
           start
          Length = 361

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 45  NMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER---INLITKLLSDE 101
           + D+Y  L L K   ++  EI   +++L+KKYHPDKNP   + + +   +     +L D 
Sbjct: 18  SQDYYAILGLSK--DASDKEIKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDP 75

Query: 102 GHRKTYDYYLKNGF 115
             RKTYD +  + F
Sbjct: 76  EKRKTYDVHGADAF 89

>AFL190C [3005] [Homologous to ScYMR161W (HLJ1) - SH] (84145..84852)
           [708 bp, 235 aa]
          Length = 235

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 42/63 (66%), Gaps = 4/63 (6%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN--PKYRKLYERINLITKLLSDEGHRK 105
           FY+ L++ +  +++  +I K ++K+A K HPDKN  P+  + ++++N   ++LSDE  R+
Sbjct: 25  FYELLQVDE--KASDGDIKKAYRKMAIKLHPDKNRHPRAAEAFKKVNRAFEVLSDEKKRR 82

Query: 106 TYD 108
            YD
Sbjct: 83  VYD 85

>YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein
           involved in protein import into mitochondria and ER,
           homolog of E. coli DnaJ [1230 bp, 409 aa]
          Length = 409

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNP--KYRKLYERINLITKLLSDEGHRK 105
           FY  L +P    +T  EI K ++K A KYHPDKNP  +  + ++  +   ++LSD   R 
Sbjct: 7   FYDILGVPVT--ATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRD 64

Query: 106 TYDYYLKNGF 115
            YD + ++G 
Sbjct: 65  IYDQFGEDGL 74

>Scas_692.34
          Length = 375

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 5/67 (7%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER---INLITKLLSDEGH 103
           D+YQ L +   K +T  EI   +++L+KK+HPDKNP     +++   +    ++LSD   
Sbjct: 21  DYYQILGI--AKDATDKEIKSAYRQLSKKFHPDKNPGNEDAHQKFIEVGEAYEVLSDPQK 78

Query: 104 RKTYDYY 110
           R+T+D +
Sbjct: 79  RQTFDQF 85

>CAGL0H04499g complement(427509..428207) similar to sp|P48353
           Saccharomyces cerevisiae YMR161w HLJ1, start by
           similarity
          Length = 232

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 6/64 (9%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITK---LLSDEGHR 104
           FY  L + +   S+  +I K ++KLA K HPDKNP Y K +E   LI +   +LSD   R
Sbjct: 22  FYDILNVER--SSSDVDIKKAYRKLAIKLHPDKNP-YPKAHEAFKLINRAFEVLSDSQKR 78

Query: 105 KTYD 108
           + YD
Sbjct: 79  QIYD 82

>Scas_669.2
          Length = 224

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 4/63 (6%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN--PKYRKLYERINLITKLLSDEGHRK 105
           FY+ LK+ K   +   EI K ++KLA K HPDKN  PK  + ++ IN   ++LSD   R+
Sbjct: 23  FYEILKVEKT--ANDNEIKKAYRKLAVKLHPDKNPHPKASEAFKIINRAFEVLSDVEKRQ 80

Query: 106 TYD 108
            YD
Sbjct: 81  LYD 83

>CAGL0J09966g complement(976568..977791) highly similar to sp|P25491
           Saccharomyces cerevisiae YNL064c YDJ1, start by
           similarity
          Length = 407

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 60  STSAEITKNFKKLAKKYHPDKNP--KYRKLYERINLITKLLSDEGHRKTYDYYLKNGF 115
           ++ AEI K ++K A KYHPDKNP  +  + ++ ++   ++LSD   R+ YD + + G 
Sbjct: 17  ASDAEIKKAYRKSALKYHPDKNPSEEAAEKFKEVSSAYEILSDSQKREVYDQFGEEGL 74

>CAGL0I09526g 911127..912017 weakly similar to sp|P52868
           Saccharomyces cerevisiae YGL128c, hypothetical start
          Length = 296

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 8/80 (10%)

Query: 40  TKYGSNMDFYQFLKL------PKLKQSTSAEITKNFKKLAKKYHPDKN--PKYRKLYERI 91
           T  G  +D Y+ L+L           +T+  + K ++KL+ +YHPDKN  P+Y   +  +
Sbjct: 7   TVIGQRLDLYKLLELNYKDYKGNDDAATTHSLKKQYRKLSLRYHPDKNPGPEYIDRFHLL 66

Query: 92  NLITKLLSDEGHRKTYDYYL 111
           NL   +L+D   +  YD ++
Sbjct: 67  NLAITVLADPAKKAEYDQWV 86

>KLLA0C07260g complement(632987..634093) similar to sp|P25303
           Saccharomyces cerevisiae YMR214w SCJ1 homolog of E. coli
           DnaJ, functions in the endoplasmic reticulum by
           interaction with KAR2P, start by similarity
          Length = 368

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER---INLITKLLSDEGH 103
           D+Y  L + K  Q++  EI   +++L+KKYHPDKNP   + +     +     +LSD   
Sbjct: 20  DYYAILGVDK--QASEKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEK 77

Query: 104 RKTYDYY 110
           R+ YD +
Sbjct: 78  RQIYDRH 84

>CAGL0L00957g 110615..111736 similar to sp|P39101 Saccharomyces
           cerevisiae YER048c CAJ1, start by similarity
          Length = 373

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 13/86 (15%)

Query: 59  QSTSAEITKNFKKLAKKYHPDK---NPKYRKLYERINLITKLLSDEGHRKTYDYYLK-NG 114
           ++TSAEI K +++ A + HPDK   +P  +  ++ +    ++LSD+  RK YD   K + 
Sbjct: 16  EATSAEIKKAYRRRAMETHPDKHPNDPNAQAKFQAVGEAYQVLSDDELRKRYDQLGKESA 75

Query: 115 FPKYDYKKGGFFFNRVTPSVWFTFFF 140
            P+      GF    V PS +FT  F
Sbjct: 76  VPQQ-----GF----VDPSEYFTAIF 92

>YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli
           DnaJ, functions in the endoplasmic reticulum by
           interaction with Kar2p [1134 bp, 377 aa]
          Length = 377

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 5/67 (7%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER---INLITKLLSDEGH 103
           D+Y  L++ K   +T  EI   +++L+KKYHPDKN    + +++   +     +LSD   
Sbjct: 23  DYYAILEIDK--DATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEK 80

Query: 104 RKTYDYY 110
           +K YD +
Sbjct: 81  KKIYDQF 87

>AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH]
           complement(1271436..1272539) [1104 bp, 367 aa]
          Length = 367

