Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01111g2092069201e-128
Sklu_2433.152102073807e-46
Kwal_47.192032351903523e-41
Scas_687.172222043364e-39
YFR042W2001943311e-38
CAGL0C02101g1971902806e-31
AFR247W2111962546e-27
CAGL0L03520g144764642.7
KLLA0F00330g37059624.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01111g
         (206 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01111g complement(102802..103431) similar to sp|P43614 Sac...   358   e-128
Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement     150   7e-46
Kwal_47.19203                                                         140   3e-41
Scas_687.17                                                           134   4e-39
YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknow...   132   1e-38
CAGL0C02101g complement(214712..215305) similar to sp|P43614 Sac...   112   6e-31
AFR247W [3439] [Homologous to ScYFR042W - SH] complement(884059....   102   6e-27
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    29   2.7  
KLLA0F00330g 17682..18794 similar to sp|P48581 Saccharomyces cer...    28   4.5  

>KLLA0A01111g complement(102802..103431) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w hypothetical protein
           singleton, start by similarity
          Length = 209

 Score =  358 bits (920), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 178/206 (86%)

Query: 1   MNATRRQQPRRLVVKLYQFFHISSAFXXXXXXXXXXXXXXXXSRKYLPGGIHRFLCCLMV 60
           MNATRRQQPRRLVVKLYQFFHISSAF                SRKYLPGGIHRFLCCLMV
Sbjct: 1   MNATRRQQPRRLVVKLYQFFHISSAFLYCALLVRWLVLLPLVSRKYLPGGIHRFLCCLMV 60

Query: 61  YSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIV 120
           YSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIV
Sbjct: 61  YSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIV 120

Query: 121 GLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIPXXXXXXXXXXXXNTEIDNYHN 180
           GLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIP            NTEIDNYHN
Sbjct: 121 GLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIPLLYLSEFYLLLLNTEIDNYHN 180

Query: 181 GPKTVLFNKFVLVVFIPLCLHLYKGF 206
           GPKTVLFNKFVLVVFIPLCLHLYKGF
Sbjct: 181 GPKTVLFNKFVLVVFIPLCLHLYKGF 206

>Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement
          Length = 210

 Score =  150 bits (380), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 119/207 (57%), Gaps = 6/207 (2%)

Query: 1   MNATRRQQPRR---LVVKLYQFFHISSAFXXXXXXXXXXXXXXXXSRKYLPGGIHRFLCC 57
           MNAT  +       +V +LYQ++ +S++F                  K+LPGGIH +LC 
Sbjct: 1   MNATHLKNESSGIGIVSRLYQYYRLSASFLFAALLARWLVLLPLVGTKFLPGGIHEYLCY 60

Query: 58  LMVYSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSS 117
           L++Y++ G +       GL  ++ +   LKN+N++Y VA++HFYDD+EH+P+LKN+SYSS
Sbjct: 61  LILYASFGELFCLFGFHGLFGALTSSTLLKNLNMLYFVAVMHFYDDYEHAPVLKNSSYSS 120

Query: 118 FIVGLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIPXXXXXXXXXXXXNTEIDN 177
           FI+GLSFTQMY HW ++FK          S+  +++   M+P            N +  N
Sbjct: 121 FIIGLSFTQMYCHWKKLFKHTHGR---KNSIWRKVDTLAMMPLFYLSEFYLFLLNVQNPN 177

Query: 178 YHNGPKTVLFNKFVLVVFIPLCLHLYK 204
           +H+       NKFVLV FIPL LH++K
Sbjct: 178 FHSTLLLDRLNKFVLVAFIPLSLHMFK 204

>Kwal_47.19203
          Length = 235

 Score =  140 bits (352), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 109/190 (57%), Gaps = 3/190 (1%)

Query: 15  KLYQFFHISSAFXXXXXXXXXXXXXXXXSRKYLPGGIHRFLCCLMVYSAVGNILWWIKMR 74
           +LYQ+F +SS+                   K+LPGGIH FLC LM+Y+    I+W    R
Sbjct: 43  RLYQYFRLSSSLLFAALVARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWTYAFR 102

