Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0A01089g23323011921e-168
Sklu_2433.142502313127e-35
AFR248C3042383123e-34
Kwal_47.192042502202682e-28
YFR043C2372062446e-25
Scas_699.392612001852e-16
CAGL0C02079g2652371562e-12
KLLA0F22385g145334652.5
YJL130C (URA2)221439643.1
CAGL0B03641g98846643.2
Scas_631.1747476643.3
Kwal_27.1151895352616.9
YBL101C (ECM21)111727609.0
Kwal_0.5614558589.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0A01089g
         (230 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0A01089g 102036..102737 weakly similar to sp|P43615 Saccharo...   463   e-168
Sklu_2433.14 YFR043C, Contig c2433 23715-24467                        124   7e-35
AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [...   124   3e-34
Kwal_47.19204                                                         107   2e-28
YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein...    99   6e-25
Scas_699.39                                                            76   2e-16
CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces c...    65   2e-12
KLLA0F22385g 2091235..2095596 similar to sp|P22147 Saccharomyces...    30   2.5  
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    29   3.1  
CAGL0B03641g 363897..366863 similar to sp|P27895 Saccharomyces c...    29   3.2  
Scas_631.17                                                            29   3.3  
Kwal_27.11518                                                          28   6.9  
YBL101C (ECM21) [102] chr2 complement(24946..28299) Protein poss...    28   9.0  
Kwal_0.56                                                              27   9.8  

>KLLA0A01089g 102036..102737 weakly similar to sp|P43615
           Saccharomyces cerevisiae YFR043c hypothetical protein
           singleton, hypothetical start
          Length = 233

 Score =  463 bits (1192), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/230 (100%), Positives = 230/230 (100%)

Query: 1   MDNHKVLILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYD 60
           MDNHKVLILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYD
Sbjct: 1   MDNHKVLILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYD 60

Query: 61  VLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCY 120
           VLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCY
Sbjct: 61  VLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCY 120

Query: 121 FNENVIEEDELYELNSDLLVQNFEIVNWFDKPDPSMDKVGSERIKEIIDVHPWLSHPETL 180
           FNENVIEEDELYELNSDLLVQNFEIVNWFDKPDPSMDKVGSERIKEIIDVHPWLSHPETL
Sbjct: 121 FNENVIEEDELYELNSDLLVQNFEIVNWFDKPDPSMDKVGSERIKEIIDVHPWLSHPETL 180

Query: 181 KKNQGQINISPIDLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELSD 230
           KKNQGQINISPIDLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELSD
Sbjct: 181 KKNQGQINISPIDLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELSD 230

>Sklu_2433.14 YFR043C, Contig c2433 23715-24467
          Length = 250

 Score =  124 bits (312), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 129/231 (55%), Gaps = 13/231 (5%)

Query: 8   ILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYDVLQEWVN 67
           IL+  S EI+  ++ IS++F    D   SI +++ W+ KYY+T +D+YID YD L EW  
Sbjct: 21  ILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKYYKTNIDVYIDDYDSLDEWTR 80

Query: 68  DFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCYFNENVIE 127
           +F   E  +LR+V++G+I +F     +     L ++I+   ++   KF+I C  +   I+
Sbjct: 81  EFQQSEYNDLREVLAGVILLFNYRSEQTFSHFL-DIINSTSQN-DEKFYIACNVSSK-ID 137

Query: 128 EDELYELNSDLLVQNFEIVNWFDKPDPSM-DKVGSERIKEIIDVHPWLSHPETLKKNQGQ 186
            +E   L+ + +    E++NW +    +  DK+G ERI+EIID H W +  E   K Q  
Sbjct: 138 AEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIIDTHEW-TQCELDVKEQPT 196

Query: 187 INISPI--------DLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELS 229
           I +  +         L+  + KL +A+ RYQ+ ++  EAE+F ++I +EL+
Sbjct: 197 IGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQEISEELT 247

>AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [915
           bp, 304 aa]
          Length = 304

 Score =  124 bits (312), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 127/238 (53%), Gaps = 19/238 (7%)

Query: 1   MDNHKVLILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYD 60
           +  +K+LIL P     Q  +  I  +F  +  E++ I RDV+W  KYYE  LDLYID+Y+
Sbjct: 73  LPRNKILILAPAGKAYQAEV--IRDLFNIEASESDRIVRDVKWSNKYYEVDLDLYIDSYE 130

Query: 61  VLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFT-AKFFIGC 119
            LQ W  +F SDEC +LRDV++GI  VF++ +     E  + LI++    FT  +  + C
Sbjct: 131 SLQTWGAEFCSDECADLRDVVAGIFLVFEETED---AETFQQLIEDC--HFTDERVLVAC 185

Query: 120 YFNENVIEEDELYELNSDLLVQNFEIVNWFDKPDPSM-DKVGSERIKEIIDVHPWLSHPE 178
               ++   +    L   L V +  +V W ++    + ++ G ER++E++D+HPW     
Sbjct: 186 ----DLSSAEHPASLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWSERML 241