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYE---RINLITKLLSDEGH 103
           D+Y  L + +  ++T  +I   +++L+KKYHPDKNP     +     +    + LSD   
Sbjct: 21  DYYAILGVDR--EATEKDIKSAYRQLSKKYHPDKNPGDTTAHHNFIEVGEAYEALSDPEK 78

Query: 104 RKTYDYY 110
           R+ YD Y
Sbjct: 79  RRIYDQY 85

>Kwal_26.9024
          Length = 375

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 44  SNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER---INLITKLLSD 100
           +  D+Y  L + K   ++  EI   +++L+KK+HPDKNP     + +   +    ++LSD
Sbjct: 22  AAQDYYGILGVSK--DASDKEIKSAYRQLSKKFHPDKNPGDEDAHHKFIEVGEAYEVLSD 79

Query: 101 EGHRKTYDYY 110
           +  R+ YD +
Sbjct: 80  DQKRQIYDQH 89

>Scas_471.1
          Length = 79

 Score = 37.7 bits (86), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 46 MDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNP 82
           D+YQ L +   K +T  EI   +++L+KK+HPDKNP
Sbjct: 35 QDYYQILGI--AKDATDKEIKSAYRQLSKKFHPDKNP 69

>KLLA0D13464g complement(1159251..1160552) similar to sp|P40564
           Saccharomyces cerevisiae YIR004w DJP1 DnaJ-like protein
           involved specifically in peroxisomal protein import,
           start by similarity
          Length = 433

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKLYERINLIT---KLLSDEGHRKTYDYYLK-NGFPKYD 119
           +I K ++K + K HPDKNP      ER   I+   ++LS E  R  YD + K    PK  
Sbjct: 21  DIKKAYRKKSVKEHPDKNPDDPTATERFQAISEAYQVLSSEELRMKYDKFGKEEAMPKNG 80

Query: 120 YKKGGFFFNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKRIENFVAKVRE 173
           ++  G  F  +     FT +       +  L LLK   N  +   E+  AK +E
Sbjct: 81  FEDAGEQFAAIFGGEAFTSY-------IGELTLLKNIQNTQELSEEDERAKEQE 127

>Sklu_2174.6 YER048C, Contig c2174 7478-8659
          Length = 393

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 60  STSAEITKNFKKLAKKYHPDK---NPKYRKLYERINLITKLLSDEGHRKTYDYYLK-NGF 115
           +T  EI K ++K A   HPDK   +P  +  ++ +    ++LSD G R  YD + K +  
Sbjct: 17  ATPTEIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSDPGLRSRYDEFGKDDAV 76

Query: 116 PKYDYKKGGFFFNRV 130
           P+  ++  G FF  +
Sbjct: 77  PQQGFEDAGEFFTTI 91

>KLLA0D04818g complement(411615..412679) similar to sp|P25294
           Saccharomyces cerevisiae YNL007c SIS1 heat shock
           protein, start by similarity
          Length = 354

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%)

Query: 63  AEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYY 110
           AEI K ++K A KYHPDK     + ++ I+   ++LSD   R+ YD Y
Sbjct: 20  AEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAQKREVYDTY 67

>AER427W [2927] [Homologous to ScYNL077W - SH]
           complement(1456998..1458410) [1413 bp, 470 aa]
          Length = 470

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 5/85 (5%)

Query: 61  TSAEITKNFKKLAKKYHPDKNPKYRKLYERINLIT---KLLSDEGHRKTYDYY--LKNGF 115
           ++AE+ K++K  A +YHPDKN       +R   I    ++L DE  RK YD Y  +  G 
Sbjct: 18  SAAELKKSYKLAALRYHPDKNGHSEASKQRFQQIADAYRVLGDERLRKIYDRYGTVDEGE 77

Query: 116 PKYDYKKGGFFFNRVTPSVWFTFFF 140
                         +TP   F  FF
Sbjct: 78  VAAMAAAERRHAGGITPGDLFAHFF 102

>YJL073W (JEM1) [2839] chr10 (303097..305034) DnaJ-like protein
           required for the nuclear fusion step of karyogamy [1938
           bp, 645 aa]
          Length = 645

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 14/88 (15%)

Query: 42  YGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK-----NPKYRKLYE---RINL 93
           Y    D+Y+ L +     ++S EI K +  L KKYHPDK     N K   ++E   +IN 
Sbjct: 533 YDPKKDYYKILGVSP--SASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINE 590

Query: 94  ITKLLSDEGHRKTYDYY----LKNGFPK 117
             + LSD+  RK YD       +N FP+
Sbjct: 591 AYETLSDDDKRKEYDLSRSNPRRNTFPQ 618

>Scas_709.3
          Length = 414

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 71/156 (45%), Gaps = 21/156 (13%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYERINLIT---KLLSDEGHR 104
           +Y+ L +     +T+ EI K ++K + + HPDKNP      ER   I+   ++LSD+  R
Sbjct: 7   YYELLGISP--SATAIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSDDTLR 64

Query: 105 KTYDYY-LKNGFPKYDYKKGGFFFNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKR 163
             YD Y  K   P   ++     F+ +     F+ +       +  L LLK     N ++
Sbjct: 65  LKYDKYGKKEAVPTGGFEDAAEQFSAIFGGDAFSSY-------IGELTLLK-----NLQK 112

Query: 164 IENFVAKVREQDTTNSLGESK-LVFKES--EDSEDK 196
            E   A+   +   +  G++K  V KES  E SE K
Sbjct: 113 TEELSAQDEAEKAKDEEGKTKDEVSKESKNEQSEHK 148

>Scas_715.29
          Length = 387

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 60  STSAEITKNFKKLAKKYHPDK---NPKYRKLYERINLITKLLSDEGHRKTYDYYLKN-GF 115
           +T AEI K +++ A + HPDK   +P+ +  ++ +    ++LSD G R  YD + K+   
Sbjct: 17  ATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQVLSDPGLRSRYDEFGKDEAV 76

Query: 116 PKYDYKKGGFFFNRV 130
           P+  ++    +F  +
Sbjct: 77  PQQGFEDANEYFTAI 91

>AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH]
           complement(327127..328176) [1050 bp, 349 aa]
          Length = 349

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYY 110
           ++ AE+ K ++K A KYHPDK     + ++ I+   ++LSD   R+ YD Y
Sbjct: 17  ASDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPNKREVYDTY 67

>CAGL0J02750g complement(270406..271554) highly similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1, start by
           similarity
          Length = 382

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 48/90 (53%), Gaps = 6/90 (6%)