Query: 75  GLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIVGLSFTQMYYHWNRI 134
           G   ++ +R  LK+++ +Y V ILHFYDD+EH+ +LKN SYS+FIV L  +Q Y HW ++
Sbjct: 103 GFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCHWCKL 162

Query: 135 FKGPSPEPRSSKSLASRLNAFIMIPXXXXXXXXXXXXNTEIDNYHNGPKTVLFNKFVLVV 194
           FK PS   ++  ++  +++ F+ +P            N +  N+H+     + NK VL++
Sbjct: 163 FKSPS---KNRNTILWKIDTFLTLPILYLSEFYLLLLNVQTPNFHSYHWLEIVNKVVLII 219

Query: 195 FIPLCLHLYK 204
           FIP+ LH ++
Sbjct: 220 FIPISLHAFR 229

>Scas_687.17
          Length = 222

 Score =  134 bits (336), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 117/204 (57%), Gaps = 5/204 (2%)

Query: 3   ATRRQ-QPRR-LVVKLYQFFHISSAFXXXXXXXXXXXXXXXXSRKYLPGGIHRFLCCLMV 60
           A+RR  +P+   + KLYQ++ +S++F                  ++LPGG+H FLC LM+
Sbjct: 17  ASRRPIEPKTPFIYKLYQYYQLSTSFLFAALLARWLIIFPLAGARFLPGGVHEFLCYLMI 76

Query: 61  YSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIV 120
           Y++VG I+W  K   L   IF++  LK++N IY V +LHFYDD+EH+ +LKN SYS FI+
Sbjct: 77  YASVGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNISYSVFII 136

Query: 121 GLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIPXXXXXXXXXXXXNTEIDNYHN 180
           GLS  Q Y+HW ++FK      R   +L  ++N  +  P            N +  N+H+
Sbjct: 137 GLSLNQAYHHWCKLFKRSG---RKKNTLVFKVNNLLGSPLLYLSEYYLLLLNVQNPNFHS 193

Query: 181 GPKTVLFNKFVLVVFIPLCLHLYK 204
            P   + N+ +L+++ P+ L +Y+
Sbjct: 194 TPLLDIINRIILIIYFPIALAVYR 217

>YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknown
           function [603 bp, 200 aa]
          Length = 200

 Score =  132 bits (331), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 69/194 (35%), Positives = 113/194 (58%), Gaps = 3/194 (1%)

Query: 11  RLVVKLYQFFHISSAFXXXXXXXXXXXXXXXXSRKYLPGGIHRFLCCLMVYSAVGNILWW 70
           +L  KLYQ++ ++++F                  ++LPGGIH FL  LM YS++  ++W 
Sbjct: 5   KLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWL 64

Query: 71  IKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIVGLSFTQMYYH 130
           ++  G  + + +R  LK++N IYLV+++HFYDD+EH+ +LKN SYSSFI+ LS +Q Y H
Sbjct: 65  LRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNASYSSFIISLSLSQAYCH 124

Query: 131 WNRIFKGPSPEPRSSKSLASRLNAFIMIPXXXXXXXXXXXXNTEIDNYHNGPKTVLFNKF 190
           W ++FK    + R   +L  ++N F+ +P            N ++ NYH+ P   + N+ 
Sbjct: 125 WCKLFKRKGVKER---TLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRV 181

Query: 191 VLVVFIPLCLHLYK 204
           VL+ + P+ L  YK
Sbjct: 182 VLLAYFPVLLTAYK 195

>CAGL0C02101g complement(214712..215305) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w, hypothetical start
          Length = 197

 Score =  112 bits (280), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 103/190 (54%), Gaps = 3/190 (1%)