Query: 179 TLKKNQGQ--INISP----IDLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELSD 230
            +  +       + P    I LDS +T+++QA+ERY    D   A+ +  +I  EL++
Sbjct: 242 RMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELTE 299

>Kwal_47.19204
          Length = 250

 Score =  107 bits (268), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 110/220 (50%), Gaps = 8/220 (3%)

Query: 16  IQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYDVLQEWVNDFVSDECK 75
           + +    IS +F   + + + I  D++W TKYY   +DLYID++D L++WV  F + EC 
Sbjct: 32  VHDQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLYIDSFDSLRDWVQQFCNSECD 91

Query: 76  ELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCYFNENVIEEDELYELN 135
           ELRDV++G++ V   +     +E    L D   +     FF+      N  EE      N
Sbjct: 92  ELRDVLAGLVLVVPCKVEDADLETFTQLADCMAD--AESFFVVLKARSNPSEECTDSSEN 149

Query: 136 SDLLVQNFEIVNWFDKPDPSMDKV-GSERIKEIIDVHPWLSHPETLKKNQGQINI----S 190
             LL    EIV   D       +V G+ R++EIID + W +    L++      +    S
Sbjct: 150 K-LLANGVEIVCRGDSGRNEYGEVIGTNRVREIIDTYDWQTQLLKLRQPSATKELEDTSS 208

Query: 191 PIDLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELSD 230
            + L+  MT+L++A+ +Y   D S+E E+F   +  ELS+
Sbjct: 209 GLPLNEIMTRLQEARTKYLAMDSSEEREIFARDVAHELSE 248

>YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein of
           unknown function [714 bp, 237 aa]
          Length = 237

 Score = 98.6 bits (244), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 111/206 (53%), Gaps = 21/206 (10%)

Query: 36  SIARDVQWKTKYYETTLDLYIDTYDVLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKP 95
           SI +D  W+ +YY+   DLYID+   +  WV +F++ EC+ LR+V++GII +  D     
Sbjct: 38  SIVKDQTWENRYYKVHFDLYIDSCKEIPVWVEEFITPECEPLRNVMAGIILI-TDIRQTK 96

Query: 96  PVECLKNLIDERIEDFTAKFFIGCYFNENVIEEDELYELN---SDLLVQNFEIVNWFDKP 152
           P E L   +   I      F +    NE V E+DE+ ELN   S+      E VNW  + 
Sbjct: 97  PQELLHQFM---IAAHRNTFVVLANVNEEV-EQDEIDELNEIWSNAFTNVIEFVNW-KRS 151

Query: 153 DPSMD------KVGSERIKEIIDVHPWLS---HPETLKKNQGQINISPIDLDSFMTKLEQ 203
            P+++      K+G +RI+EIID H WL+    P T K  +   N  P  L+  +  L+ 
Sbjct: 152 KPTVNHNDYGEKLGLDRIQEIIDTHDWLNCEVQPAT-KIREEIPNEMP--LEQIIRNLQS 208

Query: 204 AKERYQTFDDSKEAELFIEKIIDELS 229
           A+ +Y++ ++S EA+ F  ++ DELS
Sbjct: 209 ARLKYKSIENSSEADAFANEMADELS 234

>Scas_699.39
          Length = 261

 Score = 75.9 bits (185), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 100/200 (50%), Gaps = 14/200 (7%)

Query: 32  DETESIARDVQWKTKYYETTLDLYIDTYDVLQEWVNDFVSDECKELRDVISGIIFVFKDE 91
           D ++SI + + WK KY+E  LDLYID ++  +E+V ++  DE  ELR VI+GII +  D 
Sbjct: 40  DSSDSIIKGIIWKNKYFELQLDLYIDEFEDFEEFVYEYCLDEMSELRSVIAGII-IIDDT 98

Query: 92  DHKPPVECLKNLIDERIEDFTAKFFIGCYFNENVIEED--------ELYELNSDLLVQNF 143
            H    + +  L  +   + ++ F +   F  +  EED        E    + D++ +  
Sbjct: 99  YHFEDNKLVNKLQTDSGSETSSSFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIAEYV 158

Query: 144 EIVNWFDKPDPSM-DKVGSERIKEIIDVHPWLSHPETLKKNQGQINISP----IDLDSFM 198
            +   F     S+ DKVG   IKE +D+H W  +    K +Q Q    P    +D+ + +
Sbjct: 159 PLDKHFRMEKNSLGDKVGVPGIKEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISAII 218

Query: 199 TKLEQAKERYQTFDDSKEAE 218
            +L  A+  +QT  D +EA+
Sbjct: 219 NQLRDARINFQTHKDQEEAK 238

>CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces
           cerevisiae YFR043c, hypothetical start
          Length = 265

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 115/237 (48%), Gaps = 18/237 (7%)

Query: 4   HKVLILL-PESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYDVL 62
           +KVL++   ES   ++ +  + T+F  Q  +  +I + + W TKYY    DLY+D    +
Sbjct: 35  NKVLVVFEGESTLFRDQL--LDTVFGVQ--DQGNIVKQLSWDTKYYAVEYDLYVDECVDI 90