Query: 45  NMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK---NPKYRKLYERINLITKLLSDE 101
           + +FY  L +    ++T +EI K ++K+A   HPDK   +P+ +  ++ +    ++L+D 
Sbjct: 4   DTEFYDVLGISP--EATPSEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLNDP 61

Query: 102 GHRKTYDYYLK-NGFPKYDYKKGGFFFNRV 130
             RK YD + K N  P+  ++    +F  +
Sbjct: 62  ALRKQYDEFGKDNAVPQQGFEDAEEYFTAI 91

>KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102
           Saccharomyces cerevisiae YLR090w XDJ1, start by
           similarity
          Length = 512

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 13/77 (16%)

Query: 58  KQSTSAEITKNFKKLAKKYHPDK------NPKYRKLYERINLITKLLSDEGHRKTYDYYL 111
           K +T  EI K ++KLA KYHPDK            +++ +    ++LSD   +  YD Y 
Sbjct: 81  KDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELKSRYDMYG 140

Query: 112 K-------NGFPKYDYK 121
                   NGFP+ D++
Sbjct: 141 DSAFGSGGNGFPEDDHE 157

>ADL257C [1484] [Homologous to ScYNL064C (YDJ1) - SH]
           (249514..250746) [1233 bp, 410 aa]
          Length = 410

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPKYRKL--YERINLITKLLSDEGHRKTYD 108
           +  A+I K ++K A KYHPDKNP       +++I    ++LSD   R+ YD
Sbjct: 17  ANDAQIKKAYRKSALKYHPDKNPSEEAADKFKQITGAYEILSDSQKREMYD 67

>CAGL0J01936g complement(190181..191458) highly similar to sp|P40564
           Saccharomyces cerevisiae YIR004w DJP1, start by
           similarity
          Length = 425

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 6/110 (5%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPKYRKLYERINLIT---KLLSDEGHRKTYDYYLKN-GF 115
           +T+ EI K ++K + + HPDKNP      ER   I+   ++LS E  R  YD + K    
Sbjct: 17  ATAVEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSSEELRAKYDKFGKQEAI 76

Query: 116 PKYDYKKGGFFFNRVTPSVWFTFFF--LYVLAGVIHLVLLKLHNNANKKR 163
           PK  ++     F+ +     F  +   L +L  +     L   + A K++
Sbjct: 77  PKGGFEDAAEQFSAIFGGEAFASYIGELTLLKNLQKTEELNAEDEAQKQK 126

>Scas_711.40
          Length = 635

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 10/74 (13%)

Query: 43  GSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKY-----RKLYER---INLI 94
            SN D+Y+ L + K   + + +I K++  L KK+HPDK  +      +K+ E+   IN  
Sbjct: 523 ASNKDYYKILDVSK--DAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEA 580

Query: 95  TKLLSDEGHRKTYD 108
            ++LSDE  R  YD
Sbjct: 581 YEVLSDETKRNEYD 594

>Scas_542.2
          Length = 280

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 43/75 (57%), Gaps = 9/75 (12%)

Query: 46  MDFYQFLKLP------KLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER---INLITK 96
           ++ Y  L++P      +L +    +I K ++ LA KYHPDK+P   ++  +   +++ T 
Sbjct: 13  VNLYSVLEIPTEPRAKELSKILPTDIKKRYRTLALKYHPDKHPNEPEIVHKFYQLSVATH 72

Query: 97  LLSDEGHRKTYDYYL 111
           +L++E  +K YD +L
Sbjct: 73  ILTNEALKKRYDTWL 87

>AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH]
           complement(1347615..1349039) [1425 bp, 474 aa]
          Length = 474

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPD--KNPKYRKLYERINLITKLLSDEGHR 104
           D Y+ L +   K +++++I K + KLAK++HPD  K+    K +  +    ++LSDE  R
Sbjct: 41  DPYETLGV--AKDASASQIKKAYYKLAKQFHPDINKDEGAEKKFHDLQNAYEILSDENKR 98

Query: 105 KTYDYY 110
           + YD +
Sbjct: 99  RQYDQF 104

>AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH]
           complement(161385..163394) [2010 bp, 669 aa]
          Length = 669

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 13/112 (11%)

Query: 11  ALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFK 70
           AL +  +  V+Y   R         + LH  Y +  D Y+ L++     +T  EI   ++
Sbjct: 84  ALIIVGWVLVSYLVNR-----IASNETLHDSYKNVFDPYELLQVGS--GATDREIRSAYR 136

Query: 71  KLAKKYHPDK------NPKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFP 116
           KL+ K+HPDK      + +   L E+  LITK         T D +L+ G P
Sbjct: 137 KLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTDDATRDNFLRYGHP 188

>YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for
           peroxisomal biogenesis, has similarity to E. coli DnaJ
           and other DnaJ-like proteins [1299 bp, 432 aa]
          Length = 432

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 11/85 (12%)

Query: 45  NMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYERINLIT---KLLSDE 101
           + ++Y  L +     ++S EI K ++K + + HPDKNP      ER   I+   ++L D+
Sbjct: 4   DTEYYDLLGVSTT--ASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDD 61

Query: 102 GHRKTYDYY-LKNGFPKYDYKKGGF 125
             R  YD Y  K   P     +GGF
Sbjct: 62  DLRAKYDKYGRKEAIP-----QGGF 81

>Scas_694.20
          Length = 410

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 60  STSAEITKNFKKLAKKYHPDKNP--KYRKLYERINLITKLLSDEGHRKTYD 108
           +  +EI K ++K A KYHPDKNP  +  + ++ ++   ++LSD   R+ YD
Sbjct: 17  AGDSEIKKAYRKSALKYHPDKNPTEEGAEKFKEVSAAYEILSDSEKREIYD 67

>Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement
          Length = 678

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNP----KYRKLYERINLITKLLSDEGH 103
           +Y+ L +  +  ++  E+ K ++K A KYHPDKNP    +  + +  I L  ++LSD   
Sbjct: 5   YYELLGVESI--ASDLELKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQE 62

Query: 104 RKTYDYYLKNGFPKYDY 120
           R  YD + KN     DY
Sbjct: 63  RAWYDSH-KNQILDDDY 78

>ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH]
           complement(732201..733511) [1311 bp, 436 aa]
          Length = 436

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 20/133 (15%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKLYERINLIT---KLLSDEGHRKTYDYYLK-NGFPKYD 119
           EI K ++K + + HPDKNP   K  ER   I+   ++LS +  R  YD + K    P+  
Sbjct: 21  EIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLSSDELRAKYDKFGKEEAVPQNG 80

Query: 120 YKKGGFFFNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNS 179
           ++  G  F  +     F  +       +  L LLK     N ++ E  V    +QD    
Sbjct: 81  FEDAGEQFAAIFGGEAFASY-------IGELTLLK-----NIQKTEELV----QQDEEEK 124