Query: 15  KLYQFFHISSAFXXXXXXXXXXXXXXXXSRKYLPGGIHRFLCCLMVYSAVGNILWWIKMR 74
           KL+Q + + +                    +YLPGGIH +LC L+V  +V  +LW +   
Sbjct: 5   KLFQLYQLQTTLLYLALFGRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFH 64

Query: 75  GLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIVGLSFTQMYYHWNRI 134
           GL   I  R  LK++N +YLV  LHFYDD+EH+PLLK ++YS+FI+G+S  + Y HW R+
Sbjct: 65  GLRGFISQR-VLKSLNYLYLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRL 123

Query: 135 FKGPSPEPRSSKSLASRLNAFIMIPXXXXXXXXXXXXNTEIDNYHNGPKTVLFNKFVLVV 194
           FK      R ++    +  +++M+P            N ++ N+H   +  L N  VL++
Sbjct: 124 FKRGPNYKRETR--YWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLIL 181

Query: 195 FIPLCLHLYK 204
           + P+ L +YK
Sbjct: 182 YFPMALTVYK 191

>AFR247W [3439] [Homologous to ScYFR042W - SH]
           complement(884059..884694) [636 bp, 211 aa]
          Length = 211

 Score =  102 bits (254), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 100/196 (51%), Gaps = 4/196 (2%)

Query: 9   PRRLVVKLYQFFHISSAFXXXXXXXXXXXXXXXXSRKYLPGGIHRFLCCLMVYSAVGNIL 68
           P  +V + YQF+ +S  F                  +++PGGIH FL  L+  SAV  +L
Sbjct: 15  PNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGFLIYLLGGSAVLEVL 74

Query: 69  WWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNTSYSSFIVGLSFTQMY 128
           W I        ++ R  LK  N++Y VA++HFYDD+EH+P+LKN  YS FI+ +   Q  
Sbjct: 75  WMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIGYSIFILSIGMNQAL 134

Query: 129 YHWNRIFKGPSPEPRSSKSLASRLNAFIMIPXXXXXXXXXXXXNTEIDNYHNGPKTVLFN 188
           +H  R+F+      R  +S   R + F++ P            N +  ++H+ PK  + N
Sbjct: 135 HHGGRLFR----GRRRRRSWWWRSDTFVLQPALYISQFYLLLLNVQNPSFHSTPKLDIIN 190

Query: 189 KFVLVVFIPLCLHLYK 204
           + VLV ++PL L  ++
Sbjct: 191 RTVLVAYVPLALQCFR 206

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
           Saccharomyces cerevisiae YJL095w BCK1, start by
           similarity
          Length = 1447

 Score = 29.3 bits (64), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 19/64 (29%)

Query: 70  WIKMRGLAW-----------SIFNRHNLKNINLIYLVAILHFYDDF----EHSPLLKNTS 114
           W   R +AW           ++F RH L     + L+A    YD+F    +H P+ KN S
Sbjct: 173 WTLSRVIAWFKFHDFPDSWIAVFKRHQLCGQRFLRLLA----YDNFAIYEKHLPISKNAS 228

Query: 115 YSSF 118
           +  F
Sbjct: 229 FDKF 232

>KLLA0F00330g 17682..18794 similar to sp|P48581 Saccharomyces
           cerevisiae YOR368w RAD17 DNA damage checkpoint control
           protein singleton, hypothetical start
          Length = 370

 Score = 28.5 bits (62), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 55  LCCLMVYSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLKNT 113
           L CL  +   G +L  I   GL+++  N H +K    I LV     +  F +SP+ + +
Sbjct: 21  LNCLTPFGVKGEMLITIDKNGLSFAQENNHVIK----IQLVLSRELFQTFHYSPITETS 75

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.143    0.465 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,971,615
Number of extensions: 220462
Number of successful extensions: 604
Number of sequences better than 10.0: 13
Number of HSP's gapped: 594
Number of HSP's successfully gapped: 13
Length of query: 206
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 109
Effective length of database: 13,238,163
Effective search space: 1442959767
Effective search space used: 1442959767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)