Query: 63  QEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCYFN 122
             W+N+  SD+ +ELRD+++ II V   +  +   E    L D    +  +   +     
Sbjct: 91  HGWLNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQGNSVSVISVNTNSA 150

Query: 123 ENVIEE-DELYELNSDLLVQNFEIVNWFDKP--DPSMDKVGSERIKEIIDVHPWLSHPET 179
             V +  DE  EL++     + E +N+ D      + +  G  R+KEIID HPW      
Sbjct: 151 RQVKDTYDEFLELDA----SSIEFINYHDDRVEKETNECKGMARLKEIIDTHPWTDCKVV 206

Query: 180 LKKNQGQIN-ISPIDLDSFMTKLEQAKERYQTFDD-----SKEAELFIEKIIDELSD 230
           LK  +   + ++  DL+  +  L++AK  YQ   +     S+EAE F  ++  ++++
Sbjct: 207 LKNKESTSDKVNKPDLEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFALQMATDIAN 263

>KLLA0F22385g 2091235..2095596 similar to sp|P22147 Saccharomyces
           cerevisiae YGL173c KEM1 multifunctional nuclease, start
           by similarity
          Length = 1453

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 39  RDVQWKTKYYETTLDLYIDTYDVLQEWVNDFVSD 72
           R V+WK +YY+  LD  I+  D L+E   ++V  
Sbjct: 507 RFVEWKDQYYKDKLDFSINDTDSLKEMTENYVGG 540

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
           Multifunctional protein of pyrimidine biosynthesis
           pathway, contains glutamine amidotransferase,
           glutamine-dependent carbamylphosphate synthetase
           (CPSase), dihydroorotase-like (DHOase) domain, and
           aspartate carbamyltransferase (ATCase) [6645 bp, 2214
           aa]
          Length = 2214

 Score = 29.3 bits (64), Expect = 3.1,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 121 FNENVIEEDELYELNSDLLVQNFEIVNWFDKPDPSMDKV 159
           FNE  ++ D  YELN+   ++ F I N F K   S+DKV
Sbjct: 834 FNETDLDIDIDYELNNPTDMRVFAIANAFAKKGYSVDKV 872

>CAGL0B03641g 363897..366863 similar to sp|P27895 Saccharomyces
           cerevisiae YEL061c CIN8, Kinesin-like protein,
           hypothetical start
          Length = 988

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 36  SIARDVQWKTKYYETTLDLYIDTYDVLQEWVNDFVSDECKELRDVI 81
           S+ +DVQ   +  + T+ L+      LQ+ ++ F+SDE   +RD +
Sbjct: 591 SLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFISDEISNIRDTL 636

>Scas_631.17
          Length = 474

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 141 QNFEIVNWFDKPDPSMDKVGSERIKEIIDVHPWLSHPETLKKNQGQINISPIDLDSFMTK 200
           +N  + +    PDP     GS+  +E  D +     P T K  + +  I P  +D  M +
Sbjct: 91  KNSSLYHGHSNPDPISSTDGSKIEEEDEDFYT----PATAKLIEARKFILPYSIDRSMKR 146

Query: 201 LEQAKERYQTFDDSKE 216
           L+  KER   FD  KE
Sbjct: 147 LQSMKERALNFDIGKE 162

>Kwal_27.11518
          Length = 953

 Score = 28.1 bits (61), Expect = 6.9,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 26/52 (50%)

Query: 74  CKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCYFNENV 125
           C E  + I G I  +   + KP ++C +  I+ R  D +   ++G +  EN+
Sbjct: 223 CGECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENI 274

>YBL101C (ECM21) [102] chr2 complement(24946..28299) Protein
           possibly involved in cell wall structure or biosynthesis
           [3354 bp, 1117 aa]
          Length = 1117

 Score = 27.7 bits (60), Expect = 9.0,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 19/27 (70%)

Query: 14  LEIQEHIAFISTIFQKQYDETESIARD 40
           + I E + F+S  ++ +YD+T+ +A+D
Sbjct: 626 VSITERVTFVSKGYEYEYDQTDPVAKD 652

>Kwal_0.56
          Length = 145

 Score = 26.9 bits (58), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 168 IDVHPWLSH--PETLKKNQGQINISPIDLDSFMTKLEQAKERYQTFDDSKEAELFIEK 223
            D+ P +SH  PE LK N G     P+D   + TKL++  +  +   +  + + ++E+
Sbjct: 88  TDLKPLVSHNLPE-LKHNYGGFQKGPLDSQLYFTKLKEYIKNGKVQTEGTDVKCYVER 144

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,786,254
Number of extensions: 430375
Number of successful extensions: 1512
Number of sequences better than 10.0: 40
Number of HSP's gapped: 1500
Number of HSP's successfully gapped: 40
Length of query: 230
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 132
Effective length of database: 13,203,545
Effective search space: 1742867940
Effective search space used: 1742867940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)