Query: 180 LGESKLVFKESED 192
             E + V ++++D
Sbjct: 125 QREKQRVHEKTQD 137

>ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH]
           (926131..927966) [1836 bp, 611 aa]
          Length = 611

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 10/102 (9%)

Query: 39  HTKYGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN--------PKYRKLYER 90
           H    +  ++Y+ L +     + + +I + +  L KKYHPDK          K  +    
Sbjct: 501 HQPPSTKKNYYKILGIGN--DANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSS 558

Query: 91  INLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFFFNRVTP 132
           IN   ++LSDE  RK YD     G  ++    G  F+    P
Sbjct: 559 INEAYEVLSDESKRKEYDMLRSGGGSQHAGGNGQQFYRNSGP 600

>CAGL0H03707g complement(341230..342279) highly similar to sp|P25294
           Saccharomyces cerevisiae YNL007c SIS1 heat shock
           protein, start by similarity
          Length = 349

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYY 110
           EI K ++K A KYHPDK     + ++ I+   ++LSD   R+ YD Y
Sbjct: 21  EIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQKREVYDQY 67

>Kwal_23.4830
          Length = 411

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKL--YERINLITKLLSDEGHRK 105
           FY  L +     +  A+I K ++K A K+HPDKNP       ++ + +  ++LSD   R 
Sbjct: 7   FYDLLGVSP--DANDAQIKKAYRKQALKFHPDKNPSEEAADKFKELTVAYEILSDSQKRD 64

Query: 106 TYD 108
            YD
Sbjct: 65  IYD 67

>Kwal_47.18133
          Length = 393

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 45  NMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK---NPKYRKLYERINLITKLLSDE 101
           + ++Y  L L     +++ +I K ++K A   HPDK   +P+ +  ++ I    ++LSD 
Sbjct: 4   DTEYYDLLGLQP--DASATDIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSDP 61

Query: 102 GHRKTYDYYLK-NGFPKYDYKKGGFFFNRV 130
             R  YD + K N  P+  ++    FF  +
Sbjct: 62  DLRSRYDEFGKENAVPQQGFEDAAEFFTTI 91

>YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of E.
           coli DnaJ, has a leucine zipper [1176 bp, 391 aa]
          Length = 391

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 59  QSTSAEITKNFKKLAKKYHPDK---NPKYRKLYERINLITKLLSDEGHRKTYDYYLK-NG 114
           ++T  EI K +++ A + HPDK   +P  +  ++ +    ++LSD G R  YD + K + 
Sbjct: 16  EATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRSKYDQFGKEDA 75

Query: 115 FPKYDYKKGGFFFNRV 130
            P+  ++    +F  +
Sbjct: 76  VPQQGFEDASEYFTAI 91

>Scas_564.1*
          Length = 457

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK----NPKYRKLYE----RINLITKLL 98
           D Y  L +     +T ++I K ++KLA ++HPDK    N   R+  E     I+   ++L
Sbjct: 343 DLYAVLGV--ASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEIL 400

Query: 99  SDEGHRKTYDYY 110
           SDE  R  YD Y
Sbjct: 401 SDEDKRAHYDLY 412

>KLLA0F03333g complement(313991..315220) similar to sp|P25491
           Saccharomyces cerevisiae YNL064c YDJ1 mitochondrial and
           ER import protein, start by similarity
          Length = 409

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKL--YERINLITKLLSDEGHRKTYDYYLKNGF 115
           +I K ++K A K+HPDKNP       ++ I    ++LSD   R+ YD +   G 
Sbjct: 21  QIKKAYRKSALKFHPDKNPSEEAAEKFKEITSAYEILSDSQKREVYDQFGLEGL 74

>YJL162C (YJL162C) [2759] chr10 complement(114176..115624) Protein
           that contains a DnaJ chaperonin domain [1449 bp, 482 aa]
          Length = 482

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPD--KNPKYRKLYERINLITKLLSDEGHRK 105
           +Y  L L     +TS+E+ K++ KLA+  HPD  K+ K  +L++ +     +L+DE  + 
Sbjct: 14  YYSILGL--TSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILTDEDQKL 71

Query: 106 TYDYYLK-NGFPKYDYKKGGFFF 127
            YD  LK  G   Y  KK    F
Sbjct: 72  RYDRDLKIKGLHTYQPKKNCHIF 94

>Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement
          Length = 429

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 6/108 (5%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKLYERINLIT---KLLSDEGHRKTYDYYLK-NGFPKYD 119
           EI K ++K + + HPDKNP      ER   I+   ++LS+E  R  YD + K    P+  
Sbjct: 21  EIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQVLSNEELRTKYDKFGKEEAVPQNG 80

Query: 120 YKKGGFFFNRVTPSVWFTFFF--LYVLAGVIHLVLLKLHNNANKKRIE 165
           ++     F+ +     F  +   L +L  +     L   + A KK+ E
Sbjct: 81  FEDAAEQFSAIFGGDAFASYVGELTLLKNLQKTEELSAEDEAEKKQQE 128

>Kwal_0.207
          Length = 353

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTY 107
            Y  L +    Q T  E+ K ++K A KYHPDK     + ++ I+   ++L+D   R+ Y
Sbjct: 7   LYDLLGVSPSAQET--ELKKGYRKAALKYHPDKPSGDAEKFKEISEAFEILNDPQKREVY 64

Query: 108 DYY 110
           D Y
Sbjct: 65  DTY 67

>YGL128C (CWC23) [1858] chr7 complement(269297..270148) Protein
           possibly involved in pre-mRNA splicing, has similarity
           to E. coli DnaJ and other DnaJ-like proteins [852 bp,
           283 aa]
          Length = 283

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 36  QELHTKYGSNMDFYQFLKLPKLKQSTS-----AEITKNFKKLAKKYHPDKNPKYRKLYER 90
            EL       ++ Y  L+LP      +      +I + ++ LA KYHPDK+P    +  +
Sbjct: 4   HELEDVINQRLNLYDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIHK 63

Query: 91  INLI---TKLLSDEGHRKTYDYYL 111
            +L+   T +L++   R  YD +L
Sbjct: 64  FHLLSTATNILTNADVRPHYDRWL 87

>KLLA0E07876g complement(709306..710793) weakly similar to sp|P53940
           Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 495

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 45  NMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN---PKYRKLYERINLITKLLSDE 101
           N   Y  L++     +T  EI K ++K A K+HPDKN    +  KL++ I+   + LS+ 
Sbjct: 4   NTKLYDILEVNTT--ATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSNS 61

Query: 102 GHRKTYDYY 110
             R+ YD Y
Sbjct: 62  NKRELYDQY 70

>Kwal_55.20965
          Length = 421

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKLYERINLIT---KLLSDEGHRKTYDYYLK-NGFPKYD 119
           +I K ++K + + HPDKNP      ER   I+   ++LS E  R  YD Y K    PK  
Sbjct: 22  DIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSKEDLRAKYDKYGKEEAIPKEG 81

Query: 120 YKKGGFFFNRV 130
           ++     F+ +
Sbjct: 82  FEDAAEQFSMI 92

>KLLA0E04345g complement(400495..401781) similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1 dnaJ homolog,
           start by similarity
          Length = 428

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 60  STSAEITKNFKKLAKKYHPDKN---PKYRKLYERINLITKLLSDEGHRKTYDYY 110
           ++  EI K+++KLA K HPDKN   P+ +  ++ +    ++L D+  RK YD +
Sbjct: 17  ASPQEIKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAYQVLIDDDLRKKYDQF 70

>Scas_695.14
          Length = 327

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYY 110
           +   E+ K ++K A KYHPDK     + ++ I+   ++L+D   R+ YD Y
Sbjct: 17  ANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNTREVYDQY 67

>Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement
          Length = 348

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 63  AEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYY 110
            E+ K ++K A KYHPDK     + ++ I+   ++L+D   R+ YD Y
Sbjct: 20  GELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDSY 67

>Kwal_33.13451
          Length = 287

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 8/89 (8%)

Query: 37  ELHTKYGSNMDFYQFLKL-----PKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER- 90
           EL+  + S  + Y+ L L       L + +  +  ++F++ A K+HPDKNP       R 
Sbjct: 27  ELNAIFNSKANLYELLNLQVRNTEDLSRLSPFQFRRSFRQQALKFHPDKNPDNAAAVSRF 86

Query: 91  --INLITKLLSDEGHRKTYDYYLKNGFPK 117
             +N+   +L D   R+ Y+ +    F K
Sbjct: 87  HDLNVALNILCDPVQREKYNSWFIQTFLK 115

>Kwal_56.23782
          Length = 414

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 46  MDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK--NPKYRKLYE----RINLITKLLS 99
           MD Y  L +     +T  EI K +++LA ++HPDK  +   R+  E     +    +LLS
Sbjct: 1   MDPYDTLGV--APDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLS 58

Query: 100 DEGHRKTYDYYLK-NGFPKYDYKKGGF 125
           +E  R+ YD Y   NG   Y    GGF
Sbjct: 59  NEEKRRNYDTYGDTNG---YSDSYGGF 82

>CAGL0H02827g 261006..262976 similar to sp|P40358 Saccharomyces
           cerevisiae YJL073w JEM, start by similarity
          Length = 656

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 11/71 (15%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPK---------YRKLYERINLITKL 97
           ++YQ L +    +++  EI K +  L KKYHPDK  K           +    IN   ++
Sbjct: 541 NYYQILGIKP--EASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEV 598

Query: 98  LSDEGHRKTYD 108
           L+DE  RK YD
Sbjct: 599 LNDEEKRKEYD 609

>YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein
           required for initiation of translation, member of DnaJ
           family of protein chaperones [1059 bp, 352 aa]
          Length = 352

 Score = 34.7 bits (78), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYY 110
           E+ K ++K A KYHPDK     + ++ I+   ++L+D   R+ YD Y
Sbjct: 21  ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQY 67

>YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member of
           the DnaJ family of protein chaperones, contains two
           C2H2-type zinc finger domains [1773 bp, 590 aa]
          Length = 590

 Score = 34.7 bits (78), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 20/130 (15%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNP----KYRKLYERINLITKLLSDEGH 103
           +Y+ L +     ++  E+ K ++K A +YHPDKNP    +  + +  I    ++LSD   
Sbjct: 5   YYELLGVET--HASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQE 62

Query: 104 RKTYDYYLKNGFPKYDYKKGGFFFNRVTPSV--WFTFFFLYVLAGVIHLVLLKLHNNANK 161
           R  YD + +               N   PS   ++ +     + GV    LL   N+A  
Sbjct: 63  RAWYDSHKEQ------------ILNDTPPSTDDYYDYEVDATVTGVTTDELLLFFNSALY 110

Query: 162 KRIENFVAKV 171
            +I+N  A +
Sbjct: 111 TKIDNSAAGI 120

>CAGL0I01320g complement(107768..109270) similar to sp|P21375
           Saccharomyces cerevisiae YJR051w OSM1 osmotic growth
           protein, start by similarity
          Length = 500

 Score = 34.7 bits (78), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 48/120 (40%), Gaps = 21/120 (17%)

Query: 22  YCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN 81
           YC   D   I  + + ++T Y +N+DFY    L  +K+++  ++ KN             
Sbjct: 336 YCPKDDNRAILLMSEAVYTNYKANIDFYMSKGL--IKKASVIDMVKNL------------ 381

Query: 82  PKYRKLYERINLITKLLSDEGHRKTYDYYLK---NGFPKYDYKKGGFFFNRVTPSVWFTF 138
               K+   +  I K L       T D+  K   N F K   K    ++  +TP V FT 
Sbjct: 382 ----KITSNVEDIVKHLQHYSTASTDDFNRKLVINTFGKDVSKDTSVYYGEITPVVHFTM 437

>AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH]
           (885026..886309) [1284 bp, 427 aa]
          Length = 427

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK--NPKYRKLYE----RINLITKLLSD 100
           D Y+ L +     ++  E+ + +++LA +YHPDK  +   R+  E     I+    +LSD
Sbjct: 4   DLYEVLGI--ASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61

Query: 101 EGHRKTYDYY 110
           E  R  YD +
Sbjct: 62  EQKRAEYDQF 71

>Scas_488.3
          Length = 367

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHRKTYDYY 110
           E+ K ++K A KYHPDK     + ++ I+   ++L+D   R+ YD Y
Sbjct: 21  ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQY 67

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
           cell stress, member of the DnaJ family of predicted
           protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 34.3 bits (77), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 45  NMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN---PKYRKLYERINLITKLLSDE 101
           N   Y  L +     ++++EI K ++  A KYHPDKN    + ++ ++ I    ++L D 
Sbjct: 4   NTSLYDSLNV--TAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDN 61

Query: 102 GHRKTYDYY 110
             R  YD Y
Sbjct: 62  RLRALYDQY 70

>KLLA0D06402g 547385..549280 weakly similar to sp|P40358
           Saccharomyces cerevisiae YJL073w JEM1 singleton,
           hypothetical start
          Length = 631

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 10/73 (13%)

Query: 44  SNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK----NPKYRKLYE----RINLIT 95
           ++ D+Y+ L + K   +T  ++ +++ +L KK+HPDK    N + R+  E     IN   
Sbjct: 525 TDKDYYKILGVDK--SATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAY 582

Query: 96  KLLSDEGHRKTYD 108
           ++LSD+  R  YD
Sbjct: 583 EILSDDDKRTKYD 595

>AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH]
           complement(1640183..1641004) [822 bp, 273 aa]
          Length = 273

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 43  GSNMDFYQFLKLP-----KLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITK- 96
           G   D Y  L++      +L+   +A++   F++LA +YHPDK     +  ++   + K 
Sbjct: 11  GGGKDLYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKA 70

Query: 97  --LLSDEGHRKTYDYYL 111
             +LS+   R TY+ +L
Sbjct: 71  YDILSNSSLRATYNRWL 87

>Scas_532.2
          Length = 616

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 60  STSAEITKNFKKLAKKYHPDKNP----KYRKLYERINLITKLLSDEGHRKTYDYY 110
           +T  E+ K ++K A ++HPDKNP    +  +++  I    ++LSD   R  YD +
Sbjct: 15  ATDLELKKAYRKKALQFHPDKNPDNVDEATEIFATIRSAYEVLSDPQERAWYDAH 69

>CAGL0J07964g 777358..779595 similar to sp|P53847 Saccharomyces
           cerevisiae YNL258c, hypothetical start
          Length = 745

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 16/17 (94%)

Query: 82  PKYRKLYERINLITKLL 98
           PKYR+LYER+N++ KLL
Sbjct: 674 PKYRELYERVNIVAKLL 690

>Scas_651.17
          Length = 491

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 7/76 (9%)

Query: 48  FYQFLKL-PKLKQSTSAEITKNFKKLAKKYHPD--KNPKYRKLYERINLITKLLSDEGHR 104
           +Y  L L PK   +T  EI K++ KLA++ HPD  K+    +L++ +     +L+DE  +
Sbjct: 8   YYSILGLTPK---ATDNEIRKSYMKLARQLHPDKSKSDSCAELFKLVVHAHSILTDEETK 64

Query: 105 KTYDYYL-KNGFPKYD 119
           + YD  L   G   YD
Sbjct: 65  RKYDTQLVMRGLGAYD 80

>CAGL0J10296g complement(1004500..1005939) similar to sp|P53940
           Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 479

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 60  STSAEITKNFKKLAKKYHPDKN---PKYRKLYERINLITKLLSDEGHRKTYDYY 110
           ++   I K F   A + HPDKN    + +K ++ I+   ++LSD   R+ YD Y
Sbjct: 17  ASQVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSDPKSREMYDRY 70

 Score = 28.1 bits (61), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 52 LKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER 90
          L+    K + S E  K F++++K Y    +PK R++Y+R
Sbjct: 31 LRCHPDKNNHSEESKKQFQEISKAYEVLSDPKSREMYDR 69

>KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces
           cerevisiae YOR254c SEC63 ER protein-translocation
           complex subunit singleton, start by similarity
          Length = 669

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 55/131 (41%), Gaps = 29/131 (22%)

Query: 43  GSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYER---------INL 93
            +  D Y+ L +     ST  EI   ++KL+ K+HPDK  K     ER         IN 
Sbjct: 107 AAAFDPYELLGV--TLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINK 164

Query: 94  ITKLLSDEGHRKTYDYYLKN----------GFPKYDYKKGGFFFNRVTPSVWFTFFFLYV 143
             K L+DE  ++ Y  Y               PK+  + G       +P V F +F L  
Sbjct: 165 AYKALTDEITKENYRKYGHPDGPQSTSHGIALPKFLVEGG------TSPFVVFAYFIL-- 216

Query: 144 LAGVIHLVLLK 154
           LA V+ +V+ K
Sbjct: 217 LAFVLPMVVSK 227

>ADL327W [1414] [Homologous to ScYPR061C - SH]
           complement(123853..124770) [918 bp, 305 aa]
          Length = 305

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 9/56 (16%)

Query: 64  EITKNFKKLAKKYHPDKNPKYRKL---YER------INLITKLLSDEGHRKTYDYY 110
           ++ K + +LAK YHPD     ++    +ER      +N    LLSD   R+ YD Y
Sbjct: 107 QLKKRYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMYDMY 162

>Kwal_26.8879
          Length = 656

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 31/66 (46%), Gaps = 12/66 (18%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPKYRKLYER---------INLITKLLSDEGHRKTYDYY 110
           ST  EI   ++KL+ K+HPDK  K     ER         I    K L+DE  R+    Y
Sbjct: 128 STDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDEVTREN---Y 184

Query: 111 LKNGFP 116
           LK G P
Sbjct: 185 LKYGHP 190

>YHR009C (YHR009C) [2295] chr8 complement(124103..125674)
           Cytoplasmic protein of unknown function, associates with
           the nuclear pore complex [1572 bp, 523 aa]
          Length = 523

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 32  FQLQQELHTKY-GSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYH------PDKNPKY 84
           FQL QEL  +Y G N   Y+ L    L+     E+ +N+++L+KK +      P K P Y
Sbjct: 87  FQLHQELSDEYDGENNWDYRRLTTVSLEADVREEVIENYERLSKKAYNLNVPPPKKRPGY 146

>Kwal_56.24151
          Length = 480

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 4/71 (5%)

Query: 36  QELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYERINLIT 95
           Q LH K+     F   + L       S  +T+   KL  KYH D    +R +   I L T
Sbjct: 363 QRLHCKFS----FAPIVYLTAAHLLQSLFLTRKDNKLCCKYHLDNCQVHRLIIASIRLAT 418

Query: 96  KLLSDEGHRKT 106
           KLL D  H  T
Sbjct: 419 KLLEDCVHSHT 429

>Kwal_23.3061
          Length = 458

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 45  NMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN--PKYRKL-YERINLITKLLSDE 101
           N D Y  L +     ++  EI K ++  A K+HPDKN   +  KL +++I    ++L D+
Sbjct: 6   NNDLYDTLGV--AANASRQEIKKAYRLKALKHHPDKNGHSEQSKLKFQQICKAYEILGDD 63

Query: 102 GHRKTYDYY 110
             R+ YD +
Sbjct: 64  KKREMYDRF 72

>CAGL0I06226g 597520..598887 some similarities with sp|P46997
          Saccharomyces cerevisiae YJL162c, hypothetical start
          Length = 455

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 2/33 (6%)

Query: 48 FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK 80
          +Y  L +P    +++ EI K++ KLAKK HPDK
Sbjct: 13 YYSILGVPT--NASTNEIRKSYMKLAKKLHPDK 43

>Kwal_26.9495
          Length = 428

 Score = 31.2 bits (69), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 46  MDFYQFLKLPKLK-QSTSAEITKNFKKLAKKYHPDKNPKYRKL-----YERINLITKLLS 99
            D Y  + L KL+ ++T A+I K  +K   K+HPDK      L     ++ I    + L+
Sbjct: 95  ADLYAAMGLSKLRYRATEAQIIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYETLT 154

Query: 100 DEGHRKTYDYYLKNG 114
           D   R  YD    N 
Sbjct: 155 DSNKRAQYDSCDSNA 169

>CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces
           cerevisiae YNL227c, start by similarity
          Length = 623

 Score = 31.2 bits (69), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNP----KYRKLYERINLITKLLSDEGH 103
           +Y  L++     ++  ++ K +++ A +YHPDKNP    +   ++  I    ++LSD   
Sbjct: 5   YYDLLEVRS--DASDLDLKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQE 62

Query: 104 RKTYDYY 110
           R  YD +
Sbjct: 63  RAWYDSH 69

>CAGL0F00715g complement(80864..81796) similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16 nuclear viral
           propagation protein, hypothetical start
          Length = 310

 Score = 30.8 bits (68), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 47/121 (38%), Gaps = 26/121 (21%)

Query: 135 WFTFFF-----LYVLAGVIHLV---LLKLHNNANKKRIENFVAKVREQDTTNSLGESKLV 186
           W  FF       YV    I LV    LKL  N  +KR+     KV+ ++         LV
Sbjct: 104 WNKFFLHRCKQRYVKLSQIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRE--RKALV 161

Query: 187 FKESEDSEDKQLLVRFGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGK 246
             + E+S  K+LL R         D++L  ++ D+                 IWNK +GK
Sbjct: 162 AAKIEESISKELLNRLKSGAYSNADKTLTPLNVDEN----------------IWNKIMGK 205

Query: 247 F 247
            
Sbjct: 206 L 206

>Kwal_33.13860
          Length = 578

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPKYR--KLYERINLITKLLSDEGHRKTYDYYL 111
           +T A+I K ++K+A   HPDKN      +L++ ++    +L D+  R++Y+  L
Sbjct: 23  ATEAQIKKAYRKIAMAIHPDKNKSVSAAELFKLVSHAQSVLIDKEQRQSYNRKL 76

>CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces
          cerevisiae YLR090w, hypothetical start
          Length = 452

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 46 MDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDK 80
          MD+Y  L + +   ++  EI + ++KLA ++HPDK
Sbjct: 1  MDYYGLLGVGQ--DASQDEIKRAYRKLALRHHPDK 33

>Sklu_2109.4 YOR254C, Contig c2109 4786-6762
          Length = 658

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPK------YRKLYERINLITKLLSDEGHRKTYDYYLKN 113
           +T  E+   ++KL+ K+HPDK  K        +L E+  LITK         T + YLK 
Sbjct: 127 ATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDEITKENYLKF 186

Query: 114 GFP 116
           G P
Sbjct: 187 GHP 189

>Sklu_2292.4 YGR285C, Contig c2292 5220-6518
          Length = 432

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 6/69 (8%)

Query: 46  MDFYQFLKLPKLK-QSTSAEITKNFKKLAKKYHPDKNPKYRKLYER-----INLITKLLS 99
            D Y  + + KL+ ++T A+I K  +K   K+HPDK      L E      I    + L+
Sbjct: 96  ADLYAAMGISKLRYKATDAQIIKAHRKQVLKHHPDKKSASGGLEEDGFFKIIQKAYETLT 155

Query: 100 DEGHRKTYD 108
           D   R  YD
Sbjct: 156 DSNKRAQYD 164

>YFL016C (MDJ1) [1667] chr6 complement(104695..106230) Protein
           involved in mitochondrial (mt) biogenesis, mt protein
           folding, and protection of mt DNA synthesis activity
           (Mip1p) during heat shock, member of DnaJ family of
           protein chaperones and mitochondrial Hsp70-Hsp78
           bi-chaperone system [1536 bp, 511 aa]
          Length = 511

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPD--KNPKYRKLYERINLITKLLSDEGHR 104
           D Y  L L K   +T AEI K + KLAKKYHPD  K P   K +  +    ++LSDE  R
Sbjct: 61  DPYDTLGLKK--SATGAEIKKAYYKLAKKYHPDINKEPDAEKKFHDLQNAYEILSDETKR 118

Query: 105 KTYD 108
           + YD
Sbjct: 119 QQYD 122

>AGL339C [3973] [Homologous to ScYGR285C (ZUO1) - SH] (77330..78622)
           [1293 bp, 430 aa]
          Length = 430

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 38  LHTKYGSNMDFYQFLKLPKLK-QSTSAEITKNFKKLAKKYHPDK 80
           L  +   + D Y  + L KL+ ++T A+I K  +K   K+HPDK
Sbjct: 88  LEARDWKSADLYAAMGLSKLRYKATQAQIIKAHRKQVLKHHPDK 131

>YGR285C (ZUO1) [2230] chr7 complement(1061857..1063158) Zuotin
           (Z-DNA-binding protein), associates with Ssz1p to form
           the ribosome-associated complex (RAC), has region of
           similarity to E. coli DnaJ chaperonin [1302 bp, 433 aa]
          Length = 433

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 46  MDFYQFLKLPKLK-QSTSAEITKNFKKLAKKYHPDK 80
            D Y  + L KL+ ++T ++I K  +K   KYHPDK
Sbjct: 96  ADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPDK 131

>ABL194C [398] [Homologous to ScYNL227C - SH] (42210..43868) [1659
           bp, 552 aa]
          Length = 552

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 60  STSAEITKNFKKLAKKYHPDKN----PKYRKLYERINLITKLLSDEGHRKTYDYY 110
           ++  ++ K +++ A +YHPDKN     +  +++  I    ++LSD   R  YD +
Sbjct: 15  ASDTDLKKAYRRKALQYHPDKNIGNVQQATEIFASIRAAYEVLSDAQERAWYDAH 69

>Scas_707.19
          Length = 519

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 47  DFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPD--KNPKYRKLYERINLITKLLSDEGHR 104
           D Y+ L + K   +TS+EI K + KLAKKYHPD  K P   K +  +    ++LSDE  +
Sbjct: 51  DPYKVLGINK--SATSSEIKKAYYKLAKKYHPDINKEPTAEKKFHDLQNAYEILSDETKK 108

Query: 105 KTYDYYLKNGF 115
             YD +    F
Sbjct: 109 SQYDTFGSAAF 119

>CAGL0G00154g 14591..15892 highly similar to sp|P32527 Saccharomyces
           cerevisiae YGR285c ZUO1, start by similarity
          Length = 433

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 46  MDFYQFLKLPKLK-QSTSAEITKNFKKLAKKYHPDKNPKYRK------LYERINLITKLL 98
            D Y  + L KL+ ++T  +I K+ +K   KYHPDK   +         ++ I    + L
Sbjct: 96  ADLYAAMGLSKLRFRATENQIIKSHRKQVVKYHPDKQSAHGAGLDQDGFFKIIQKSFETL 155

Query: 99  SDEGHRKTYD 108
           +D   R+ YD
Sbjct: 156 TDVTKRRQYD 165

>KLLA0C02541g complement(226721..227533) weakly similar to sp|P52868
           Saccharomyces cerevisiae YGL128c singleton, start by
           similarity
          Length = 270

 Score = 29.6 bits (65), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 12/83 (14%)

Query: 43  GSNMDFYQFLKL-----PKLKQSTSAEITKNFKKLAKKYHPDKNPK-----YRKLYERIN 92
            +++D Y+ L +       L   T   I K F+KL+   HPDK+ +      R  ++ + 
Sbjct: 8   DNHVDLYRILHIHVNDNEHLNSVTPTLINKQFRKLSLTLHPDKSNESDLNITRDRWDNLQ 67

Query: 93  LITKLLSDEGHRKTYDYYLKNGF 115
              ++LS+  H+K YD + +  F
Sbjct: 68  SAYRILSE--HKKEYDIWYQRTF 88

>KLLA0D19602g 1653096..1654958 similar to sp|P53863 Saccharomyces
           cerevisiae YNL227c, start by similarity
          Length = 620

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN----PKYRKLYERINLITKLLSDEGH 103
           +Y  L +     +T  ++ + ++K A  YHPDKN     +  +++ +I    ++LSD   
Sbjct: 5   YYDLLDVKS--DATDTDLKRAYRKKALLYHPDKNRNNIEEATEVFAQIRAAYEVLSDAQE 62

Query: 104 RKTYDYY 110
           R  YD +
Sbjct: 63  RAWYDAH 69

>Kwal_14.1591
          Length = 640

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 12/45 (26%)

Query: 24  FTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKN 68
           +TR+E E F            N D Y F KLP  +Q   AE  KN
Sbjct: 512 YTREECETF------------NQDLYTFDKLPATRQEQLAEAAKN 544

>Scas_720.86
          Length = 576

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 20/36 (55%)

Query: 78  PDKNPKYRKLYERINLITKLLSDEGHRKTYDYYLKN 113
           PD  P  R+ +E  N+ T   S+ G+R  ++Y++  
Sbjct: 41  PDLTPAERQYWENYNVTTYFTSELGNRTAFNYHVAT 76

>Scas_653.14
          Length = 669

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLS-DEGHRKTYDYYLKNGFPKY 118
           ++  +I   ++KL+ K+HPDK  K     ER ++  K +   + +    D  +K  F KY
Sbjct: 132 ASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDEVIKENFLKY 191

Query: 119 DYKKG 123
            +  G
Sbjct: 192 GHPDG 196

>YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli
           DnaJ [1380 bp, 459 aa]
          Length = 459

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 58  KQSTSAEITKNFKKLAKKYHPDK--NPKYRKLYE----RINLITKLLSDEGHRKTYDYY 110
           + +T  EI   ++KLA K+HPDK  +   +++ E     I    ++LSD   +  YD Y
Sbjct: 18  RDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYDLY 76

>KLLA0F03124g complement(289514..290815) similar to sp|P32527
           Saccharomyces cerevisiae YGR285c ZUO1 zuotin, a putative
           Z-DNA binding protein singleton, start by similarity
          Length = 433

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 46  MDFYQFLKLPKLK-QSTSAEITKNFKKLAKKYHPDK 80
            D Y  + L KL+ ++T+ +I K  +K   KYHPDK
Sbjct: 96  ADLYAAMGLSKLRYRATNQQIIKAHRKQVLKYHPDK 131

>Kwal_23.4420
          Length = 592

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 48  FYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN----PKYRKLYERINLITKLLSDEGH 103
           +Y+ L +     ++ A++ K ++K A  YHPDKN     +   ++  I    ++L+D   
Sbjct: 5   YYELLGVETT--ASDADLKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYEVLADPQE 62

Query: 104 RKTYDYY 110
           R  YD +
Sbjct: 63  RAWYDSH 69

>KLLA0B07271g complement(633724..635685) some similarities with
           sp|P46997 Saccharomyces cerevisiae YJL162c singleton,
           hypothetical start
          Length = 653

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 14/90 (15%)

Query: 60  STSAEITKNFKKLAKKYHPDKNPKYR--KLYERINLITKLLSDEGHRKTYDY-YLKNGFP 116
           +T  +I K + KLA++ HPDK+      +L++++     +L+D+  +  YD   L  G  
Sbjct: 25  ATEVQIRKAYMKLARELHPDKSKSEEAGELFKKVAHAHFILTDKKEKMKYDSKLLAKGL- 83

Query: 117 KYDY---------KKGGFFFNRVTPSVWFT 137
            YDY         ++ G F +    S  FT
Sbjct: 84  -YDYSPRIPNDKSRQNGMFKDTAKNSKTFT 112

>CAGL0G07469g complement(708261..710267) similar to sp|P14906
           Saccharomyces cerevisiae YOR254c SEC63, start by
           similarity
          Length = 668

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 46/117 (39%), Gaps = 17/117 (14%)

Query: 8   VTYALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITK 67
           V+ AL +   AA     T+   ++F              D Y  L +     ++  +I  
Sbjct: 100 VSVALLIQRIAANTETITQSMAQMF--------------DPYDLLGISP--SASDKDIKS 143

Query: 68  NFKKLAKKYHPDKNPKYRKLYERINLITKLLS-DEGHRKTYDYYLKNGFPKYDYKKG 123
            +++L+ K+HPDK  K     ER  +    +   + H    D  ++  + KY +  G
Sbjct: 144 AYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDPIVRENYLKYGHPDG 200

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,089,415
Number of extensions: 486536
Number of successful extensions: 1924
Number of sequences better than 10.0: 135
Number of HSP's gapped: 1886
Number of HSP's successfully gapped: 136
Length of query: 273
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 173
Effective length of database: 13,134,309
Effective search space: 2272235457
Effective search space used: 2272235457
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)